hmctn

Overview
Namehmctn (AGS83416.1)
Smed IDSMED30010595
Length (bp)1969
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010595

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010595SMESG000006452.1 SmedASXL_010562SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010595SMESG000006452.1 dd_Smed_v6_31887_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory cellSMED30010595SMESG000006452.1 KF134119smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30010595SMESG000006452.1 KF134119smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30010595SMESG000006452.1 KF134119smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30010595SMESG000006452.1 KF134119smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hmctn vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 75.0998 bits (183), Expect = 3.881e-13
Identity = 48/179 (26.82%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L++ N+ ++D G Y C+      +  K   L V  P  I+    S +++ V E+  V ++C + GIP P+I+W+   K+G    L N+ + I      + +   +    G YTC+V N   G++ K F L +   P I +G + +E  + +E     +   + G+P+  I W K+ + L
Sbjct: 2348 LQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWF---KDGWPVSLSNSVR-ILSGGRMLRLMQTTMEDAGQYTCVVRNAA-GEERKIFGLSVLVPPHI-VGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPL 2520          

HSP 2 Score: 74.7146 bits (182), Expect = 5.013e-13
Identity = 51/177 (28.81%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   ++ D G Y CL S+    D K   +RV VP  I  T   +D  +++ R+ V + C S  +P P I+W  N       RL    +  I      + I N       +YTC+  N + GK ++ F L +   P+IK G   +     + T+++ I  G P   I W K+  +L
Sbjct: 3584 LRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQ-VTLECKSDAVPPPVITWLRN-----GERLQATPRVRILSGGRYLQINNADLGDTANYTCVASN-IAGKTTREFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEGVPTPRITWRKDGAVL 3753          

HSP 3 Score: 70.8626 bits (172), Expect = 8.143e-12
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--QAIINGHPINSIQWEKNSKILNLSANKCFYIGR 1241
            LK+      D G Y C         +K   + VLVP  I+ T    +  +V  R+ V + C   G P P+I W+   K+G    L +   ++      + + N  R   G Y C V N   GKQ+K  KL I+  PSIK GN   + S    ++I  +    G P+ +I W K+ + + +S+++  YI +
Sbjct: 1416 LKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRD-VALECQVKGTPFPDIHWF---KDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAA-GKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPI-MSSSQALYIDK 1599          

HSP 4 Score: 67.0106 bits (162), Expect = 1.161e-10
Identity = 74/309 (23.95%), Postives = 124/309 (40.13%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN------GHPINSIQWEKNSKILNLSAN-KCFYIGRTKKYCFYLDKTGHFQEQKAQLWIY-----NLSAIDFTSYRLLIVSP--FGNIFGTTKIIEFK 1406
            T   T  P  TI W +          H+ +       ++I        +L+I   + +D G Y C+ S  +   +K   L + VP  +       D + V   E V + CN+ GIP+P I W  + K   +G   R+      +  N +T+ I+       G YTC+  N   G++ + F L ++  P+I+   D  E+     T++   IN      G P   I W KN   L LS++ +    G+  +           + Q + + +Y     N + +D   Y L + +P    N  GT +I   K
Sbjct: 3172 TCDATGIPPPTIAWLK---------NHKRIENSDSLEVRILSGG---SKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSD-VSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERI-----RVSANGSTLNIYGALTSDTGKYTCVATNPA-GEEDRIFNLNVYVTPTIRGNKDEAEKLM---TLVDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIV---------RAQVSDVAVYTCVASNRAGVDNKHYNLQVFAPPNMDNSMGTEEITVLK 3449          

HSP 5 Score: 66.6254 bits (161), Expect = 1.436e-10
Identity = 57/215 (26.51%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDI-FVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            P   I WR+  D   L   H       R+S  I ++ +    L I +  +TD G Y C+ +     DR+ + L+V VP  I P  T+   + V    +  ++C + GIP P+I+W    KNG    +  N+     ++  ++ I + S     +Y C V N   G   ++  L +   PSI         ++    +I    +G P  SI W KN
Sbjct: 3740 PTPRITWRK--DGAVLAGNH------ARYS--ILENGF----LHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTN---MTVIVNVQTTLACEATGIPKPSINWR---KNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGA-GDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKN 3933          

HSP 6 Score: 64.3142 bits (155), Expect = 6.932e-10
Identity = 53/186 (28.49%), Postives = 79/186 (42.47%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK--DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSK 1199
            L+I   K++D GEY C+   +    +K   L V VP  I    +    ++ V+E   V + C S  +P P I+WY   KNG   R+       +I  +   + I        G Y C   N V G+  K+F L ++  PSI        +   RE +++ I N         G P  +I W KN K
Sbjct: 3020 LQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWY---KNG---RMITESTHVEILADGQMLHIKKAEVSDTGQYVCRAIN-VAGRDDKNFHLNVYVPPSI--------EGPEREVIVETISNPVTLTCDATGIPPPTIAWLKNHK 3190          

HSP 7 Score: 61.6178 bits (148), Expect = 5.337e-9
Identity = 51/190 (26.84%), Postives = 79/190 (41.58%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD---HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII------NGHPINSIQWEKNSKILNLSAN 1220
            L+I   K+ D G Y C+   E   D     +RVLVP +I   G + D    + V   +  +I C S G P+P  SW    K+G    L ++      N   + I N      G Y C+ +N   G   K F L +   PS+     +  +S+    ++   I      +G P   + W KN + + L+ N
Sbjct: 2833 LQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPII--KGANSDLPEEVTVLVNKSALIECLSSGSPAPRNSWQ---KDG-QPLLEDDHHKFLSNGRILQILNTQITDIGRYVCVAENTA-GSAKKYFNLNVHVPPSV-----IGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTN 3010          

HSP 8 Score: 61.2326 bits (147), Expect = 5.860e-9
Identity = 43/175 (24.57%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  702 TDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI--KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            +D G+Y C+ +     + +   L V V   I       + L+      + I C + G P P I+W    KNGL   L ++ + +      + I          YTC+  N+  G  +K + L+++  P++   MG + I   +G  T +  I +G P  S+ W ++ + L L A+
Sbjct: 3312 SDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSINIECRATGTPPPQINWL---KNGLPLPLSSHIR-LLAAGQVIRIVRAQVSDVAVYTCVASNRA-GVDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAH 3481          

HSP 9 Score: 61.2326 bits (147), Expect = 6.273e-9
Identity = 60/235 (25.53%), Postives = 108/235 (45.96%), Query Frame = 3
Query:  537 QLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
             +T SP  TI+W +  D Q +         D+R   KI  +     +L I   ++++ G Y C+ +      +K  ++ V VP  I  +G S+   +V + + V + C + GIP+P+I+W  +    +N    N K  I  +   + I        G YTC+  N   G+  +  +L +   PS+    KM N+ +  S   +   +A   G+P+  I W K++++L+ S +  F
Sbjct: 1757 HVTGSPPPTIMWLK--DGQLI---------DERDGFKILLNG---RKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSER--VVVKYKPVALQCIANGIPNPSITWLKD-DQPVNTAQGNLK--IQSSGRVLQIAKTLLEDAGRYTCVATNAA-GETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAA--GNPVPVITWYKDNRLLSGSTSMTF 1969          

HSP 10 Score: 60.4622 bits (145), Expect = 1.118e-8
Identity = 44/179 (24.58%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHL---IVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I      D G Y C+           +KL V VP VI P      HL   ++   + + +SC + G+P P+I+W+ + +      +  + +   ++  ++ I  V     G YTC+  N V G  S S KL +   P I+        ++  + ++  + +G P  +I W+K++ +L
Sbjct: 4043 LQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVISP------HLKEYVIAVDKPITLSCEADGLPPPDITWHKDGR-----AIVESIRQRVLSSGSLQIAFVQPGDAGHYTCMAAN-VAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLL 4209          

HSP 11 Score: 58.5362 bits (140), Expect = 4.139e-8
Identity = 53/214 (24.77%), Postives = 92/214 (42.99%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI-----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGN--DVIEQSQGRETMIQAII------NGHPINSIQWEKN-------SKILNLSANKCFYIGRTK 1247
            L+I N +  + G Y C+ + E     K  +++V +P +I        G S   + +K    + + C +Y IPS ++SWY   K+G   +  ++  +I  N +T+ I        G YTC+  N + G+    F + I   PS +    +GN  D     + ++ +I   I      N  P  ++ W K+        K+L L   +   I R K
Sbjct: 2631 LQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWY---KDGQPLK-SDDHVNIAANGHTLQIKEAQISDTGRYTCVASN-IAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAK 2839          

HSP 12 Score: 58.151 bits (139), Expect = 5.765e-8
Identity = 65/276 (23.55%), Postives = 112/276 (40.58%), Query Frame = 3
Query:  444 SATNAESDCEY---VQILNQIAKSKPKKDSR--RTLQLTFS------PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK--NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            S+   + D EY   V +   IA +   +D    R  Q+T        P   I W R  ++   T + ++L+  +               L+I+N  + D   Y C+ S       +   L V VP  I   G  Q  L++   +  ++ C + G+P+P I+W  +     G +AR Y+  ++ F++  +  + +  R     Y C+  N   G   +   L++   PSI  G   +      +T +     G P  SI W KN  +LN+  N+  Y
Sbjct: 3602 SSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQATPRVRILSGGRY--------------LQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNI--KGGPQS-LVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHAR-YSILENGFLHIQSAHVTDTGR-----YLCMATNAA-GTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSY 3853          

HSP 13 Score: 58.151 bits (139), Expect = 5.765e-8
Identity = 46/176 (26.14%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I  ++  D G Y C+ +        + KL V VP  I  T   + H  V E  + I+ C + GIP+P I+W  +  N L A L    K     Y  + + NV    +G YTC+ +N   G+ + +  L +   P+       +  ++G +  +     G P+  + W  N+ I+
Sbjct: 4133 LQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRST---EGHYTVNENSQAILPCVADGIPTPAINWKKD--NVLLANLLG--KYTAEPYGELILENVVLEDSGFYTCVANNAA-GEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNII 4300          

HSP 14 Score: 55.8398 bits (133), Expect = 3.345e-7
Identity = 49/174 (28.16%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII---NGHPINSIQWEK 1190
            L + + +I+D G Y C+        ++ + LRV VP  I+  G  Q+ + V   + V + C S  IP P ++W    K+G +  L      I  N + + I +      G YTC   N V GK  K++ + IW  P+I  G+D + Q    E  + +++   +G P  ++ W+K
Sbjct: 2068 LALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIM--GEEQN-VSVLISQAVELLCQSDAIPPPTLTWL---KDG-HPLLKKPGLSISENRSVLKIEDAQVQDTGRYTCEATN-VAGKTEKNYNVNIWVPPNIG-GSDELTQLTVIEGNLISLLCESSGIPPPNLIWKK 2232          

HSP 15 Score: 55.4546 bits (132), Expect = 3.964e-7
Identity = 44/184 (23.91%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            +L+I   + +D   Y C+ S      +K   L+V +   I  +G+    +IV   + + + C   GIP P ++W  +    + A+      +I    + + + N+     G Y C+  N V G   K + L +   PSI +GN    + I   +     +    +G P+ SI W K+   ++LS
Sbjct: 2253 QLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAK----GVEILDEGHILQLKNIHVSDTGRYVCVAVN-VAGMTDKKYDLSVHAPPSI-IGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLS 2430          

HSP 16 Score: 55.0694 bits (131), Expect = 5.028e-7
Identity = 50/184 (27.17%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTS-QDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL ++N+ + D G Y C+ +     D  TV L V V    LPT T     + + + E++ +SC + GIP P ++W  N  N + A       D    ++ + I  VS+  +G+Y C  +N V   ++  F      EP +  G+   + IE   G   ++   + G P  +IQW +    + +S
Sbjct: 4223 ELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHV----LPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFN-NNIIPAHF-----DSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYV--KEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPTPTIQWNRKGVDIEIS 4393          

HSP 17 Score: 53.9138 bits (128), Expect = 1.155e-6
Identity = 46/203 (22.66%), Postives = 84/203 (41.38%), Query Frame = 3
Query:  501 KSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGT--SQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN 1103
            K K K+    T ++T +P   I W +          H +++   RF             L+I N+++   G Y CL S+      ++  L V V   I   G+  + + + V       + C +Y  P   I+W+   K+G       N + I     T+ I N    + G Y+C+  N+  G+  K ++++++  P I  G+
Sbjct: 2490 KVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGG-RF-------------LQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVGSDGNPEDVTVILNSPTSLVCEAYSYPPATITWF---KDGTPLESNRNIR-ILPGGRTLQILNAQEDNAGRYSCVATNEA-GEMIKHYEVKVYIPPIINKGD 2673          

HSP 18 Score: 53.5286 bits (127), Expect = 1.722e-6
Identity = 55/223 (24.66%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD--HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIE--QSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            P  T+ W        L   H LL   K+  L I ++  VL   KI++ ++ D G Y C  +       K   + + VP  I   G S +   L V E   + + C S GIP PN+ W       L   +   +  I      + I    +     Y+C+  N V G   K + L+++  P+I   G+   E   ++G+   ++  + G P  ++ W K+   L
Sbjct: 2131 PPPTLTW--------LKDGHPLL---KKPGLSISENRSVL---KIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNI---GGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSM--GRVRILSGGRQLQISIAEKSDAALYSCVASN-VAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPL 2333          

HSP 19 Score: 52.373 bits (124), Expect = 3.200e-6
Identity = 50/192 (26.04%), Postives = 78/192 (40.62%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVI-----------ISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTV-TIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            L I ++   D+GEY C+   E     +   L+V VP VI            K++E+V            + C   G PSP I WY +     N ++  +     VN   +  +F  +    G Y+C   N + G   K F +++   P+I   N   E S    R+  ++  + G P   I W K+ K L L
Sbjct: 1323 LVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVI------------KDKEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKD-----NVQVTESSTIQTVNNGKILKLFRATPEDAGRYSCKAIN-IAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFL 1496          

HSP 20 Score: 52.373 bits (124), Expect = 3.857e-6
Identity = 63/269 (23.42%), Postives = 106/269 (39.41%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIG-------------RTKKYCFYLDKTGHFQEQKAQLWIY 1313
            P+ TI WRR  +    +         + FS+    S      L I NL  +D G Y C    E    +   +  V V  ++ P  G S     V E +++ + C    G P P   W  N     +A L  N      +  ++ I  V     G YTC+  N V G  +K+  + +   P+I+ G  ++   +G    +    +G+P  S+ W K  ++++ S+ K F  G              + +Y      T  + ++K QL +Y
Sbjct:  820 PEPTIKWRRLDNMPIFS---------RPFSVSSI-SQLRTGALFILNLWASDKGTYIC--EAENQFGKIQSETTVTVTGLVAPLIGISPSVANVIEGQQLTLPCTLLAGNPIPERRWIKN-----SAMLLQNPYITVRSDGSLHIERVQLQDGGEYTCVASN-VAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGELISTSSAK-FSAGADGSLYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVY 1069          
BLAST of hmctn vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 69.707 bits (169), Expect = 7.535e-12
Identity = 46/183 (25.14%), Postives = 84/183 (45.90%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI--LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSA 1217
            L++   +++D G Y C        D+K V+L VLVP      P G  QD ++V+  +K ++SC +  +P P ++WY   K+G    +   +         + I        G Y+C V N V G+  ++F L +   P+ +    + + Q  G   ++   ++G P  ++ W K+   +  SA
Sbjct:   34 LQLGRARLSDSGMYTCEALNAAGRDQKLVQLSVLVPPAFRQAPRG-PQDAVLVRVGDKAVLSCETDALPEPTVTWY---KDG-QPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSN-VAGEAVRTFTLTVQVPPTFENPKTETVSQVAGSPLVLTCDVSGVPAPTVTWLKDRMPVESSA 210          

HSP 2 Score: 62.3882 bits (150), Expect = 1.335e-9
Identity = 46/231 (19.91%), Postives = 99/231 (42.86%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND---VIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            T  ++  P  T+ W +       +  H ++++  R              L++  L+    G Y C+    +   RK   + VLV   I  +G +++H ++ E ++V + C + G P P+++W  +  + L   +  + +  +++  ++ +  +     G+YTC+  N   G+ ++   + +   P+IK G D    +    G    +   + G P   + W K+   L LS
Sbjct:  186 TCDVSGVPAPTVTWLKDRMPVESSAVHGVVSRGGR--------------LQLSRLQPAQAGTYTCVAENTQAEARKDFVVAVLVAPRIRSSGVAREHHVL-EGQEVRLDCEADGQPPPDVAWLKD-GSPLGQDMGPHLR-FYLDGGSLVLKGLRASDAGAYTCVAHNPA-GEDARLHTVNVLVPPTIKQGADGSGTLVSRPGELVTMVCPVRGSPPIHVSWLKDGLPLPLS 398          
BLAST of hmctn vs. Ensembl Human
Match: NEGR1 (neuronal growth regulator 1 [Source:HGNC Symbol;Acc:HGNC:17302])

HSP 1 Score: 66.6254 bits (161), Expect = 4.076e-11
Identity = 50/180 (27.78%), Postives = 76/180 (42.22%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPS---IKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
             L+I N+ +TDDG Y C   T+       V L V VP  I       + + V E   V ++C + G P P+ISW          R  +     F N   + I+ ++R   G Y C  +N V     +  K+ + + P+   IK G      + GR  +I+    G P  + +W K  K L
Sbjct:  102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDI---SNDMTVNEGTNVTLTCLATGKPEPSISW----------RHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGT----VTPGRSGLIRCEGAGVPPPAFEWYKGEKKL 264          

HSP 2 Score: 53.5286 bits (127), Expect = 7.217e-7
Identity = 43/134 (32.09%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  684 IDNLKITDD--GEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV-NYNT---VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKL 1067
            +D   IT D  GEYEC  S E  +    V+ +V V     PT        V      +I C   G+P P   WY   K     +L+N ++ I + N++T   +T+ NV++ H G+YTC+  NK+ G  + S  L
Sbjct:  188 LDIYGITRDQAGEYEC--SAENDVSFPDVR-KVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEK-----KLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKL-GTTNASLPL 312          
BLAST of hmctn vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 64.6994 bits (156), Expect = 6.441e-10
Identity = 44/173 (25.43%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV-NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND---VIEQSQGRETMIQAIINGHPINSIQW 1184
            L+I    + D+G Y+C+  +      +  +LRV  P  I  +  + + + V E   V + C + G+P+PNI+W+   K+G  A L  + K ++      + +        G YTC   N V G   K+ +L+++  P+I+       V++   GR   ++ +  GHP  ++ W
Sbjct: 1494 LRITGSHVGDEGRYQCVAFSPAGQQARDFQLRVHAPPTIWGSNETGE-VAVMEDHLVQLLCEARGVPTPNITWF---KDG--ALLPTSTKVVYTRGGRQLQLGRAQSSDAGVYTCKASNAV-GAAEKATRLDVYVPPTIEGAGGRPYVVKAVAGRPVALECVARGHPSPTLSW 1659          

HSP 2 Score: 63.929 bits (154), Expect = 9.208e-10
Identity = 46/183 (25.14%), Postives = 84/183 (45.90%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI--LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKM-GNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSA 1217
            L++   +++D G Y C        D+K V+L VLVP      P G  QD ++V+  +K ++SC +  +P P ++WY   K+G    +   +         + I        G Y+C V N V G+  ++F L +   P+ +    + + Q  G   ++   ++G P  ++ W K+   +  SA
Sbjct: 3001 LQLGRARLSDSGMYTCEALNAAGRDQKLVQLSVLVPPAFRQAPRG-PQDAVLVRVGDKAVLSCETDALPEPTVTWY---KDG-QPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSN-VAGEAVRTFTLTVQVPPTFENPKTETVSQVAGSPLVLTCDVSGVPAPTVTWLKDRMPVESSA 3177          

HSP 3 Score: 60.8474 bits (146), Expect = 8.995e-9
Identity = 50/172 (29.07%), Postives = 72/172 (41.86%), Query Frame = 3
Query:  711 GEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNAR--LYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DV---IEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            G Y C+ +       + V+L V VP  I PT T   H I  E     + C + G+P+P I+W     N L +R   YN  K+      T+ I   S    G+Y C   N V G  S+  +L +  +P I M      DV   +    G E  +     G P   + W K+S+
Sbjct:  950 GRYSCVATNTAGSQHRDVELVVQVPPRIHPTAT---HHITNEGVAASLPCVASGVPAPTITWTKE-TNALTSRGPHYNVSKE-----GTLLIAQPSAQDAGAYVCTATNTV-GFSSQEMRLSVNTKPRIHMNGSRNADVPLQVTAKAGEEVTLDCEAKGSPPPLVTWTKDSR 1111          

HSP 4 Score: 59.6918 bits (143), Expect = 1.791e-8
Identity = 56/215 (26.05%), Postives = 87/215 (40.47%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWY-ANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            SPK  +VW +  D Q L F+ Q      + + ++  SN +L+          D  ++EC+ S E     +  ++ V VP  I      Q    V     V+++C+S GIP+P +SW  A  + G     Y            + I     IH G YTC   N   G   K   L +   P +K    V+      E ++    +G P  +I W+K
Sbjct: 3784 SPKPLVVWWK--DGQKLDFRLQ------QGAYRLLPSNALLLTAP----GPQDSAQFECVVSNEVGEAHRLYQVTVHVPPTI---ADDQTDFTVTMMAPVVLTCHSTGIPAPTVSWSKAGAQLGARGSGYRVSPS-----GALEIGQALPIHAGRYTCSARNSA-GVAHKHVFLTVQASPVVKPLPSVVRAVAEEEVLLPCEASGIPRPTITWQK 3977          

HSP 5 Score: 59.3066 bits (142), Expect = 2.625e-8
Identity = 54/231 (23.38%), Postives = 97/231 (41.99%), Query Frame = 3
Query:  525 RRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRI---HNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKM-GNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            R T   T +P  T++W +  +          ++      L+++    VL    + + + +D G Y C+  +    DR+ V L+V +P  IL     + ++ V   E V + C S+ +P P +SW   WK+G   R    +  + ++ +   +  V R      G YTC   N+  G   K + L +W  P   +  +  +   +G  T +     G P   I W K+ + L
Sbjct: 2004 RLTCNATGAPSPTLMWLKDGNP---------VSPAGTPGLQVFPGGRVLT---LASARASDSGRYSCVAVSAVGEDRQDVVLQVHMPPSIL---GEELNVSVVANESVALECQSHAMPPPVLSW---WKDG---RPLEPRPGVHLSADK-ALLQVDRADVWDAGHYTCEALNQA-GHSEKHYNLNVWVAPVFPLRESHTLTVREGHPTRLSCECRGVPFPKISWRKDGQPL 2211          

HSP 6 Score: 57.3806 bits (137), Expect = 9.553e-8
Identity = 45/177 (25.42%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  693 LKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKER---EKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV-NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKIL 1205
            ++ +D G Y C  S    +D   V+LRVL P    P   + +   + ER   E   + C + G P P ++    W+ G ++   + +  + V    ++ + +VS   +G Y C   N+V G  S+  KL ++  PSI+        S   G+   ++   NG P+  I W K+++++
Sbjct: 1218 IRTSDAGRYRCEASNSAGVDAWEVELRVLEP----PHWGADETSGLLERVAGENASLPCPARGTPKPQVT----WRKGPSSEPLHGQPGVAVLEEGSLFLASVSPADSGDYECQATNEV-GSTSRRAKLVVYVPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLI 1385          

HSP 7 Score: 56.225 bits (134), Expect = 2.272e-7
Identity = 47/220 (21.36%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGL----NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            +P+  I W +  D Q LT              ++  ++     L+++N+++ D G Y CL  +      K+ ++RV  P  I+ P G     ++     ++++ C+    P+P I+W+   ++G+    +A     ++  F+    +     S   +G Y+C   N   G  S +F++EI   P+I+ G   +  S  +  ++    +G P   + W K+
Sbjct: 3530 TPQPNITWHK--DGQALT--------------RLENNSRATRVLRVENVQVRDAGLYTCLAESPAGAIEKSFRVRVQAPPNIVGPRGPR--FVVGLAPGQLVLECSVEAEPAPKITWH---RDGIVLQEDAHTQFPERGRFLQLQAL-----STADSGDYSCTARNAA-GSTSVAFRVEIHTVPTIRSGPPAVNVSVNQTALLPCQADGVPAPLVSWRKD 3722          

HSP 8 Score: 55.4546 bits (132), Expect = 3.504e-7
Identity = 46/187 (24.60%), Postives = 85/187 (45.45%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI--KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
            L+++ +   D G Y C+  +E    R+  +L V+ P  I  +G   + L +     + + C++ G P PNI+W+   K+G    RL NN +   V    + + NV     G YTC+ ++   G   KSF++ +   P+I    G   +      + +++  +   P   I W ++  +L   A+  F
Sbjct: 3466 LQLEAVGAGDSGTYSCVAVSEAGEARRHFQLTVMEPPHIEDSGQPTE-LSLTPGAPMELLCDAQGTPQPNITWH---KDGQALTRLENNSRATRV----LRVENVQVRDAGLYTCLAESPA-GAIEKSFRVRVQAPPNIVGPRGPRFVVGLAPGQLVLECSVEAEPAPKITWHRDGIVLQEDAHTQF 3643          

HSP 9 Score: 53.1434 bits (126), Expect = 1.964e-6
Identity = 42/187 (22.46%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKN-----GLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND---VIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L++  L+    G Y C+    +   RK   + VLV   I  +G +++H ++ E ++V + C + G P P+++W  +        G + R Y       ++  ++ +  +     G+YTC+  N   G+ ++   + +   P+IK G D    +    G    +   + G P   + W K+   L LS
Sbjct: 3188 LQLSRLQPAQAGTYTCVAENTQAEARKDFVVAVLVAPRIRSSGVAREHHVL-EGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLRFY-------LDGGSLVLKGLRASDAGAYTCVAHNPA-GEDARLHTVNVLVPPTIKQGADGSGTLVSRPGELVTMVCPVRGSPPIHVSWLKDGLPLPLS 3365          

HSP 10 Score: 52.373 bits (124), Expect = 3.325e-6
Identity = 52/186 (27.96%), Postives = 81/186 (43.55%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGL----NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQG---RETMIQAIINGHPINSIQWEKNSKILNL 1211
            L+I  ++  + G Y C  S E   D    +L VL P VIL  T    + + V     V + C + G P P ISW    +NGL    + RL   +    +  +T  + + +     SY C+ +N+  G   K F L +   P I  G D +EQ          +   ++ HP   + W K+S+ L+L
Sbjct: 2814 LQIPLVRAENAGRYSCKASNEVGEDWLHYELLVLTPPVILGDTEELVEEVTVNASSTVSLQCPALGNPVPTISWL---QNGLPFSPSPRLQVLEDGQVLQVSTAEVADAA-----SYMCVAENQA-GSAEKLFTLRVQVPPRIA-GLD-LEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSL 2988          

HSP 11 Score: 51.9878 bits (123), Expect = 4.708e-6
Identity = 36/148 (24.32%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIE 1115
            L++    ++  G Y C+ +       K  +L VL+   IL     ++ + + V     + + C +   PSPNI+W    K+G       N + +    + + I N  +   G YTC+V N++ G+  K++ +E+   PSI   + + E
Sbjct: 2509 LQVLQANLSSAGHYSCIAANAVGEKTKHFQLSVLLAPTILGGAEDSADEEVTVTVNNPISLICEALAFPSPNITWM---KDGAPFEASRNIQ-LLPGTHGLQILNAQKEDAGQYTCVVTNEL-GEAVKNYHVEVLIPPSISKDDPLAE 2651          
BLAST of hmctn vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 63.5438 bits (153), Expect = 7.838e-10
Identity = 58/229 (25.33%), Postives = 92/229 (40.17%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARL--YNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DV---IEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            ++  R + +++     + L    R S++   S      L +D       G Y C+ +       + V+L V VP  I PT T   H I  E     + C + G+P+P I+W     N L +R   YN  K+      T+ I   S    G+Y C   N V G  S+  +L +  +P I M      DV   +    G E  +     G P   + W K+S+ +    N+
Sbjct:  171 VLAGRPLPERHWLKDGRPLPPGSRHSIRADGS------LHLDRALQEHAGRYSCVATNTAGSQHRDVELVVQVPPRIHPTAT---HHITNEGVAASLPCVASGVPAPTITWTKE-TNALTSRGPHYNVSKE-----GTLLIAQPSAQDAGAYVCTATNTV-GFSSQEMRLSVNTKPRIHMNGSRNADVPLQVTAKAGEEVTLDCEAKGSPPPLVTWTKDSRPVPPITNR 383          
BLAST of hmctn vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 64.6994 bits (156), Expect = 9.122e-11
Identity = 44/182 (24.18%), Postives = 81/182 (44.51%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYA--------NWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            L I N++ +D G Y C  +TE  I   T +L V VP V+  + ++   + V+E   V ++C + G P+P + W          N   G  A +++           + +  VSR H   Y C+  N +   +S + KL + + P ++  ++ ++ S G    +       P   + WEK+ +
Sbjct:  156 LTIKNVQESDRGNYSCQINTEP-ITLSTGELDVKVPPVV--SRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGP--------VLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGE 326          
BLAST of hmctn vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 64.6994 bits (156), Expect = 9.937e-11
Identity = 44/182 (24.18%), Postives = 81/182 (44.51%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYA--------NWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            L I N++ +D G Y C  +TE  I   T +L V VP V+  + ++   + V+E   V ++C + G P+P + W          N   G  A +++           + +  VSR H   Y C+  N +   +S + KL + + P ++  ++ ++ S G    +       P   + WEK+ +
Sbjct:  156 LTIKNVQESDRGNYSCQINTEP-ITLSTGELDVKVPPVV--SRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGP--------VLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGE 326          
BLAST of hmctn vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 64.6994 bits (156), Expect = 1.027e-10
Identity = 46/189 (24.34%), Postives = 84/189 (44.44%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYA--------NWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            L I N++ +D G Y C  +TE  I   T +L V VP V+  + ++   + V+E   V ++C + G P+P + W          N   G  A +++           + +  VSR H   Y C+  N +   +S + KL + + P ++  ++ ++ S G    +       P   + WEK+ + +  S N
Sbjct:  156 LTIKNVQESDRGNYSCQINTEP-ITLSTGELDVKVPPVV--SRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGP--------VLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNN 333          
BLAST of hmctn vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 63.929 bits (154), Expect = 1.446e-10
Identity = 46/189 (24.34%), Postives = 84/189 (44.44%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYA--------NWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            L I N++ +D G Y C  +TE  I   T +L V VP V+  + ++   + V+E   V ++C + G P+P + W          N   G  A +++           + +  VSR H   Y C+  N +   +S + KL + + P ++  ++ ++ S G    +       P   + WEK+ + +  S N
Sbjct:  105 LTIKNVQESDRGNYSCQINTEP-ITLSTGELDVKVPPVV--SRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGP--------VLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNN 282          
BLAST of hmctn vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 64.3142 bits (155), Expect = 2.674e-10
Identity = 39/176 (22.16%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  672 MELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            + L+IDN+K   +G Y C+   +     +   + +  P  ++    + + + V E  +  I C  +G P P ++W  + +   +  L  + K  +++    T+ +      G+YTCI  NK  G+   +  +E+   P I+    V++  +G   M+   + G P+  + W++N K
Sbjct: 3089 LSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVV---MASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLAD-----GGTYTCIATNKA-GESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGK 3255          

HSP 2 Score: 63.1586 bits (152), Expect = 7.052e-10
Identity = 44/193 (22.80%), Postives = 82/193 (42.49%), Query Frame = 3
Query:  636 FSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIV-KEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            ++  + Q +  L  L +    + D G Y C+ + +    + T  + VLVP    P    ++ ++  KE    ++ C   G P P ++W    +NG     +N           + I N +R   G Y+CI  N+  G     F ++++ +P+ +         +G    I+  I+GHP  +I W K  +  N+
Sbjct: 3167 YTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVP----PRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWK---RNGKEIEQFNP---------VLHIRNATRADEGKYSCIASNEA-GTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNM 3342          

HSP 3 Score: 62.003 bits (149), Expect = 1.335e-9
Identity = 54/179 (30.17%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  684 IDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISC-----NSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG-NDVIEQ-SQGRETMIQAIINGHPINSIQWEKNSK 1199
            I+N+++TD G Y C  +           L VL P      GT     I +E + + ++C             ++SW  + +  L+  L +N  DI  +   +TI   S  + G YTCI  N+  G+ S  FK+EI   P I +  NDV  Q +  + T+++  + GHP  SI+W KN K
Sbjct: 3633 IENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPT--IKREGDTITLTCPIKLAEDIADQVMDVSWTKDSR-ALDGDLTDNV-DISDDGRKLTISQASLENAGLYTCIALNRA-GEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGK 3806          

HSP 4 Score: 62.003 bits (149), Expect = 1.491e-9
Identity = 47/183 (25.68%), Postives = 81/183 (44.26%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKM-GNDVIEQSQGRETMIQAIIN-----GHPINSIQWEKNSKILN 1208
            + I+  K++D G+Y C  S E       + L++LVP  I  +    + L +  R  + + C   GIP P++ W    KNG++  + +++  +  N  T  I NV     G YTC   N+  GK S  F L++   P   + G     + +G    +   I         +  + W K+S+ L+
Sbjct: 3537 ITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVAR-TIYLECPISGIPQPDVIWT---KNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNR-GGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALD 3714          

HSP 5 Score: 58.9214 bits (141), Expect = 1.303e-8
Identity = 49/202 (24.26%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  594 YLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            ++T+  Q   KD +  ++  QS+    +L I      D   Y C+   +        ++ V  P  I     S   ++      + I C + GIP P ISW+ + K  L       K+       ++ I N+     G YTC+ +NK  G+  +   +EI   P + M ++V+   +GR+T I+  + G+P   + W K+ +
Sbjct: 2973 HITWSRQF-GKDGQLDMRA-QSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADT--TLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDL----SLRIDNIKPNQEGRYTCVAENKA-GRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE 3165          

HSP 6 Score: 56.225 bits (134), Expect = 9.271e-8
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT--VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            L I +LK TD G+Y C           +V + VLVP  I   G      +   ++ + + C + G P P + W  N        L ++   I V  ++  + I NVS    G YTC  +N V G  +  + +++   P I  G    VIE   G   +I+ ++ G+P   + W +N
Sbjct: 3915 LDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRL-PAQQSLTLQCLAQGKPVPQMRWTLN-----GTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAEN-VAGSDNLMYNVDVVQAPVISNGGTKQVIE---GELAVIECLVEGYPAPQVSWLRN 4080          

HSP 7 Score: 55.4546 bits (132), Expect = 1.504e-7
Identity = 45/188 (23.94%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV--IEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            +LKI  +K  D G+Y C          + V + V+    I   G   D+   ++ E+V+ISC  Y  P   I+W    K   + +          N   + +F +    +  YTCI  N+  G   + FK+ +   PS    N V  I  + G  + +     G P  +I W K+   +  +    F+
Sbjct: 2347 QLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYE-SQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTS----ANGQKLYLFKLRETDSSKYTCIATNEA-GTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFF 2528          

HSP 8 Score: 55.4546 bits (132), Expect = 1.583e-7
Identity = 53/217 (24.42%), Postives = 85/217 (39.17%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN-DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSA 1325
            ++I+N+ ++D G Y C        D     + V+   VI   GT Q    V E E  +I C   G P+P +SW    +NG              +   +TI     + +G Y C   N+  G   +++ LE+   P I      V+  S G +  +   + G+P   I W  N   +    N     G T       D T H ++ + +  IY  +A
Sbjct: 4009 IQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQ----VIEGELAVIECLVEGYPAPQVSWL---RNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEA-GSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGEN-----GHT----IGADGTLHIEKAEERHLIYECTA 4208          

HSP 9 Score: 55.0694 bits (131), Expect = 1.957e-7
Identity = 52/184 (28.26%), Postives = 75/184 (40.76%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF----VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVI----EQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L I N+   D+G+Y C    +   +    K  VLVP  I+     ++   V E   V +SC + G P P+I+W+   K+G  A    N  DI     +N N + I  +     G YTC  DN   G   +   + +   P I+   D I    E  Q    +I   +   P   I W K  K L
Sbjct: 2251 LTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAV-EHSTVTLSCPATGKPEPDITWF---KDG-EAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSA-GSVEQDVNVNVITIPKIE--KDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL 2426          

HSP 10 Score: 55.0694 bits (131), Expect = 2.095e-7
Identity = 41/168 (24.40%), Postives = 74/168 (44.05%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            D+G YEC   ++    R T  L +  P  +      Q+ ++V   ++V   C +  G P P I W+ N K+ +    Y     I +N   + I        G+Y+C+ +N + GK  +   L +   P+I      +  +  R+  +Q +  G P   I+W+K + +L
Sbjct:  675 DEGTYECRAMSQAGQARDTTDLMLATPPKV---EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDY-----IKINEGQLHIMGAKDEDAGAYSCVGEN-MAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLL 833          

HSP 11 Score: 53.5286 bits (127), Expect = 6.536e-7
Identity = 45/177 (25.42%), Postives = 78/177 (44.07%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQA-IINGHPINSIQWEKNSKIL 1205
            LKI ++   D G YEC+      +  + ++L ++ P  +    T QD +    RE V +SC + G P P + WY   ++ LN   Y   +D    Y    I + +    G+Y C   ++  G+   +  L +   P +++  + +   +G     +   I G P   I+W KN K L
Sbjct:  575 LKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSV--KVTPQD-VYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKFLY----IRDATHHDEGTYECRAMSQA-GQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDL 743          

HSP 12 Score: 52.373 bits (124), Expect = 1.489e-6
Identity = 43/143 (30.07%), Postives = 61/143 (42.66%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV--NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG 1100
            L I + K  D G Y C  + E  +  KT  L V VP  I+  G       V E   +++ C   G P+P ++W    K+G   R   + K + V        I +    H GSY C+  N V G    SF ++I   P I+ G
Sbjct: 2063 LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEG---GEYTVIENNSLVLPCEVTGKPNPVVTWT---KDG---RPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDV-GTAEISFDVDIITRPMIQKG 2195          

HSP 13 Score: 50.8322 bits (120), Expect = 3.755e-6
Identity = 53/224 (23.66%), Postives = 92/224 (41.07%), Query Frame = 3
Query:  537 QLTFSPKTTIVWR---RKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQ--DHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            Q+T +PK T++W+     +DK +L         D+  SL           L+I+ L      +  C    +      T      +  +  PT  ++     I +E E + + C    +    I+W    K GL   L  N     ++   +TI N +R H   YTC+ +N   G+ SK F + +   P IK     +E ++G E ++     G+P  + +W+ N
Sbjct: 1760 QVTGNPKPTVIWKIDGNDVDKSWLF--------DESLSL-----------LRIEKLT-GKSAQISCTAENKA----GTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDC-PVSLGDFQITWM---KQGLP--LTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTA-GQVSKDFDVVVQVLPKIKNAVVTLEINEGEEIILTCDAEGNPTPTAKWDFN 1952          

HSP 14 Score: 50.8322 bits (120), Expect = 4.301e-6
Identity = 61/265 (23.02%), Postives = 103/265 (38.87%), Query Frame = 3
Query:  648 IYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKD--IFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDS--WV 1430
            I+  +Y L  +KI + +++D GEY C  + +     +   L V V   I+    +Q   +V + ++V + C + G+P P I+WY +     N  L N   D        +V   ++S    G YTC  +N V   + +   L +   P +      +  +  +   +     G P   I W ++S I   +  K   +G T                   L I N+   D   Y  +  S  G    T K+I  KP +  +  WV
Sbjct: 4274 IFSEDYKL--IKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQ---VVHKGDQVTLWCEASGVPQPAITWYKD-----NELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTE-EDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTT-------------------LAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPIWV 4508          

HSP 15 Score: 50.447 bits (119), Expect = 4.969e-6
Identity = 58/258 (22.48%), Postives = 100/258 (38.76%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSP------------------FGNIFGTTKII 1397
            L + N+++ D+G Y C    E  I +K  KL V+     L     Q    +   +++ + C++ G P P I +  + K     RL N   ++ +  +T+ I N  +   G YTCI +NK  G+  K   +E+   P +      +E   G    ++  I       I W +               G+  +    LD        K++L+I   +  D  SY  + V+                   FG+ F TT+I+
Sbjct: 2818 LNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFL---DQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGK-----RL-NESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKA-GRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQ-------------FGKDGQ----LDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIV 3048          
BLAST of hmctn vs. Ensembl Fly
Match: DIP-eta (gene:FBgn0031725 transcript:FBtr0343246)

HSP 1 Score: 98.2117 bits (243), Expect = 2.106e-21
Identity = 73/282 (25.89%), Postives = 130/282 (46.10%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKP 1409
            + W R   +  LT Q+ ++TK++R  + I  S +    ++I ++K +D G Y C  +T+  +  +   L V+VP  IL   TS D ++V+E   V + C + G P P I+W    ++G+   L   ++ + +    + I NV R H G+Y CI  N V    SK   L + + P I + N +I   +G+   +      +P +   W +          +   +    KY   + + G ++    +L I  L+  +F SYR +  +  G+  GT K+    P
Sbjct:   74 VAWLRVDTQTILTIQNHVITKNQR--IGIANSEHKTWTMRIKDIKESDKGWYMCQINTDP-MKSQMGYLDVVVPPDILDYPTSTD-MVVREGSNVTLKCAATGSPEPTITW--RRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTR---------ERGEIVPPGGKYSANVTEIGGYR-NSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLYRIPP 339          
BLAST of hmctn vs. Ensembl Fly
Match: DIP-eta (gene:FBgn0031725 transcript:FBtr0302933)

HSP 1 Score: 98.2117 bits (243), Expect = 2.106e-21
Identity = 73/282 (25.89%), Postives = 130/282 (46.10%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKP 1409
            + W R   +  LT Q+ ++TK++R  + I  S +    ++I ++K +D G Y C  +T+  +  +   L V+VP  IL   TS D ++V+E   V + C + G P P I+W    ++G+   L   ++ + +    + I NV R H G+Y CI  N V    SK   L + + P I + N +I   +G+   +      +P +   W +          +   +    KY   + + G ++    +L I  L+  +F SYR +  +  G+  GT K+    P
Sbjct:   74 VAWLRVDTQTILTIQNHVITKNQR--IGIANSEHKTWTMRIKDIKESDKGWYMCQINTDP-MKSQMGYLDVVVPPDILDYPTSTD-MVVREGSNVTLKCAATGSPEPTITW--RRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTR---------ERGEIVPPGGKYSANVTEIGGYR-NSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLYRIPP 339          
BLAST of hmctn vs. Ensembl Fly
Match: DIP-iota (gene:FBgn0031837 transcript:FBtr0113026)

HSP 1 Score: 86.6557 bits (213), Expect = 7.535e-18
Identity = 57/214 (26.64%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            + W R   +  L+ Q+ ++TK+ R S  I  + + + +LKI +++ +D G Y C  +T+  +  +   L V+VP  I+   TSQD ++    + V ++C++ G+P P I+W       +      +++   V    +T++ V R H G+Y CI  N V    SK   L + + P+I    D I    G++  ++ I    P +   W ++S++L
Sbjct:   62 VAWLRVDTQTILSIQNHVITKNHRIS--ISHTEHRIWQLKIRDVQESDRGWYMCQINTDP-MKSQMGYLDVVVPPDIVDYQTSQD-VVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLL 271          
BLAST of hmctn vs. Ensembl Fly
Match: DIP-theta (gene:FBgn0051646 transcript:FBtr0079114)

HSP 1 Score: 87.4261 bits (215), Expect = 1.318e-17
Identity = 70/277 (25.27%), Postives = 129/277 (46.57%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI 1394
            I W R   +  LT Q+ ++TK+ R S+   +    +  L+I ++K +D G Y C  +T+  +  +   L V+VP  IL   TS D ++++E   V + C + G P+P I+W    + G    L N  + +  N + +TI  V+R++ G+Y CI  N +    SK   L + + P I + N ++  +  +   ++     +P +   W KN  I+        ++  T +  + +           +L IY +   DF +YR +  +  G+  G  K+
Sbjct:  161 IAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI--LRIRDVKESDKGWYMCQINTDP-MKSQVGYLDVVVPPDILDYPTSTD-MVIREGSNVTLKCAATGSPTPTITWRR--EGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGER---FVPETFESGYKI---------TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKL 419          
BLAST of hmctn vs. Ensembl Fly
Match: DIP-delta (gene:FBgn0085420 transcript:FBtr0333611)

HSP 1 Score: 83.9593 bits (206), Expect = 1.015e-16
Identity = 70/281 (24.91%), Postives = 122/281 (43.42%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFK 1406
            + W     +  LT    ++++  R+S+  Y  N  L  L ++     D G Y C  +T   I  +   L+V+VP  IL   ++   + V+E + + ++C + G P+P I W    ++G    +   KK +  + + + +  VSR   G+Y CI  N V    SK   L++ + P I + N ++    G +  I      HP   I W  NS ++ L + K           +  D T +      +L I NL   DF +YR +  +  G   G+ ++ E  
Sbjct:   75 VAWIHIDRQMILTIHRHVISRIPRYSIT-YTDNTWL--LHVNQAHQDDRGYYMCQVNTNPMIS-QVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIW--RREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNS-VMVLPSKK-----------YKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIP 337          
BLAST of hmctn vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 73.9442 bits (180), Expect = 5.045e-13
Identity = 53/197 (26.90%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  654 QSNYVLME-----LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYA-NWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            Q N  ++E     L+I+ +++ D G Y CL S+    D +   +RV +P  +L +   +  + V  +  + + C +   P P I WY  N K  L  R+ +     F+    V      R+H+ G Y+C+V N + G  S  F +EI   P I+ G+ +I    G++ ++   + G P +S+ W K+   + L  N+
Sbjct: 2531 QDNMAIIERDGQLLRINKVQVEDAGLYTCLASSPAGEDGRNHWVRVQLPPTLLGSNDIRT-VSVPAKGHLTLECQTDSDPPPEIEWYKDNVKVQLGGRIQSIASGQFLEIQDV------RMHDSGQYSCVVTN-IAGSTSLFFTVEILLPPVIREGSSLIIAHVGQDAVLPCEVEGAPSSSVMWRKDGGPVPLHNNR 2719          

HSP 2 Score: 70.8626 bits (172), Expect = 5.176e-12
Identity = 48/183 (26.23%), Postives = 93/183 (50.82%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEK-YIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNA---RLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILN 1208
            L I +   +  G+++C+ + E   ++RKT +L+V VP  I   G   + L V  ++ + + C+++GIP+P ISW  + +  L      L N K+        + I+ V   H G ++C   N   G+  + + +E+   P I   + V E +   G+E  +Q  ++G P+ S++W  + ++L+
Sbjct: 1303 LVIGSASASHSGDFKCVATNEAGSVERKT-RLKVNVPPEIQDDGQLLN-LTVTLKQPLTLGCDAFGIPTPTISWTKDNRPVLETPGVYLQNGKR-------LLKIYRVQHDHAGRFSCTAQNSA-GEAKREYTIEVQAPPVISGTSGVQEVTIMAGQEVDMQCRVSGRPLPSVEWTHDGEVLS 1475          

HSP 3 Score: 60.077 bits (144), Expect = 8.817e-9
Identity = 49/215 (22.79%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            +P ++++WR+      L         + RF+L    S      L+I  ++++D G Y C  S +   D + + L+V V   I P      ++ V   ++ ++SC S GIP+P +SW    +NG    +  +     ++  ++ I + +    G + C V N+V G++ +  ++ +   P IK     +   +    ++     G P   I W KN
Sbjct: 2699 APSSSVMWRKDGGPVPL--------HNNRFTLLSEGS------LRISTVQLSDVGRYYCSVSNQAGSDHRGMDLKVYVGPSISP---GPFNVTVVTGQRAVLSCESTGIPAPQVSWR---RNGSPISVDQSSAYRLMSSGSLVITSPTAEDEGYFECTVTNEV-GEERRVIEVILQVPPVIKDDVSSVTAVKMSPVVLPCHATGRPEPVISWNKN 2892          

HSP 4 Score: 57.7658 bits (138), Expect = 5.123e-8
Identity = 46/179 (25.70%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRV-LVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L I+  +  D G + C+ +      R  ++L V + PA     G     + + + + + +SC++ G P+P I+W AN       R Y          ++V   NV+    G+Y CI +N V   ++ SF      EP +  G     Q+  QG+  M+   ++G P+ S++W K+ + L
Sbjct: 3182 LIIERAEAGDAGLFTCVATNTAGSARWDIRLTVNMRPAFKELPGD----VTLNKGQSLSLSCHAEGTPTPTITWTAN------NRPYTGASVDETGRSSVIFDNVTVSDGGTYACIAENTVGLIRALSFVRV--REPPVLRGEAHTSQTVIQGKSAMLDCAVSGDPVPSLRWHKDGQPL 3348          

HSP 5 Score: 57.7658 bits (138), Expect = 5.391e-8
Identity = 45/174 (25.86%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNA---RLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            LK   + + D G Y+CL   E        +L + VP V+      +   +V   + V + C + G P P ++W+ + +  +++   RL++N         ++ I    R   G YTC   N V G+ S   +L +   P I +G   I   QG   M+     G P   + WEK
Sbjct: 3001 LKFSRVTLGDAGTYQCLAQNEAGTALAQTQLILQVPPVL---SVPRLEYVVVLGQPVSLDCVADGQPKPEVTWHRDRRPVVDSSHLRLFSN--------GSLHITATQRGDAGIYTCSARNSV-GRASHDVRLILHTPPQIFVGQSEISVMQGLRVMLPCAAQGVPEPRMSWEK 3162          

HSP 6 Score: 57.3806 bits (137), Expect = 6.021e-8
Identity = 47/181 (25.97%), Postives = 80/181 (44.20%), Query Frame = 3
Query:  657 SNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            S Y LM    L I +    D+G +EC  + E   +R+ +++ + VP VI    +S   +   +   V++ C++ G P P ISW  NW   L AR  + +    +    + I   +  H G YTC   N V G   K   L +   P I+   + ++       ++   + G P  +I W++
Sbjct: 2810 SAYRLMSSGSLVITSPTAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSS---VTAVKMSPVVLPCHATGRPEPVISWNKNWMQ-LGARGGSYR---VLPTGALEILAATPSHAGKYTCSARNPV-GVAYKHVTLTVQEPPEIRPMAEEVQVVLHHSVVLPCEVQGFPRPTITWQR 2982          

HSP 7 Score: 57.3806 bits (137), Expect = 6.499e-8
Identity = 42/175 (24.00%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVK-EREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            L+I      D G+Y C  +     D+K++ L +     ++P   S+  +        +I+ C + GIP P ++WY   +NGL     N  +   +    + I  V     G YTC V N + G+  ++F++ + + P +  G  ++ + Q+ G    +    +G P+ +I W K+
Sbjct: 1985 LQIPRAGQQDAGQYVCTATNSAGQDQKSILLTIYALPALVPRLESESEVRTPLVGSTLILRCEANGIPKPEVTWY---RNGLQLAAGNGLR---IERQQLEIVGVQVADGGVYTCKVSN-IAGQVDRTFRVTV-HVPPVMEGPLHETLTQNLGSHITLICEASGIPVPNIAWLKD 2151          

HSP 8 Score: 57.3806 bits (137), Expect = 7.016e-8
Identity = 43/182 (23.63%), Postives = 82/182 (45.05%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV---IEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L++  L+++  G Y C+    +   +K   L +  P  I+ +G   + +     E++ + C + G P+P +SW  N K  +N        +I  + +T+T  +V    +G+YTC+  +   G+++K + L     PSI     V   +  +Q     ++    G P   I W ++   L LS
Sbjct: 2170 LELGPLQLSHAGTYTCIAKNTEGQTQKDYSLTIYAPPSIIDSGHPSE-VSAPVGEELALECRAMGSPAPKVSWLRNGKTLVNGN--TEHINISPDGSTLTFLSVKPEDSGTYTCLAVSSA-GQETKIYTLFALVPPSISGETSVPREVHTTQHSVVTLECKAKGTPQPQISWLRDGHPLLLS 2347          

HSP 9 Score: 55.0694 bits (131), Expect = 3.407e-7
Identity = 48/221 (21.72%), Postives = 93/221 (42.08%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIF--NVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETM--IQAIINGHPINSIQWEKNSK 1199
            +P+  I W R      L+ + +LL+ D                L+I  + ++D G Y C+  +   +      L+V  P  +  T  ++  + V +   V ++C + G+P P +SW    K+G    L+ N   + ++         +V     G Y+C+  N+  G  +K+F L +   P I       EQ    +++  ++ I  G P  ++ W K+ +
Sbjct: 2330 TPQPQISWLRDGHPLLLSPRIRLLSADS--------------TLRISPVHLSDSGIYTCVARSRAGLAELNFDLQVQAPPAVERTEPTE-QVAVVQGSSVTLTCEARGVPPPTLSWL---KDGQPLSLHRN---LLLDGQETRFLLSDVGPSDAGLYSCVASNQA-GSSTKTFNLTVLEPPKITGSLSPEEQLIAVDSLLELECIATGLPPPTLSWLKDGR 2528          

HSP 10 Score: 54.6842 bits (130), Expect = 3.937e-7
Identity = 41/184 (22.28%), Postives = 83/184 (45.11%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
            L+I ++++ D G+Y C+ +           + +L+P VI   G+S   +I    +  ++ C   G PS ++ W    K+G    L+NN+  + ++  ++ I  V     G Y C V N+  G   +   L+++  PSI  G   +    G+  ++     G P   + W +N   +++  +  +
Sbjct: 2637 LEIQDVRMHDSGQYSCVVTNIAGSTSLFFTVEILLPPVI-REGSSL--IIAHVGQDAVLPCEVEGAPSSSVMWR---KDGGPVPLHNNRFTL-LSEGSLRISTVQLSDVGRYYCSVSNQA-GSDHRGMDLKVYVGPSISPGPFNVTVVTGQRAVLSCESTGIPAPQVSWRRNGSPISVDQSSAY 2812          

HSP 11 Score: 54.299 bits (129), Expect = 5.721e-7
Identity = 48/203 (23.65%), Postives = 78/203 (38.42%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKERE----------------------KVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAI------INGHPINSIQWEKN 1193
            L +DN  ++ +G+Y C+ S     D++   L + VP V            + ERE                       + +SC S  IP P +SWY   +   ++       D  V      I  + R+     G YTC   N+  G+    + LE+   P I    D  E  Q  +T++ +       ++GHP  S+ W K+
Sbjct: 1682 LHVDNAMLSHEGQYTCVVSNSAGEDKRDFHLTIQVPPVFHRVINGAADFTLGEREGDEEDPDSPDGMVERREVLLGHSISLSCESNAIPPPRLSWYRQGRQLTSS-------DGVVLAPGGHILQIPRVQLEDAGKYTCQAVNEA-GEDKMHYDLEVLVPPVISGQTD--EFMQDVDTVVNSTVSLRCDVSGHPSPSVSWIKD 1874          

HSP 12 Score: 53.1434 bits (126), Expect = 1.168e-6
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            L+I  ++  D G Y+C  S      +  V L VL  P+V++   T    L      +V ISC++ G P P + W        N  L N+ +        +TI   +   +G+YTC+  N+V G  S+S  +     PSI +   ++    G +  ++   +G P   ++W+K
Sbjct:  571 LEISWVRSQDAGPYQCRASNAHGESQAVVWLVVLEAPSVVVSPQTQSFSL----GAEVHISCSASGSPPPKVFWSHG-----NIFLSNHHRMSISESGMLTIRGAAPEDSGNYTCLATNEV-GTASQSVNVNYAEPPSISVVQQMVMVVAGEDASLECQASGTPSPIVKWQK 732          

HSP 13 Score: 51.2174 bits (121), Expect = 5.474e-6
Identity = 42/179 (23.46%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  690 NLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            ++K  D G Y CL  +    + K   L  LVP  I    +    +   +   V + C + G P P ISW    ++G +  L + +  +    +T+ I  V    +G YTC+  ++  G    +F L++   P+++     + +   QG    +     G P  ++ W K+ + L+L  N
Sbjct: 2269 SVKPEDSGTYTCLAVSSAGQETKIYTLFALVPPSISGETSVPREVHTTQHSVVTLECKAKGTPQPQISWL---RDG-HPLLLSPRIRLLSADSTLRISPVHLSDSGIYTCVARSRA-GLAELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCEARGVPPPTLSWLKDGQPLSLHRN 2442          

HSP 14 Score: 50.447 bits (119), Expect = 8.806e-6
Identity = 48/186 (25.81%), Postives = 74/186 (39.78%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVP------AVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG--LNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEP 1085
            P  TI W +  D Q +    QL       SL++  +            +  D G Y C  +       +   LR++VP      + IL  G  ++   V+    + +SC + G P P   W+   K+G  LN    N    + VN + + + N    H G YTC+V N   G+  + F L I   P
Sbjct: 1556 PLPTITWLK--DNQPIVSSPQLTYTQGGQSLRVAAA------------RGEDAGAYTCRATNPAGTAHRHYTLRIMVPPQIEGDSTILSFGRREEK--VRINGTLTLSCLAKGFPEPVTQWF---KDGQLLNG---NTHSGLSVNSHMLHVDNAMLSHEGQYTCVVSNSA-GEDKRDFHLTIQVPP 1718          
BLAST of hmctn vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 72.4034 bits (176), Expect = 1.740e-12
Identity = 53/187 (28.34%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I+N  + D  +Y C+ S      R+  KL V VP  I   P   S     V   + V++ C   G+P+P I+W    K G +    NN +  F    ++ I +      G Y C+  N+  G + K   L+++  PSI  G   I  +   +T +     G P  S+ W KN++ LN   N+  Y
Sbjct: 3661 LQINNAVLGDGAQYSCVASNVAGETRRHFKLSVNVPPTIKDGPQSVS-----VHINQPVVLECVVNGVPAPRITWR---KQG-SILAGNNPRYKFGEDGSLRILSAQVTDTGRYLCMATNQA-GTERKRVDLQVYVPPSIAEGPTNITVTVNVQTTLSCEATGIPKPSVSWTKNTQALNTDQNQNMY 3837          

HSP 2 Score: 70.4774 bits (171), Expect = 5.640e-12
Identity = 47/179 (26.26%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWY---ANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L++ + ++ + G Y CL S+    D K   +RV VP  I      QD  +++ R+ V + C S  +P P ++W    A  K     R+ ++ + + +N       N        Y+C+  N V G+  + FKL +   P+IK G   +     +  +++ ++NG P   I W K   IL
Sbjct: 3568 LRVASAQVENTGRYTCLASSPAGDDDKEFLVRVHVPPNIAGDRGVQDVSVLQNRQ-VTLECKSDAVPPPTLTWLKDDAPLKMSPRVRVLSSGRYLQIN-------NAVLGDGAQYSCVASN-VAGETRRHFKLSVNVPPTIKDGPQSVSVHINQPVVLECVVNGVPAPRITWRKQGSIL 3737          

HSP 3 Score: 70.0922 bits (170), Expect = 8.275e-12
Identity = 49/172 (28.49%), Postives = 79/172 (45.93%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            L+I   K+ D G Y C+            KLRV VP VI  T   + + +  +   V + CNS G P+P++SW+   K+G    L  + +   ++   + I        G YTC V N V G  S    L +   PSI++G   +   +  + ++  + +G P  +I WEK+
Sbjct: 4027 LQISKAKVEDSGTYMCVAQNPAGTALGKTKLRVQVPPVI--TSDIRAYTVALDVS-VTLQCNSEGFPTPSVSWH---KDG--QLLSESVRQRVLSTGALQIAFAQPGDTGRYTCTVAN-VAGSSSLDISLTVQIPPSIRVGESEVSVVENTQALLTCVADGVPQPTITWEKD 4189          

HSP 4 Score: 68.9366 bits (167), Expect = 1.781e-11
Identity = 56/199 (28.14%), Postives = 88/199 (44.22%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFN--------VSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGR 1241
            LK+    + D G Y C          +   L VLVP  I+ T  S+D   V  +E +++ C   G P P I WY             ++K +F+    + + N         +R+ +   Y C   N   GKQSK F L I+  PSIK GN   E +   G    ++  + G P+ ++ W KN +++ LS+ +  Y+ R
Sbjct: 1408 LKLLKAAVQDAGRYICKAINIAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQE-IVLECKVKGDPFPTIQWY------------KDRKPVFLGDPNIEVLNRGQQLKIKSARLGDQARYQCSATNAA-GKQSKDFNLSIFVPPSIKGGNVSSEVTVLLGNLVTLECEVRGVPLPAVTWYKNGEVI-LSSRQAQYVDR 1591          

HSP 5 Score: 65.0846 bits (157), Expect = 2.833e-10
Identity = 42/138 (30.43%), Postives = 66/138 (47.83%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI 1091
            L++ +   +D G Y C+ S     +RK   L VLVP  I+  GT +D + VKER+  I++C   G P P I+W    K+G      + +  +  N   + I        G Y+C+  N   G +S+ F L +   P+I
Sbjct: 2430 LRLMHAASSDAGRYTCIVSNSAGEERKNFDLYVLVPPSIVNEGTVED-VKVKERQNAILACEVTGNPVPEITWL---KDG-QPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSA-GDRSRHFNLNVLVSPTI 2561          

HSP 6 Score: 64.6994 bits (156), Expect = 3.564e-10
Identity = 50/184 (27.17%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYN-TVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEKNSKILNLSAN 1220
            L+I   +++D G Y C+ S    +D +   L+V VP  +   G++++  +VK      I C + G PSP I W         A +  +     +N N T+ I NV   H G YTC   N+  G  S+ F L++   P I       E S     +++ +   +G P+ ++ W K+ + L  + N
Sbjct: 3382 LRIARAQVSDGGSYTCVASNRAGVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFI-CIADGTPSPVIIWLRT-----GASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQA-GDASRHFSLKVLDPPRINGSGVPAEVSVVVNHVLELLCEADGIPLPTLTWLKDGRPLPQTEN 3558          

HSP 7 Score: 63.1586 bits (152), Expect = 1.086e-9
Identity = 48/176 (27.27%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLV-PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            +L ID  +  D G Y C+ +     D +T+ L +   PA     G     + + +RE++++ C   GIP P I+W        N  +   + D +  ++ + I  VS+  +G+YTC+ +N V   +S  F      EP I  G+   + IE   G   ++   + G P+ +IQW K
Sbjct: 4207 DLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPAFTELLGD----VALNKRERLLMVCGVTGIPPPKITW------TFNNNIVPAQYDHYNGHSELVIERVSKDDSGTYTCMAENSVGSIKSLGFVYV--KEPPIIDGDVHSNRIE-PLGGNAILNCEVRGDPLPTIQWSK 4369          

HSP 8 Score: 62.7734 bits (151), Expect = 1.355e-9
Identity = 57/227 (25.11%), Postives = 99/227 (43.61%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGL--NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            PK  + WRR+ +    T +H   T   R    ++          I NL + D+  Y C    + +  R  VK +V V  ++ P    S   + V E ++V + C    G P P   W  +  NGL  ++     ++D      ++ I  VS+   G YTC+ +N V G  +++  L ++  P+I+ G  +    +G    +    +G P   I W K  ++L+LS +
Sbjct:  811 PKPQLSWRREDNIALFTQRHGPSTVTHRMDGGLF----------ITNLWVEDEATYVC--EAQNHFGRIQVKAKVTVTGLVSPLIALSPTVVSVIEDQQVTLPCVLLAGNPLPERHWLHD--NGLVTSSPYVTVRRD-----GSLHIEQVSQQDGGQYTCLTENVV-GSSNRTTILNVYVMPTIQHGPQIFSTIEGTPISLPCRAHGVPKPDITWSKRGELLDLSGS 1017          

HSP 9 Score: 62.7734 bits (151), Expect = 1.414e-9
Identity = 54/207 (26.09%), Postives = 96/207 (46.38%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN--------DVIEQSQGRETMIQAIINGHPINSIQWEKN-------SKILNLSANKCFYIGRTK 1247
            +L+I   +++D G Y C+ S  +   +K   L + VP  I+ +    + + V   + V + C + G P+P I W    K+G+  +R       I  + +T+T+  V    +G YTC+  N+  G++ + F L ++  P I+ GN         V++ S      I+ + +G P   + W KN       S+I  LSA +   I R +
Sbjct: 3192 KLQISRSQLSDSGTYTCVASNVEGKAQKNYHLVIHVPPNIIGSELPSE-MSVLLNDSVQLVCRAEGTPTPEIQWL---KDGMTISRTAQKNIKISPDGSTLTVTAVHTSDSGKYTCVATNQA-GEEDRIFNLNVYVPPLIQ-GNGPAAKELTTVLDSS----INIECVASGSPPPQLNWLKNGLPLPVSSQIRLLSAGQVLRIARAQ 3388          

HSP 10 Score: 61.6178 bits (148), Expect = 3.118e-9
Identity = 49/192 (25.52%), Postives = 80/192 (41.67%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSAN 1220
            L+I   ++ D G Y C+   E   D     +RVL+P  I    G   D + V   + +++ C   G P+P ISW  + +        +N   +  N  T+ I N      G Y C+  N + G   KSF L +   P+I +G         RE  +  ++N          G P  +++W K+ + +  S N
Sbjct: 2817 LQIPRAQVDDTGRYTCVAVNEAGEDSIQYDVRVLLPPSIRGADGELPDEVTVLVNKTMLLECQVDGSPTPKISWVKDSQ----PLTQDNTHRLLSNGRTLQILNAQVTDTGRYVCVAQN-LAGTAEKSFNLHVHVSPTI-VGI--------REENVTVVLNNFVSLNCEATGLPPPTLRWFKDRRPVQASTN 2994          

HSP 11 Score: 60.077 bits (144), Expect = 1.079e-8
Identity = 42/167 (25.15%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI--KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            D+GEY C+   +     K  +L+V VP  I   G   +  +V  +   ++ C+  G P P I+WY   K+G+   + ++   I     T+ +   +    G Y C   N + G + + F L++   P+I   +G+  +     +E +++  + G P  +IQW K+ K
Sbjct: 1324 DNGEYTCMAVNDAGTTEKKYQLKVNVPPDIRDNGLLSNVSVVINQPTNLV-CDVTGTPVPVITWY---KDGVEV-VPSSDVQILQKGKTLKLLKAAVQDAGRYICKAIN-IAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGDPFPTIQWYKDRK 1484          

HSP 12 Score: 59.6918 bits (143), Expect = 1.205e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT-VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND---VIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            +LKI + ++ D   Y+C  +       K   L + VP  I   G     + V     V + C   G+P P ++WY N +  L++R     +  +V+    + I        G YTC V   V G   K  +L+++  PSI  G+D    ++    +  +++    GHP  S+ W K+
Sbjct: 1501 QLKIKSARLGDQARYQCSATNAAGKQSKDFNLSIFVPPSI-KGGNVSSEVTVLLGNLVTLECEVRGVPLPAVTWYKNGEVILSSR-----QAQYVDRGQFLKILRAQVSDAGQYTCRV-TSVAGTAEKVVELDVYVPPSITAGSDGPTDMKVVLNKSLILECEAEGHPPPSLTWLKD 1670          

HSP 13 Score: 59.6918 bits (143), Expect = 1.300e-8
Identity = 45/180 (25.00%), Postives = 86/180 (47.78%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECL-YSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   ++ D G Y C+  +     DRK   + V VP  I+      +++ V  +  V+++C + G+P P I+W    K+G      ++ + +      + + + +    G YTCIV N   G++ K+F L +   PSI +    +E  + +E    ++   + G+P+  I W K+ + L
Sbjct: 2336 LRILEAQVADTGRYTCIAINVAGQADRK-YDVNVHVPPTIIGQTHMPENISVVVKNPVVLTCEASGMPPPAITWL---KDGQPISTSSSVR-VISGGRGLRLMHAASSDAGRYTCIVSNSA-GEERKNFDLYVLVPPSI-VNEGTVEDVKVKERQNAILACEVTGNPVPEITWLKDGQPL 2508          

HSP 14 Score: 56.225 bits (134), Expect = 1.345e-7
Identity = 67/292 (22.95%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDI-FVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI-IEFKPI 1412
            PK ++ W +           Q L  D+       Q+ Y L+    L +    + D   YEC+ S E   + + ++L V VP  I    T    L+V     V+I C + G+P P + W    K+GL  RL  + +    +    + I      H+G Y+C+  N   G   +  +L +   P I+     ++        +     G P  +I W+K    +N+     F  G      F +   G  Q  KA++        D  +Y  +  +P G   G TK+ ++  P+
Sbjct: 3815 PKPSVSWTKNT---------QALNTDQN------QNMYRLLSSGSLVVIAPSVEDTALYECVVSNEAGQESRAIQLTVHVPPSIADEAT---ELVVSRLSPVVIGCTASGVPHPVLYWS---KDGL--RLAKDGEGFTILPSGPLEITAADLSHSGRYSCVAKNAA-GTAHRHVQLTVHESPVIQSHPSTLDVILNNHVTLPCRATGSPRPTITWQKEG--INI-----FTTGGG----FTVLPNGGLQISKAKVE-------DSGTYMCVAQNPAGTALGKTKLRVQVPPV 4064          

HSP 15 Score: 55.4546 bits (132), Expect = 2.277e-7
Identity = 43/176 (24.43%), Postives = 67/176 (38.07%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKI 1202
            L I N  + D G Y CL S     D +T  +  +  P V +P       L++   +K ++ C   G+P P+I WY   K  L  +  ++   +     T+TI      H G YTC+  N   G       L++   P        +    G    +     GHP   + W +   I
Sbjct:  657 LIIKNTGLKDAGTYGCLASNVAGTDSQTAIVSYIESPQVTVP----HSDLLIGLGQKTVMECRVTGVPHPDIMWY---KGDLQLKP-SSVLSMDPQRGTLTIQQTQDTHAGQYTCVAVNSA-GSAQGYITLDVGSAPQFTKKPSDLSADIGTNITLPCYAQGHPKPQLSWRREDNI 823          

HSP 16 Score: 55.4546 bits (132), Expect = 2.587e-7
Identity = 40/171 (23.39%), Postives = 72/171 (42.11%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQW 1184
            L +  +  +D G+Y C+ + +   + +   L V VP +I   G +   L       + I C + G P P ++W    KNGL   + +  + +      + I        GSYTC+  N+  G  ++ + L+++  PS+       E +  +G       I +G P   I W
Sbjct: 3288 LTVTAVHTSDSGKYTCVATNQAGEEDRIFNLNVYVPPLIQGNGPAAKELTTVLDSSINIECVASGSPPPQLNWL---KNGLPLPVSSQIR-LLSAGQVLRIARAQVSDGGSYTCVASNRA-GVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFICIADGTPSPVIIW 3453          

HSP 17 Score: 53.9138 bits (128), Expect = 8.348e-7
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  696 KITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT--VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEK-------NSKILNLSANKCFYIGRTKK 1250
            +++D G Y C+         +  +LRV VP  I+    +   L+    + V + C S  IP P +SW    K+G   R    K  + V+ +   + I +      G YTC   N V GK  K + L +W  PSI+  ++V   +     +I  +   +G P  S+ W+K       +S++  LS  +   I   +K
Sbjct: 2066 QVSDAGHYTCVAVNAGGEQHREYELRVYVPPNIMGEEVNNTVLM---GQSVQLHCQSDAIPPPALSWR---KDG---RPLYRKPGLSVSEDGSFLKIISAQVQDTGRYTCEATN-VAGKTEKHYNLNVWVPPSIRGSDEVSSLTVIEGGLITLVCESSGIPPPSLIWKKDGSELKGDSRVRVLSGGRQLQISSAEK 2251          

HSP 18 Score: 51.9878 bits (123), Expect = 2.763e-6
Identity = 49/192 (25.52%), Postives = 80/192 (41.67%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSKILNLS 1214
            L+I   K++D G+Y C+        +K + L V VP  I   +G     L V+  + V++ C S  +P P I+WY N +      N R+  + + + +    V+         G Y C   N V G+  K+F L I   P +             E +++ I N         G P  S+ W KN +++  S
Sbjct: 3004 LQILKAKMSDGGKYSCVAVNPAGEAQKLIYLTVYVPPSIRHNSGDLPVVLNVQVGKSVMLECESNAVPPPVITWYKNGRPIAETANLRILADGQMLQLKETEVS-------DTGQYVCKATN-VAGQVDKNFHLNIHVPPRL--------DGPAEERVVETISNPVTFACDATGIPPPSLTWLKNGRVIENS 3179          

HSP 19 Score: 51.6026 bits (122), Expect = 3.533e-6
Identity = 52/228 (22.81%), Postives = 96/228 (42.11%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQ-HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQ--DHLIVKE---REKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            P  T+VW +  D Q L    H  +T + R              ++I + +++D G Y C+ +     D K   + + VP      G S   ++  VK+      + + C +  +P P ++WY   K+G +    N+K  I      + I        G YTC+  N+  G+ S  + + +   PSI+  +    D +     +  +++  ++G P   I W K+S+ L
Sbjct: 2690 PTPTLVWYK--DGQILKADGHLTITANGRI-------------VQIKHTQVSDTGRYTCVATNIAGEDEKDFDVNIQVPPSFRGFGDSGPGNNGEVKDVILNNPISLYCETNAVPPPVLTWY---KDG-HLLTSNDKVLILPGGRVLQIPRAQVDDTGRYTCVAVNEA-GEDSIQYDVRVLLPPSIRGADGELPDEVTVLVNKTMLLECQVDGSPTPKISWVKDSQPL 2897          

HSP 20 Score: 51.2174 bits (121), Expect = 5.355e-6
Identity = 37/174 (21.26%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETM--IQAIINGHPINSIQWEKN 1193
            LKI   +++D G+Y C  ++      K V+L V VP  I         + V   + +I+ C + G P P+++W    K+G    +  + + +      + I N  +   G Y C+    V G++   + + +   P +   +D  + +     +  ++    G P  +I W K+
Sbjct: 1595 LKILRAQVSDAGQYTCRVTSVAGTAEKVVELDVYVPPSITAGSDGPTDMKVVLNKSLILECEAEGHPPPSLTWL---KDGSPVAVRESLR-VLDQGRKIEILNALQSDAGRYVCVA-TSVAGEKEIKYDVSVLVPPVVDGASDTTDATVILNNILELECYATGRPTPTITWLKD 1763          

HSP 21 Score: 50.447 bits (119), Expect = 8.325e-6
Identity = 42/178 (23.60%), Postives = 78/178 (43.82%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKER---EKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKN 1193
            L ++ + +TD+G Y C        +   ++L V VP V+        +  ++ER   +++   C + G P P I W+   +NG           I  +   + + +VS + NG YTC+  N   G   K ++L++   P I+  N ++        + T +   + G P+  I W K+
Sbjct: 1218 LTLNQVALTDEGIYVCRAVNIAGKEETAIQLHVQVPPVV-EVSEPPFNSPLQERVANQQIAFPCPAKGTPEPVIKWF---RNGHELTGNEPGVSILEDGTLLILASVSPLDNGEYTCMAVNDA-GTTEKKYQLKVNVPPDIR-DNGLLSNVSVVINQPTNLVCDVTGTPVPVITWYKD 1389          
BLAST of hmctn vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 72.4034 bits (176), Expect = 1.740e-12
Identity = 53/187 (28.34%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I+N  + D  +Y C+ S      R+  KL V VP  I   P   S     V   + V++ C   G+P+P I+W    K G +    NN +  F    ++ I +      G Y C+  N+  G + K   L+++  PSI  G   I  +   +T +     G P  S+ W KN++ LN   N+  Y
Sbjct: 3662 LQINNAVLGDGAQYSCVASNVAGETRRHFKLSVNVPPTIKDGPQSVS-----VHINQPVVLECVVNGVPAPRITWR---KQG-SILAGNNPRYKFGEDGSLRILSAQVTDTGRYLCMATNQA-GTERKRVDLQVYVPPSIAEGPTNITVTVNVQTTLSCEATGIPKPSVSWTKNTQALNTDQNQNMY 3838          

HSP 2 Score: 70.4774 bits (171), Expect = 5.640e-12
Identity = 47/179 (26.26%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWY---ANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L++ + ++ + G Y CL S+    D K   +RV VP  I      QD  +++ R+ V + C S  +P P ++W    A  K     R+ ++ + + +N       N        Y+C+  N V G+  + FKL +   P+IK G   +     +  +++ ++NG P   I W K   IL
Sbjct: 3569 LRVASAQVENTGRYTCLASSPAGDDDKEFLVRVHVPPNIAGDRGVQDVSVLQNRQ-VTLECKSDAVPPPTLTWLKDDAPLKMSPRVRVLSSGRYLQIN-------NAVLGDGAQYSCVASN-VAGETRRHFKLSVNVPPTIKDGPQSVSVHINQPVVLECVVNGVPAPRITWRKQGSIL 3738          

HSP 3 Score: 70.0922 bits (170), Expect = 8.275e-12
Identity = 49/172 (28.49%), Postives = 79/172 (45.93%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            L+I   K+ D G Y C+            KLRV VP VI  T   + + +  +   V + CNS G P+P++SW+   K+G    L  + +   ++   + I        G YTC V N V G  S    L +   PSI++G   +   +  + ++  + +G P  +I WEK+
Sbjct: 4028 LQISKAKVEDSGTYMCVAQNPAGTALGKTKLRVQVPPVI--TSDIRAYTVALDVS-VTLQCNSEGFPTPSVSWH---KDG--QLLSESVRQRVLSTGALQIAFAQPGDTGRYTCTVAN-VAGSSSLDISLTVQIPPSIRVGESEVSVVENTQALLTCVADGVPQPTITWEKD 4190          

HSP 4 Score: 68.9366 bits (167), Expect = 1.781e-11
Identity = 56/199 (28.14%), Postives = 88/199 (44.22%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFN--------VSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGR 1241
            LK+    + D G Y C          +   L VLVP  I+ T  S+D   V  +E +++ C   G P P I WY             ++K +F+    + + N         +R+ +   Y C   N   GKQSK F L I+  PSIK GN   E +   G    ++  + G P+ ++ W KN +++ LS+ +  Y+ R
Sbjct: 1409 LKLLKAAVQDAGRYICKAINIAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQE-IVLECKVKGDPFPTIQWY------------KDRKPVFLGDPNIEVLNRGQQLKIKSARLGDQARYQCSATNAA-GKQSKDFNLSIFVPPSIKGGNVSSEVTVLLGNLVTLECEVRGVPLPAVTWYKNGEVI-LSSRQAQYVDR 1592          

HSP 5 Score: 65.0846 bits (157), Expect = 2.833e-10
Identity = 42/138 (30.43%), Postives = 66/138 (47.83%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI 1091
            L++ +   +D G Y C+ S     +RK   L VLVP  I+  GT +D + VKER+  I++C   G P P I+W    K+G      + +  +  N   + I        G Y+C+  N   G +S+ F L +   P+I
Sbjct: 2431 LRLMHAASSDAGRYTCIVSNSAGEERKNFDLYVLVPPSIVNEGTVED-VKVKERQNAILACEVTGNPVPEITWL---KDG-QPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSA-GDRSRHFNLNVLVSPTI 2562          

HSP 6 Score: 64.6994 bits (156), Expect = 3.564e-10
Identity = 50/184 (27.17%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYN-TVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEKNSKILNLSAN 1220
            L+I   +++D G Y C+ S    +D +   L+V VP  +   G++++  +VK      I C + G PSP I W         A +  +     +N N T+ I NV   H G YTC   N+  G  S+ F L++   P I       E S     +++ +   +G P+ ++ W K+ + L  + N
Sbjct: 3383 LRIARAQVSDGGSYTCVASNRAGVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFI-CIADGTPSPVIIWLRT-----GASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQA-GDASRHFSLKVLDPPRINGSGVPAEVSVVVNHVLELLCEADGIPLPTLTWLKDGRPLPQTEN 3559          

HSP 7 Score: 63.1586 bits (152), Expect = 1.086e-9
Identity = 48/176 (27.27%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLV-PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            +L ID  +  D G Y C+ +     D +T+ L +   PA     G     + + +RE++++ C   GIP P I+W        N  +   + D +  ++ + I  VS+  +G+YTC+ +N V   +S  F      EP I  G+   + IE   G   ++   + G P+ +IQW K
Sbjct: 4208 DLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPAFTELLGD----VALNKRERLLMVCGVTGIPPPKITW------TFNNNIVPAQYDHYNGHSELVIERVSKDDSGTYTCMAENSVGSIKSLGFVYV--KEPPIIDGDVHSNRIE-PLGGNAILNCEVRGDPLPTIQWSK 4370          

HSP 8 Score: 62.7734 bits (151), Expect = 1.355e-9
Identity = 57/227 (25.11%), Postives = 99/227 (43.61%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGL--NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            PK  + WRR+ +    T +H   T   R    ++          I NL + D+  Y C    + +  R  VK +V V  ++ P    S   + V E ++V + C    G P P   W  +  NGL  ++     ++D      ++ I  VS+   G YTC+ +N V G  +++  L ++  P+I+ G  +    +G    +    +G P   I W K  ++L+LS +
Sbjct:  812 PKPQLSWRREDNIALFTQRHGPSTVTHRMDGGLF----------ITNLWVEDEATYVC--EAQNHFGRIQVKAKVTVTGLVSPLIALSPTVVSVIEDQQVTLPCVLLAGNPLPERHWLHD--NGLVTSSPYVTVRRD-----GSLHIEQVSQQDGGQYTCLTENVV-GSSNRTTILNVYVMPTIQHGPQIFSTIEGTPISLPCRAHGVPKPDITWSKRGELLDLSGS 1018          

HSP 9 Score: 62.7734 bits (151), Expect = 1.414e-9
Identity = 54/207 (26.09%), Postives = 96/207 (46.38%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN--------DVIEQSQGRETMIQAIINGHPINSIQWEKN-------SKILNLSANKCFYIGRTK 1247
            +L+I   +++D G Y C+ S  +   +K   L + VP  I+ +    + + V   + V + C + G P+P I W    K+G+  +R       I  + +T+T+  V    +G YTC+  N+  G++ + F L ++  P I+ GN         V++ S      I+ + +G P   + W KN       S+I  LSA +   I R +
Sbjct: 3193 KLQISRSQLSDSGTYTCVASNVEGKAQKNYHLVIHVPPNIIGSELPSE-MSVLLNDSVQLVCRAEGTPTPEIQWL---KDGMTISRTAQKNIKISPDGSTLTVTAVHTSDSGKYTCVATNQA-GEEDRIFNLNVYVPPLIQ-GNGPAAKELTTVLDSS----INIECVASGSPPPQLNWLKNGLPLPVSSQIRLLSAGQVLRIARAQ 3389          

HSP 10 Score: 61.6178 bits (148), Expect = 3.118e-9
Identity = 49/192 (25.52%), Postives = 80/192 (41.67%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSAN 1220
            L+I   ++ D G Y C+   E   D     +RVL+P  I    G   D + V   + +++ C   G P+P ISW  + +        +N   +  N  T+ I N      G Y C+  N + G   KSF L +   P+I +G         RE  +  ++N          G P  +++W K+ + +  S N
Sbjct: 2818 LQIPRAQVDDTGRYTCVAVNEAGEDSIQYDVRVLLPPSIRGADGELPDEVTVLVNKTMLLECQVDGSPTPKISWVKDSQ----PLTQDNTHRLLSNGRTLQILNAQVTDTGRYVCVAQN-LAGTAEKSFNLHVHVSPTI-VGI--------REENVTVVLNNFVSLNCEATGLPPPTLRWFKDRRPVQASTN 2995          

HSP 11 Score: 60.077 bits (144), Expect = 1.079e-8
Identity = 42/167 (25.15%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI--KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            D+GEY C+   +     K  +L+V VP  I   G   +  +V  +   ++ C+  G P P I+WY   K+G+   + ++   I     T+ +   +    G Y C   N + G + + F L++   P+I   +G+  +     +E +++  + G P  +IQW K+ K
Sbjct: 1325 DNGEYTCMAVNDAGTTEKKYQLKVNVPPDIRDNGLLSNVSVVINQPTNLV-CDVTGTPVPVITWY---KDGVEV-VPSSDVQILQKGKTLKLLKAAVQDAGRYICKAIN-IAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGDPFPTIQWYKDRK 1485          

HSP 12 Score: 59.6918 bits (143), Expect = 1.205e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT-VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND---VIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            +LKI + ++ D   Y+C  +       K   L + VP  I   G     + V     V + C   G+P P ++WY N +  L++R     +  +V+    + I        G YTC V   V G   K  +L+++  PSI  G+D    ++    +  +++    GHP  S+ W K+
Sbjct: 1502 QLKIKSARLGDQARYQCSATNAAGKQSKDFNLSIFVPPSI-KGGNVSSEVTVLLGNLVTLECEVRGVPLPAVTWYKNGEVILSSR-----QAQYVDRGQFLKILRAQVSDAGQYTCRV-TSVAGTAEKVVELDVYVPPSITAGSDGPTDMKVVLNKSLILECEAEGHPPPSLTWLKD 1671          

HSP 13 Score: 59.6918 bits (143), Expect = 1.300e-8
Identity = 45/180 (25.00%), Postives = 86/180 (47.78%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECL-YSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   ++ D G Y C+  +     DRK   + V VP  I+      +++ V  +  V+++C + G+P P I+W    K+G      ++ + +      + + + +    G YTCIV N   G++ K+F L +   PSI +    +E  + +E    ++   + G+P+  I W K+ + L
Sbjct: 2337 LRILEAQVADTGRYTCIAINVAGQADRK-YDVNVHVPPTIIGQTHMPENISVVVKNPVVLTCEASGMPPPAITWL---KDGQPISTSSSVR-VISGGRGLRLMHAASSDAGRYTCIVSNSA-GEERKNFDLYVLVPPSI-VNEGTVEDVKVKERQNAILACEVTGNPVPEITWLKDGQPL 2509          

HSP 14 Score: 56.225 bits (134), Expect = 1.345e-7
Identity = 67/292 (22.95%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDI-FVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI-IEFKPI 1412
            PK ++ W +           Q L  D+       Q+ Y L+    L +    + D   YEC+ S E   + + ++L V VP  I    T    L+V     V+I C + G+P P + W    K+GL  RL  + +    +    + I      H+G Y+C+  N   G   +  +L +   P I+     ++        +     G P  +I W+K    +N+     F  G      F +   G  Q  KA++        D  +Y  +  +P G   G TK+ ++  P+
Sbjct: 3816 PKPSVSWTKNT---------QALNTDQN------QNMYRLLSSGSLVVIAPSVEDTALYECVVSNEAGQESRAIQLTVHVPPSIADEAT---ELVVSRLSPVVIGCTASGVPHPVLYWS---KDGL--RLAKDGEGFTILPSGPLEITAADLSHSGRYSCVAKNAA-GTAHRHVQLTVHESPVIQSHPSTLDVILNNHVTLPCRATGSPRPTITWQKEG--INI-----FTTGGG----FTVLPNGGLQISKAKVE-------DSGTYMCVAQNPAGTALGKTKLRVQVPPV 4065          

HSP 15 Score: 55.4546 bits (132), Expect = 2.277e-7
Identity = 43/176 (24.43%), Postives = 67/176 (38.07%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKI 1202
            L I N  + D G Y CL S     D +T  +  +  P V +P       L++   +K ++ C   G+P P+I WY   K  L  +  ++   +     T+TI      H G YTC+  N   G       L++   P        +    G    +     GHP   + W +   I
Sbjct:  658 LIIKNTGLKDAGTYGCLASNVAGTDSQTAIVSYIESPQVTVP----HSDLLIGLGQKTVMECRVTGVPHPDIMWY---KGDLQLKP-SSVLSMDPQRGTLTIQQTQDTHAGQYTCVAVNSA-GSAQGYITLDVGSAPQFTKKPSDLSADIGTNITLPCYAQGHPKPQLSWRREDNI 824          

HSP 16 Score: 55.4546 bits (132), Expect = 2.587e-7
Identity = 40/171 (23.39%), Postives = 72/171 (42.11%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQW 1184
            L +  +  +D G+Y C+ + +   + +   L V VP +I   G +   L       + I C + G P P ++W    KNGL   + +  + +      + I        GSYTC+  N+  G  ++ + L+++  PS+       E +  +G       I +G P   I W
Sbjct: 3289 LTVTAVHTSDSGKYTCVATNQAGEEDRIFNLNVYVPPLIQGNGPAAKELTTVLDSSINIECVASGSPPPQLNWL---KNGLPLPVSSQIR-LLSAGQVLRIARAQVSDGGSYTCVASNRA-GVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFICIADGTPSPVIIW 3454          

HSP 17 Score: 53.9138 bits (128), Expect = 8.348e-7
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  696 KITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT--VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEK-------NSKILNLSANKCFYIGRTKK 1250
            +++D G Y C+         +  +LRV VP  I+    +   L+    + V + C S  IP P +SW    K+G   R    K  + V+ +   + I +      G YTC   N V GK  K + L +W  PSI+  ++V   +     +I  +   +G P  S+ W+K       +S++  LS  +   I   +K
Sbjct: 2067 QVSDAGHYTCVAVNAGGEQHREYELRVYVPPNIMGEEVNNTVLM---GQSVQLHCQSDAIPPPALSWR---KDG---RPLYRKPGLSVSEDGSFLKIISAQVQDTGRYTCEATN-VAGKTEKHYNLNVWVPPSIRGSDEVSSLTVIEGGLITLVCESSGIPPPSLIWKKDGSELKGDSRVRVLSGGRQLQISSAEK 2252          

HSP 18 Score: 51.9878 bits (123), Expect = 2.763e-6
Identity = 49/192 (25.52%), Postives = 80/192 (41.67%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSKILNLS 1214
            L+I   K++D G+Y C+        +K + L V VP  I   +G     L V+  + V++ C S  +P P I+WY N +      N R+  + + + +    V+         G Y C   N V G+  K+F L I   P +             E +++ I N         G P  S+ W KN +++  S
Sbjct: 3005 LQILKAKMSDGGKYSCVAVNPAGEAQKLIYLTVYVPPSIRHNSGDLPVVLNVQVGKSVMLECESNAVPPPVITWYKNGRPIAETANLRILADGQMLQLKETEVS-------DTGQYVCKATN-VAGQVDKNFHLNIHVPPRL--------DGPAEERVVETISNPVTFACDATGIPPPSLTWLKNGRVIENS 3180          

HSP 19 Score: 51.6026 bits (122), Expect = 3.533e-6
Identity = 52/228 (22.81%), Postives = 96/228 (42.11%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQ-HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQ--DHLIVKE---REKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            P  T+VW +  D Q L    H  +T + R              ++I + +++D G Y C+ +     D K   + + VP      G S   ++  VK+      + + C +  +P P ++WY   K+G +    N+K  I      + I        G YTC+  N+  G+ S  + + +   PSI+  +    D +     +  +++  ++G P   I W K+S+ L
Sbjct: 2691 PTPTLVWYK--DGQILKADGHLTITANGRI-------------VQIKHTQVSDTGRYTCVATNIAGEDEKDFDVNIQVPPSFRGFGDSGPGNNGEVKDVILNNPISLYCETNAVPPPVLTWY---KDG-HLLTSNDKVLILPGGRVLQIPRAQVDDTGRYTCVAVNEA-GEDSIQYDVRVLLPPSIRGADGELPDEVTVLVNKTMLLECQVDGSPTPKISWVKDSQPL 2898          

HSP 20 Score: 51.2174 bits (121), Expect = 5.355e-6
Identity = 37/174 (21.26%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETM--IQAIINGHPINSIQWEKN 1193
            LKI   +++D G+Y C  ++      K V+L V VP  I         + V   + +I+ C + G P P+++W    K+G    +  + + +      + I N  +   G Y C+    V G++   + + +   P +   +D  + +     +  ++    G P  +I W K+
Sbjct: 1596 LKILRAQVSDAGQYTCRVTSVAGTAEKVVELDVYVPPSITAGSDGPTDMKVVLNKSLILECEAEGHPPPSLTWL---KDGSPVAVRESLR-VLDQGRKIEILNALQSDAGRYVCVA-TSVAGEKEIKYDVSVLVPPVVDGASDTTDATVILNNILELECYATGRPTPTITWLKD 1764          

HSP 21 Score: 50.447 bits (119), Expect = 8.325e-6
Identity = 42/178 (23.60%), Postives = 78/178 (43.82%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKER---EKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKN 1193
            L ++ + +TD+G Y C        +   ++L V VP V+        +  ++ER   +++   C + G P P I W+   +NG           I  +   + + +VS + NG YTC+  N   G   K ++L++   P I+  N ++        + T +   + G P+  I W K+
Sbjct: 1219 LTLNQVALTDEGIYVCRAVNIAGKEETAIQLHVQVPPVV-EVSEPPFNSPLQERVANQQIAFPCPAKGTPEPVIKWF---RNGHELTGNEPGVSILEDGTLLILASVSPLDNGEYTCMAVNDA-GTTEKKYQLKVNVPPDIR-DNGLLSNVSVVINQPTNLVCDVTGTPVPVITWYKD 1390          
BLAST of hmctn vs. Ensembl Zebrafish
Match: boc (BOC cell adhesion associated, oncogene regulated [Source:ZFIN;Acc:ZDB-GENE-030131-6560])

HSP 1 Score: 64.3142 bits (155), Expect = 3.454e-10
Identity = 47/205 (22.93%), Postives = 95/205 (46.34%), Query Frame = 3
Query:  642 LKIYQSNYVLME---LKIDNLKITDDGEYECLY--------STEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKS--FKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSA 1217
            L+  + NY++M    L+I N    D+G Y C           T    DR  ++      A I+    S+  ++V + +++++ C + GIP+P ++W    K+GL+ R +NN + +  N   + I   S   +G+Y C+ DN +    S    + ++++  P +++     + + G        + G P  ++ W  N++ L+ S 
Sbjct:  175 LETSKGNYLIMPSGNLQIANATRDDEGPYICAAYNPVTQEIKTSTSTDRLRIRRSTSEAARIIYPPASRS-IMVNKGQRLVLECVASGIPTPQVTWA---KDGLDLRNHNNTRFLLSN---LLIDAASESDSGTYVCLADNGIGSTSSAQVLYDVQVFEPPQVRVELQQQDVAWGDTVRFSCQVRGKPAPTVVWLHNAQPLSPSP 372          
BLAST of hmctn vs. Ensembl Zebrafish
Match: cadm2b (cell adhesion molecule 2b [Source:ZFIN;Acc:ZDB-GENE-080506-3])

HSP 1 Score: 62.7734 bits (151), Expect = 5.562e-10
Identity = 54/235 (22.98%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGI-PSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTI-----FNVSRIHNGS-YTCIVDNKVEGKQSKSFK--LEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPI-NSIQWEKNSKIL 1205
            T ++ ++  T++ W     +Q L F  +   +D R  +++ ++++  + + I ++ ++D+G+Y C   T      K     + VPA    TG S+     +E E V ++C + G  P+ +I W+ N K      +   +K++     + T+       V R  +G+ YTC+V++   G         LE+ Y P +K+ + VI   +G+   ++ +  G+P+   + W K+   L
Sbjct:   32 TCRVDYNDNTSLQWSNPA-QQTLFFGDKKALRDNR--IELVRASWKELTISISDVALSDEGQYTCSLFTMPVKTSKAFLTVLGVPAKPEITGLSRP---AQEGEDVTLTCTTSGSKPAADIRWFRNDK-----EVQAGQKEVNATGRSFTVRSSVHLKVDRKDDGAAYTCVVEHVTLGSLPHQVTEVLEVHYPPQVKIVHSVIVPQEGQYFKLECMSKGNPLPEPVMWTKDGGEL 255          
BLAST of hmctn vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 75.485 bits (184), Expect = 2.862e-13
Identity = 53/186 (28.49%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAI-----INGHPINSIQWEKNSKILNLSAN 1220
            L+     ++D G Y C  S     D +   + VLVP  I  TG+ Q+ + VKER  + +SC + G P P I+W    K+G +  L +    I      + I NV    +G Y C+  N   G++S+SF L +   P+IK G         +  ++ +I     ++ HP  +I W K+ ++     N
Sbjct: 2414 LRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKI--TGSVQEEIKVKERGNITLSCEATGTPIPQITWL---KDG-HPVLEDTNHRIDHKGQLLRISNVMMTDSGRYVCVASNPA-GERSRSFSLGVLISPTIK-GAINGSPEDVKVVLLSSISLECEVHSHPPATITWHKDGRLFKFKDN 2591          

HSP 2 Score: 71.2478 bits (173), Expect = 4.896e-12
Identity = 53/218 (24.31%), Postives = 95/218 (43.58%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN-------LSANKCFYIGRT------KKYCFYLDKTGHFQEQ 1292
            L+I + ++ + G + CL S      +K   ++V +P  I     +Q+ + V +++++ + C S  +P P I+W  + +    + + +    I  N   V I N      G YTCI  N + GK +K F L I   PSI+ G  ++         ++ I +G P+    W K+  +L+       +S N   YI         + +C   +  G  Q Q
Sbjct: 3537 LRITSAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGVSGTQN-ITVLQKKQITMECKSDALPPPRITWLKDGQPLQPSPMVH----ILSNGQFVQIDNTEVTDTGRYTCIATN-IAGKTTKEFILNIQVPPSIEEGPSLVTAFVDEPVTLECISSGVPLPKTAWRKDGSLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQ 3748          

HSP 3 Score: 63.5438 bits (153), Expect = 1.045e-9
Identity = 51/188 (27.13%), Postives = 84/188 (44.68%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVII------SCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSA 1217
            L+I   +ITD G Y C  +       K   + + VPA I   G  + H    + +KVI+       C + G P P I+W    K+G+     +N + +  N   + I N      G YTC+  N V G+    +K+ +   PSI+ GND  + +        ++ + +G P+ S+ W KN   ++ S 
Sbjct: 1579 LRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARI--HGDEKKH----QNKKVIVGKSLTLECEATGHPPPLITWL---KDGVPVETNDNIR-LHYNGKKLEIRNTVEYDRGLYTCVAVN-VAGETEMKYKVSVLVPPSIEGGNDPADHTVIASGAVELECLASGTPLPSVMWLKNGTPVDTSG 1755          

HSP 4 Score: 63.5438 bits (153), Expect = 1.063e-9
Identity = 52/185 (28.11%), Postives = 85/185 (45.95%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVP-AVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L+I   +++D GEY C+   +    +KT  L +  P +++     S   + VK     I+ C S  IP+P I+WY   KNG   R  ++ +        + I NV     G Y CIV N V G+ +K F L ++  PSI+       N +I+ S            G P+ +++W K+   + L+
Sbjct: 2975 LQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPAPVINWY---KNGQPIRETSSYQ-FLEGGQRLNIRNV--FDTGEYECIVTNVV-GQDNKKFFLNVYVHPSIQGLQNEYHNGIIQNS----VTFSCDAYGIPVPTLRWLKDGHPIGLT 3148          

HSP 5 Score: 61.6178 bits (148), Expect = 4.514e-9
Identity = 50/185 (27.03%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            ++IDN ++TD G Y C+ +       K   L + VP  I   G S     V E   V + C S G+P P  +W    K+G +   ++N + +     ++ I  V    +G Y C+  N   G   +   L ++  P IK     I      +T +   + G P   IQW+KN   +N   N+  Y
Sbjct: 3630 VQIDNTEVTDTGRYTCIATNIAGKTTKEFILNIQVPPSI-EEGPSLVTAFVDE--PVTLECISSGVPLPKTAWR---KDG-SLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAA-GSSQRQIDLLVYDPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMY 3806          

HSP 6 Score: 61.2326 bits (147), Expect = 6.789e-9
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSA 1217
            ++KI   ++TD G Y CL S  +    KT  L + VP  I  +G + + L V   E + + CN+ GIP+P I W  + K+ + +  Y    +I  +   +TI        G YTC+  N   G+  + F + ++  P        I+ ++G   ++ A+++          G P   I W KN   L +S+
Sbjct: 3161 KMKIARAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNE-LNVLPGEIIQLICNAKGIPTPVIHWLKDGKH-ITSEDYLG-INITSDGEILTISKTQTSDMGKYTCVATNPA-GEDDRIFNVNVFVAPK-------IDDNKGTPVVLTAVLDTSINVECHASGFPTPQINWLKNGLPLPVSS 3340          

HSP 7 Score: 60.8474 bits (146), Expect = 6.964e-9
Identity = 58/236 (24.58%), Postives = 102/236 (43.22%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILN--------LSANKCFYIGRTK-----KYCFYLDKTGHFQEQKAQLWIY-NLSAIDFT 1337
            L ID+L   D+GEY C+ S E     K   L+V  P +I       +  ++  +   ++ C + G P P I+WY     G      +    I      + I  ++   +G YTC  +N + G+  K + + +   P+I     + + S   GRE  ++  + G P  SIQW K +++L+        L   +  +I  ++     KY      T   Q ++ +L +Y N + + FT
Sbjct: 1307 LVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLL-CEASGSPPPLITWY----KGRTQVDESATVQILEKGKILKILKMALKDSGHYTCKANN-IAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGREVNLECKVKGIPFPSIQWFKENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTAGSQTKEIKLTVYSNTTDLSFT 1536          

HSP 8 Score: 60.8474 bits (146), Expect = 8.047e-9
Identity = 50/193 (25.91%), Postives = 84/193 (43.52%), Query Frame = 3
Query:  657 SNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            S+Y ++    L I +    D G Y C+         K V+L+V VP VI+P    Q   ++   + ++I C ++G P+P I W+   K+G+  A+L   +         + I  V     G YTC  +N + G  + S  L +   P I      +      +T +    +G P  +I W KN+  + + A K
Sbjct: 3985 SSYTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLKVHVPPVIVP---HQKEYVISMDKSIMIVCEAHGSPTPEIIWH---KDGVPLAKLAGQRMSA---TGGLHIAVVQPDDAGEYTCTAEN-IAGSVNSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGK 4167          

HSP 9 Score: 58.5362 bits (140), Expect = 3.943e-8
Identity = 46/176 (26.14%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN--GHPINSIQWEKNSK 1199
            L + N ++ D G+Y C+        +    L V VP  I+    +   LI    E +I+ C S  IP P ++WY +WK  +N       +D     + + I        G Y+C   N + GK  K+F + I   P+I+   +  E +    T+I  + +  G P  ++ W+KN +
Sbjct: 2036 LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYVPPNIMGEEQNISSLI---SETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISED----GSILKIEGAQVKDTGRYSCEAVN-IAGKTEKNFNVNIMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIPPPALAWKKNGQ 2203          

HSP 10 Score: 57.3806 bits (137), Expect = 1.004e-7
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARL-YNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGH----------PINSIQWEKNSKILNLSAN 1220
            L+I  ++ +D   Y C+ S    +D+K   ++V V   +     +Q   ++++ + V++ C + G+P+P ISW  + K   +  L Y   + + ++     + +++R     YTC+  N   G+ SK F L +   P I  G++V E+       +  ++N H          P   I W K+ + L+ + N
Sbjct: 3351 LRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPSLDEADVTQQITVIRD-DPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVKAKMDDIAR-----YTCVASNAA-GRVSKHFILNVMEPPHIN-GSEVTEE-------LSVVVNTHLDLLCYTTGFPPPLITWLKDGQPLSQNDN 3527          

HSP 11 Score: 56.9954 bits (136), Expect = 1.150e-7
Identity = 55/226 (24.34%), Postives = 96/226 (42.48%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME----LKIDNLKITDDGEYEC-LYSTEKYIDRKTVKLRVLVPAVILPTGT-SQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            PK TI+W++K +                  + +  ++ ++ E    L + +    D GEY C   +   Y  RK V+L V     +L  G  +Q  + V+  + VI+ C    +P P I+W    K       ++ +  IF +  ++ IF       G YTC+  N + G  ++  KL ++  P I+ G  +I    G    I  I +G P  +  W K+ +I+  
Sbjct: 1009 PKPTIIWKKKGE------------------IVVPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYAARK-VQLTVYGKVFLLYIGNKNQIEISVRAGDDVILPCEVKSVPPPFITWA---KETQLISPFSQRHSIFPS-GSLKIFETRVSDAGMYTCVGTN-IAGNITQLVKLSVYVPPKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDGQIMEF 1210          

HSP 12 Score: 56.225 bits (134), Expect = 2.288e-7
Identity = 43/187 (22.99%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  696 KITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV--NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIG 1238
            ++ D G Y C+        +K+  L + VP  ++  G++ +++ V E   + ++C   G P P +SW        +  + N+   +F+     T+ I        G Y+CI  N+  G+  K+F L+I+  PSI    +  +  +       T+++   N  P   I W KN + +  +++  F  G
Sbjct: 2889 QLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVI--GSNSENVTVVESNFISLTCEVTGFPPPAVSWLK------DTMVLNSDSHLFIVPGGRTLQIPQTRLSDVGEYSCIAINQA-GEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPAPVINWYKNGQPIRETSSYQFLEG 3066          

HSP 13 Score: 53.1434 bits (126), Expect = 2.081e-6
Identity = 46/180 (25.56%), Postives = 76/180 (42.22%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIIS--CNSYGIPSPNISWYANWKN----GLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQS--QGRETMIQAIINGHPINSIQWEK 1190
            LKI+  ++ D G Y C          K   + ++VP  I  +    +  I+   E  +IS  C+S GIP P ++W  N ++    G   R ++ +  +      + I    +    SYTC   N V G   K + ++++  PSI + GN   E    QG    ++    G P   + W K
Sbjct: 2127 LKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVPPAIRGSAEESEVNII---EGTLISLLCDSTGIPPPALAWKKNGQHSILIGQPFRFWHIR--LLSGGRQLQIITARKSDAASYTCTASNSV-GSAMKKYTVKVYVRPSISESGNHPSEIVVIQGNNVTLECDARGDPQPMLTWLK 2300          

HSP 14 Score: 51.2174 bits (121), Expect = 7.689e-6
Identity = 44/184 (23.91%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVN--YNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKN 1193
            L+     + D G+Y C+ +       +T+ L V  P  I  +G      ++     +I+ C + G P P ++W+ +     N +L  N  DI V+     + I      H G+Y C+  + + G+   S+ L++   PSI           GR + I  I+N          G P  S+ W K+
Sbjct: 1851 LQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIENSGELIQETVLAN-HNIILECKATGNPDPVVTWFKD-----NQQL-TNTGDISVSDRGQVLQISGAQVFHAGTYKCVAAS-IAGRAELSYNLQVHVPPSI----------SGRSSSITVIVNNVVRLECEATGFPAPSLTWLKD 2016          

HSP 15 Score: 51.2174 bits (121), Expect = 7.821e-6
Identity = 53/193 (27.46%), Postives = 82/193 (42.49%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNV--SRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTK 1247
            LKI  + + D G Y C  +      +K   + VL P  I   GT  D  ++  RE V + C   GIP P+I W+         RL + +    V      + ++  SR+ + G Y CI  N   G Q+K  KL ++   +     D+     G E  ++    G P  +I W K+ + L L +    YI + K
Sbjct: 1400 LKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGRE-VNLECKVKGIPFPSIQWFK------ENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTA-GSQTKEIKLTVYSNTT-----DLSFTVNG-EINLECDARGIPPPTIIWYKDGEPL-LPSPYVTYIQKGK 1577          
BLAST of hmctn vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 75.0998 bits (183), Expect = 2.911e-13
Identity = 53/186 (28.49%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAI-----INGHPINSIQWEKNSKILNLSAN 1220
            L+     ++D G Y C  S     D +   + VLVP  I  TG+ Q+ + VKER  + +SC + G P P I+W    K+G +  L +    I      + I NV    +G Y C+  N   G++S+SF L +   P+IK G         +  ++ +I     ++ HP  +I W K+ ++     N
Sbjct: 2337 LRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKI--TGSVQEEIKVKERGNITLSCEATGTPIPQITWL---KDG-HPVLEDTNHRIDHKGQLLRISNVMMTDSGRYVCVASNPA-GERSRSFSLGVLISPTIK-GAINGSPEDVKVVLLSSISLECEVHSHPPATITWHKDGRLFKFKDN 2514          

HSP 2 Score: 71.2478 bits (173), Expect = 5.022e-12
Identity = 53/218 (24.31%), Postives = 95/218 (43.58%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN-------LSANKCFYIGRT------KKYCFYLDKTGHFQEQ 1292
            L+I + ++ + G + CL S      +K   ++V +P  I     +Q+ + V +++++ + C S  +P P I+W  + +    + + +    I  N   V I N      G YTCI  N + GK +K F L I   PSI+ G  ++         ++ I +G P+    W K+  +L+       +S N   YI         + +C   +  G  Q Q
Sbjct: 3468 LRITSAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGVSGTQN-ITVLQKKQITMECKSDALPPPRITWLKDGQPLQPSPMVH----ILSNGQFVQIDNTEVTDTGRYTCIATN-IAGKTTKEFILNIQVPPSIEEGPSLVTAFVDEPVTLECISSGVPLPKTAWRKDGSLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQ 3679          

HSP 3 Score: 65.855 bits (159), Expect = 2.222e-10
Identity = 51/185 (27.57%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVP-AVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L+I   +++D GEY C+   +    +KT  L +  P +++     S   + VK     I+ C S  IP+P I+WY   KNG   R  ++ +        + I N      G Y CIV N V G+ +K F L ++  PSI+       N +I+ S            G P+ +++W K+   + L+
Sbjct: 2902 LQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPAPVINWY---KNGQPIRETSSYQ-FLEGGQRLNIRNAQVFDTGEYECIVTNVV-GQDNKKFFLNVYVHPSIQGLQNEYHNGIIQNS----VTFSCDAYGIPVPTLRWLKDGHPIGLT 3077          

HSP 4 Score: 64.3142 bits (155), Expect = 7.251e-10
Identity = 57/195 (29.23%), Postives = 86/195 (44.10%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNV--SRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTK 1247
            LKI  + + D G Y C  +      +K   + VL P  I   GT  D  ++  RE V + C   GIP P+I W+         RL + +    V      + ++  SR+ + G Y CI  N   G Q+K  KL ++  P+IK GN   + S     E  ++    G P  +I W K+ + L L +    YI + K
Sbjct: 1395 LKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGRE-VNLECKVKGIPFPSIQWFK------ENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTA-GSQTKEIKLTVYIAPTIKDGNSTTDLSFTVNGEINLECDARGIPPPTIIWYKDGEPL-LPSPYVTYIQKGK 1580          

HSP 5 Score: 62.7734 bits (151), Expect = 1.817e-9
Identity = 51/191 (26.70%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSA 1217
            ++KI   ++TD G Y CL S  +    KT  L + VP  I  +G + + L V   E + + CN+ GIP+P I W  + K+  N         I  +   +TI        G YTC+  N   G+  + F + ++  P        I+ ++G   ++ A+++          G P   I W KN   L +S+
Sbjct: 3090 KMKIARAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNE-LNVLPGEIIQLICNAKGIPTPVIHWLKDGKHITNLVGETISGCITSDGEILTISKTQTSDMGKYTCVATNPA-GEDDRIFNVNVFVAPK-------IDDNKGTPVVLTAVLDTSINVECHASGFPTPQINWLKNGLPLPVSS 3271          

HSP 6 Score: 61.6178 bits (148), Expect = 4.710e-9
Identity = 50/185 (27.03%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            ++IDN ++TD G Y C+ +       K   L + VP  I   G S     V E   V + C S G+P P  +W    K+G +   ++N + +     ++ I  V    +G Y C+  N   G   +   L ++  P IK     I      +T +   + G P   IQW+KN   +N   N+  Y
Sbjct: 3561 VQIDNTEVTDTGRYTCIATNIAGKTTKEFILNIQVPPSI-EEGPSLVTAFVDE--PVTLECISSGVPLPKTAWR---KDG-SLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAA-GSSQRQIDLLVYDPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMY 3737          

HSP 7 Score: 60.8474 bits (146), Expect = 8.115e-9
Identity = 50/193 (25.91%), Postives = 84/193 (43.52%), Query Frame = 3
Query:  657 SNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            S+Y ++    L I +    D G Y C+         K V+L+V VP VI+P    Q   ++   + ++I C ++G P+P I W+   K+G+  A+L   +         + I  V     G YTC  +N + G  + S  L +   P I      +      +T +    +G P  +I W KN+  + + A K
Sbjct: 3916 SSYTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLKVHVPPVIVP---HQKEYVISMDKSIMIVCEAHGSPTPEIIWH---KDGVPLAKLAGQRMSA---TGGLHIAVVQPDDAGEYTCTAEN-IAGSVNSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGK 4098          

HSP 8 Score: 60.8474 bits (146), Expect = 8.468e-9
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILN 1208
            L ID+L   D+GEY C+ S E     K   L+V  P +I       +  ++  +   ++ C + G P P I+WY     G      +    I      + I  ++   +G YTC  +N + G+  K + + +   P+I     + + S   GRE  ++  + G P  SIQW K +++L+
Sbjct: 1302 LVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLL-CEASGSPPPLITWY----KGRTQVDESATVQILEKGKILKILKMALKDSGHYTCKANN-IAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGREVNLECKVKGIPFPSIQWFKENRLLS 1474          

HSP 9 Score: 58.5362 bits (140), Expect = 4.079e-8
Identity = 46/176 (26.14%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN--GHPINSIQWEKNSK 1199
            L + N ++ D G+Y C+        +    L V VP  I+    +   LI    E +I+ C S  IP P ++WY +WK  +N       +D     + + I        G Y+C   N + GK  K+F + I   P+I+   +  E +    T+I  + +  G P  ++ W+KN +
Sbjct: 1960 LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYVPPNIMGEEQNISSLI---SETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISED----GSILKIEGAQVKDTGRYSCEAVN-IAGKTEKNFNVNIMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIPPPALAWKKNGQ 2127          

HSP 10 Score: 57.3806 bits (137), Expect = 1.021e-7
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARL-YNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGH----------PINSIQWEKNSKILNLSAN 1220
            L+I  ++ +D   Y C+ S    +D+K   ++V V   +     +Q   ++++ + V++ C + G+P+P ISW  + K   +  L Y   + + ++     + +++R     YTC+  N   G+ SK F L +   P I  G++V E+       +  ++N H          P   I W K+ + L+ + N
Sbjct: 3282 LRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPSLDEADVTQQITVIRD-DPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVKAKMDDIAR-----YTCVASNAA-GRVSKHFILNVMEPPHIN-GSEVTEE-------LSVVVNTHLDLLCYTTGFPPPLITWLKDGQPLSQNDN 3458          

HSP 11 Score: 56.6102 bits (135), Expect = 1.497e-7
Identity = 48/182 (26.37%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWY-EPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN 1208
            EL + N +  D G Y C  S     D  TV+L V  P    P+ T    ++ + E E++ + C + G P P+ +W   +K+ +   L + +       N + I  VSR ++G+Y C+ +N V    S +  + ++  EP +  G  N       G   ++  ++ G+P   IQW K +K+++
Sbjct: 4106 ELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTVHFP----PSFTEMPTIVSLNEGERLSLLCKATGNPLPHTTWI--FKDKILPVLQDRRSK---QQNELVIDKVSRENSGAYMCVAENIV---ASINTTIHVFVKEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVIS 4275          

HSP 12 Score: 56.6102 bits (135), Expect = 1.759e-7
Identity = 55/225 (24.44%), Postives = 96/225 (42.67%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME----LKIDNLKITDDGEYEC-LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            PK TI+W++K +                  + +  ++ ++ E    L + +    D GEY C   +   Y  RK V+L V    V L +  +Q  + V+  + VI+ C    +P P I+W    K       ++ +  IF +  ++ IF       G YTC+  N + G  ++  KL ++  P I+ G  +I    G    I  I +G P  +  W K+ +I+  
Sbjct:  997 PKPTIIWKKKGE------------------IVVPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYAARK-VQLTVY-GKVFLLSQKNQIEISVRAGDDVILPCEVKSVPPPFITWA---KETQLISPFSQRHSIFPS-GSLKIFETRVSDAGMYTCVGTN-IAGNITQLVKLSVYVPPKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDGQIMEF 1196          

HSP 13 Score: 56.225 bits (134), Expect = 2.156e-7
Identity = 54/185 (29.19%), Postives = 83/185 (44.86%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-MGNDVIEQSQGRETMIQ----AIINGHPINSIQWEKNSKILNLS 1214
            LKI   +++D G Y C+ +       + VKL V VP    P       LI VK      I+C S+GIP P  +WY   K+G        + +     N + + +      G+YTC+  N V G  S +  +EI+  P++  +     +Q+Q R +  Q      + GHP   I+W +N K L  S
Sbjct: 1118 LKIFETRVSDAGMYTCVGTNIAGNITQLVKLSVYVP----PKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWY---KDGQIMEFDQGQDN-----NMLRVESAKPSDGGTYTCVASN-VIGTDSANATVEIYAPPTLSDLEPPYNKQNQERISRQQISFPCPVKGHPKPVIKWFRNGKELTGS 1289          

HSP 14 Score: 52.373 bits (124), Expect = 3.582e-6
Identity = 46/184 (25.00%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIIS--CNSYGIPSPNISWYANWKNGL--------NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQS--QGRETMIQAIINGHPINSIQWEK 1190
            LKI+  ++ D G Y C          K   + ++VP  I  +    +  I+   E  +IS  C+S GIP P ++W  N ++ +        + RL +  + +        I    +    SYTC   N V G   K + ++++  PSI + GN   E    QG    ++    G P   + W K
Sbjct: 2051 LKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVPPAIRGSAEESEVNII---EGTLISLLCDSTGIPPPALAWKKNGQHNVAIQSGAAGHIRLLSGGRQL-------QIITARKSDAASYTCTASNSV-GSAMKKYTVKVYVRPSISESGNHPSEIVVIQGNNVTLECDARGDPQPMLTWLK 2223          

HSP 15 Score: 51.6026 bits (122), Expect = 5.073e-6
Identity = 69/288 (23.96%), Postives = 112/288 (38.89%), Query Frame = 3
Query:  444 SATNAESDCEYVQILNQIAKSKPKKDSRRTLQLTFS--------------PKTTIVWRRK----MDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVII------SCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVI----EQSQGRET---MIQAIINGHPINSIQWEKNSKILNLS 1214
            +A  A S  + +++   IA +   KD   T  L+F+              P  TI+W +     +   Y+T+              I +  Y    L+I   +ITD G Y C  +       K   + + VPA I   G  + H    + +KVI+       C + G P P I+W    K+G+     +N + +  N   + I N      G YTC+  N V G+    +K+ +    S K  N V+    +Q     T   +   I +G P   I W K+    N++
Sbjct: 1506 AANTAGSQTKEIKLTVYIAPTI--KDGNSTTDLSFTVNGEINLECDARGIPPPTIIWYKDGEPLLPSPYVTY--------------IQKGKY----LRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARI--HGDEKKH----QNKKVIVGKSLTLECEATGHPPPLITWL---KDGVPVETNDNIR-LHYNGKKLEIRNTVEYDRGLYTCVAVN-VAGETEMKYKVSVLAGSSTKQFNVVVHGELKQKHDHHTFSYLTSCIASGIPNPHITWLKDGLPFNVA 1762          

HSP 16 Score: 51.2174 bits (121), Expect = 7.887e-6
Identity = 44/184 (23.91%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVN--YNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKN 1193
            L+     + D G+Y C+ +       +T+ L V  P  I  +G      ++     +I+ C + G P P ++W+ +     N +L  N  DI V+     + I      H G+Y C+  + + G+   S+ L++   PSI           GR + I  I+N          G P  S+ W K+
Sbjct: 1775 LQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIENSGELIQETVLAN-HNIILECKATGNPDPVVTWFKD-----NQQL-TNTGDISVSDRGQVLQISGAQVFHAGTYKCVAAS-IAGRAELSYNLQVHVPPSI----------SGRSSSITVIVNNVVRLECEATGFPAPSLTWLKD 1940          
BLAST of hmctn vs. Ensembl Xenopus
Match: ENSXETT00000036915.1 (hemicentin 2 [Source:NCBI gene;Acc:100490941])

HSP 1 Score: 72.0182 bits (175), Expect = 2.235e-12
Identity = 55/221 (24.89%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  549 SPKTTIVWRR-KMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV-IEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            SP   + WR+  +    ++ +H LL                   L++  L++ D G Y CL S        T  L V VP  + P       L+ +  +   + C +YG P P +SWY   K+G   R+  ++  +     ++++  V    +G+Y C+  +   G+ S  F+LE+  E   + G+DV +EQ+     ++   + G P   I+W KN  +L
Sbjct:  997 SPLPVVSWRKDSLPLPIVSARHHLLPS---------------WSLRLSELRVMDSGYYSCLASNPAGNTSLTYSLEVQVPPRVHPGAKVLKALLGRTLQ---LPCLAYGDPMPRLSWY---KDGEPMRV-GDQDSLQGPDGSISVLEVQLSDSGNYRCVATSSA-GEDSLEFRLEVLGE-VPEYGSDVLLEQTAYEPVILTCPVQGTPTPLIRWMKNGVVL 1193          

HSP 2 Score: 52.7582 bits (125), Expect = 2.233e-6
Identity = 56/239 (23.43%), Postives = 93/239 (38.91%), Query Frame = 3
Query:  528 RTLQLTF----SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQA--------IINGHPINSIQWEKNSKIL 1205
            RTLQL       P   + W +  +   +  Q  L   D   S              +  ++++D G Y C+ ++    D    +L VL     +P   S   L     E VI++C   G P+P I W    KNG+   L  N   +  +   ++ I +    H G Y C+  N+  G   +  KL ++ +P I       E  QG+   + A         ++G P  ++ W K+ K +
Sbjct: 1077 RTLQLPCLAYGDPMPRLSWYKDGEPMRVGDQDSLQGPDGSIS--------------VLEVQLSDSGNYRCVATSSAGEDSLEFRLEVLGE---VPEYGSDVLLEQTAYEPVILTCPVQGTPTPLIRWM---KNGV--VLVGNLPGMTQLGNGSLLIESPVPNHGGDYICVATNEA-GSARRKTKLVVYAKPKI------FEDGQGKNISVMANQPLTLRCEVSGVPFPTVTWSKDGKAV 1286          
BLAST of hmctn vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 71.2478 bits (173), Expect = 5.022e-12
Identity = 53/218 (24.31%), Postives = 95/218 (43.58%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN-------LSANKCFYIGRT------KKYCFYLDKTGHFQEQ 1292
            L+I + ++ + G + CL S      +K   ++V +P  I     +Q+ + V +++++ + C S  +P P I+W  + +    + + +    I  N   V I N      G YTCI  N + GK +K F L I   PSI+ G  ++         ++ I +G P+    W K+  +L+       +S N   YI         + +C   +  G  Q Q
Sbjct: 3467 LRITSAQVENVGRFVCLASNHAGDTKKEFLVKVHIPPNIAGVSGTQN-ITVLQKKQITMECKSDALPPPRITWLKDGQPLQPSPMVH----ILSNGQFVQIDNTEVTDTGRYTCIATN-IAGKTTKEFILNIQVPPSIEEGPSLVTAFVDEPVTLECISSGVPLPKTAWRKDGSLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQ 3678          

HSP 2 Score: 65.855 bits (159), Expect = 2.222e-10
Identity = 51/185 (27.57%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVP-AVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L+I   +++D GEY C+   +    +KT  L +  P +++     S   + VK     I+ C S  IP+P I+WY   KNG   R  ++ +        + I N      G Y CIV N V G+ +K F L ++  PSI+       N +I+ S            G P+ +++W K+   + L+
Sbjct: 2903 LQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPAPVINWY---KNGQPIRETSSYQ-FLEGGQRLNIRNAQVFDTGEYECIVTNVV-GQDNKKFFLNVYVHPSIQGLQNEYHNGIIQNS----VTFSCDAYGIPVPTLRWLKDGHPIGLT 3078          

HSP 3 Score: 64.3142 bits (155), Expect = 7.251e-10
Identity = 57/195 (29.23%), Postives = 86/195 (44.10%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNV--SRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTK 1247
            LKI  + + D G Y C  +      +K   + VL P  I   GT  D  ++  RE V + C   GIP P+I W+         RL + +    V      + ++  SR+ + G Y CI  N   G Q+K  KL ++  P+IK GN   + S     E  ++    G P  +I W K+ + L L +    YI + K
Sbjct: 1407 LKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGRE-VNLECKVKGIPFPSIQWFK------ENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTA-GSQTKEIKLTVYIAPTIKDGNSTTDLSFTVNGEINLECDARGIPPPTIIWYKDGEPL-LPSPYVTYIQKGK 1592          

HSP 4 Score: 61.6178 bits (148), Expect = 4.750e-9
Identity = 50/185 (27.03%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            ++IDN ++TD G Y C+ +       K   L + VP  I   G S     V E   V + C S G+P P  +W    K+G +   ++N + +     ++ I  V    +G Y C+  N   G   +   L ++  P IK     I      +T +   + G P   IQW+KN   +N   N+  Y
Sbjct: 3560 VQIDNTEVTDTGRYTCIATNIAGKTTKEFILNIQVPPSI-EEGPSLVTAFVDE--PVTLECISSGVPLPKTAWR---KDG-SLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAA-GSSQRQIDLLVYDPPRIKSEPTNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPINTDLNQNMY 3736          

HSP 5 Score: 60.8474 bits (146), Expect = 6.964e-9
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSA 1217
            ++KI   ++TD G Y CL S  +    KT  L + VP  I  +G + + L V   E + + CN+ GIP+P I W  + K+ + +  Y    +I  +   +TI        G YTC+  N   G+  + F + ++  P        I+ ++G   ++ A+++          G P   I W KN   L +S+
Sbjct: 3091 KMKIARAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNE-LNVLPGEIIQLICNAKGIPTPVIHWLKDGKH-ITSEDYLG-INITSDGEILTISKTQTSDMGKYTCVATNPA-GEDDRIFNVNVFVAPK-------IDDNKGTPVVLTAVLDTSINVECHASGFPTPQINWLKNGLPLPVSS 3270          

HSP 6 Score: 60.8474 bits (146), Expect = 8.185e-9
Identity = 50/193 (25.91%), Postives = 84/193 (43.52%), Query Frame = 3
Query:  657 SNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN-ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            S+Y ++    L I +    D G Y C+         K V+L+V VP VI+P    Q   ++   + ++I C ++G P+P I W+   K+G+  A+L   +         + I  V     G YTC  +N + G  + S  L +   P I      +      +T +    +G P  +I W KN+  + + A K
Sbjct: 3915 SSYTILSNGNLNIASATQEDAGTYTCIAQNPAGTALKKVRLKVHVPPVIVP---HQKEYVISMDKSIMIVCEAHGSPTPEIIWH---KDGVPLAKLAGQRMSA---TGGLHIAVVQPDDAGEYTCTAEN-IAGSVNSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGK 4097          

HSP 7 Score: 60.8474 bits (146), Expect = 8.613e-9
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILN 1208
            L ID+L   D+GEY C+ S E     K   L+V  P +I       +  ++  +   ++ C + G P P I+WY     G      +    I      + I  ++   +G YTC  +N + G+  K + + +   P+I     + + S   GRE  ++  + G P  SIQW K +++L+
Sbjct: 1314 LVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLL-CEASGSPPPLITWY----KGRTQVDESATVQILEKGKILKILKMALKDSGHYTCKANN-IAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGREVNLECKVKGIPFPSIQWFKENRLLS 1486          

HSP 8 Score: 60.4622 bits (145), Expect = 9.377e-9
Identity = 55/242 (22.73%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV--NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIG 1238
            T+ +T SP  TI W +         ++  LT  +               LKI   ++ D G Y C+        +K+  L + VP  ++  G++ +++ V E   + ++C   G P P +SW        +  + N+   +F+     T+ I        G Y+CI  N+  G+  K+F L+I+  PSI    +  +  +       T+++   N  P   I W KN + +  +++  F  G
Sbjct: 2776 TVAVTGSPAPTISWLKDGHPIQEGTRYHFLTNGR--------------TLKILYAQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVI--GSNSENVTVVESNFISLTCEVTGFPPPAVSWLK------DTMVLNSDSHLFIVPGGRTLQIPQTRLSDVGEYSCIAINQA-GEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTILECESNAIPAPVINWYKNGQPIRETSSYQFLEG 2994          

HSP 9 Score: 58.5362 bits (140), Expect = 4.079e-8
Identity = 46/176 (26.14%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN--GHPINSIQWEKNSK 1199
            L + N ++ D G+Y C+        +    L V VP  I+    +   LI    E +I+ C S  IP P ++WY +WK  +N       +D     + + I        G Y+C   N + GK  K+F + I   P+I+   +  E +    T+I  + +  G P  ++ W+KN +
Sbjct: 1973 LALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYVPPNIMGEEQNISSLI---SETLILKCESDAIPPPVLTWYKDWKPLVNRPGLTISED----GSILKIEGAQVKDTGRYSCEAVN-IAGKTEKNFNVNIMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIPPPALAWKKNGQ 2140          

HSP 10 Score: 57.3806 bits (137), Expect = 1.021e-7
Identity = 45/192 (23.44%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARL-YNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGH----------PINSIQWEKNSKILNLSAN 1220
            L+I  ++ +D   Y C+ S    +D+K   ++V V   +     +Q   ++++ + V++ C + G+P+P ISW  + K   +  L Y   + + ++     + +++R     YTC+  N   G+ SK F L +   P I  G++V E+       +  ++N H          P   I W K+ + L+ + N
Sbjct: 3281 LRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPSLDEADVTQQITVIRD-DPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVKAKMDDIAR-----YTCVASNAA-GRVSKHFILNVMEPPHIN-GSEVTEE-------LSVVVNTHLDLLCYTTGFPPPLITWLKDGQPLSQNDN 3457          

HSP 11 Score: 56.6102 bits (135), Expect = 1.497e-7
Identity = 48/182 (26.37%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWY-EPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN 1208
            EL + N +  D G Y C  S     D  TV+L V  P    P+ T    ++ + E E++ + C + G P P+ +W   +K+ +   L + +       N + I  VSR ++G+Y C+ +N V    S +  + ++  EP +  G  N       G   ++  ++ G+P   IQW K +K+++
Sbjct: 4105 ELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTVHFP----PSFTEMPTIVSLNEGERLSLLCKATGNPLPHTTWI--FKDKILPVLQDRRSK---QQNELVIDKVSRENSGAYMCVAENIV---ASINTTIHVFVKEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVIS 4274          

HSP 12 Score: 56.6102 bits (135), Expect = 1.759e-7
Identity = 55/225 (24.44%), Postives = 96/225 (42.67%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME----LKIDNLKITDDGEYEC-LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            PK TI+W++K +                  + +  ++ ++ E    L + +    D GEY C   +   Y  RK V+L V    V L +  +Q  + V+  + VI+ C    +P P I+W    K       ++ +  IF +  ++ IF       G YTC+  N + G  ++  KL ++  P I+ G  +I    G    I  I +G P  +  W K+ +I+  
Sbjct: 1009 PKPTIIWKKKGE------------------IVVPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYAARK-VQLTVY-GKVFLLSQKNQIEISVRAGDDVILPCEVKSVPPPFITWA---KETQLISPFSQRHSIFPS-GSLKIFETRVSDAGMYTCVGTN-IAGNITQLVKLSVYVPPKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDGQIMEF 1208          

HSP 13 Score: 56.225 bits (134), Expect = 2.156e-7
Identity = 54/185 (29.19%), Postives = 83/185 (44.86%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-MGNDVIEQSQGRETMIQ----AIINGHPINSIQWEKNSKILNLS 1214
            LKI   +++D G Y C+ +       + VKL V VP    P       LI VK      I+C S+GIP P  +WY   K+G        + +     N + + +      G+YTC+  N V G  S +  +EI+  P++  +     +Q+Q R +  Q      + GHP   I+W +N K L  S
Sbjct: 1130 LKIFETRVSDAGMYTCVGTNIAGNITQLVKLSVYVP----PKIQRGPKLIRVKLGHSFEIACISHGIPPPTAAWY---KDGQIMEFDQGQDN-----NMLRVESAKPSDGGTYTCVASN-VIGTDSANATVEIYAPPTLSDLEPPYNKQNQERISRQQISFPCPVKGHPKPVIKWFRNGKELTGS 1301          

HSP 14 Score: 54.299 bits (129), Expect = 7.707e-7
Identity = 49/202 (24.26%), Postives = 86/202 (42.57%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLV-PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFV--NYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKNSKILNLSANKCFYIGRT 1244
            L+I N+ +TD G Y C+ S       ++  L VL+ P +      S + + V     + + C  +  P   I+W+   K+G   RL+  K ++ +     T+ I        G Y+CI  N+  G+ +  + L +   P I+   D I +  G    I+AI+N           +P+  I W K+ + L   ++     G T
Sbjct: 2415 LRISNVMMTDSGRYVCVASNPAGERSRSFSLGVLISPTIKGAINGSPEDVKVVLLSSISLECEVHSHPPATITWH---KDG---RLFKFKDNVRILPGGRTLQILKAQEKDAGRYSCIATNEA-GEGTHHYNLNVHIPPKIR--KDDISEFGGFSKEIKAIVNTNFTLVCDVKANPLAKITWYKDGQPLEPDSHLAIVSGNT 2607          

HSP 15 Score: 51.9878 bits (123), Expect = 3.613e-6
Identity = 46/184 (25.00%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIIS--CNSYGIPSPNISWYANWKNGL--------NARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQS--QGRETMIQAIINGHPINSIQWEK 1190
            LKI+  ++ D G Y C          K   + ++VP  I  +    +  I+   E  +IS  C+S GIP P ++W  N ++ +        + RL +  + +        I    +    SYTC   N V G   K + ++++  PSI + GN   E    QG    ++    G P   + W K
Sbjct: 2064 LKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVPPAIRGSAEESEVNII---EGTLISLLCDSTGIPPPALAWKKNGQHNVAIQSGAAGHIRLLSGGRQL-------QIITARKSDAASYTCTASNSV-GSAMKKYTVKVYVRPSISESGNHPSEIVVIQGNNVTLECDARGDPQPMLTWLK 2236          

HSP 16 Score: 51.2174 bits (121), Expect = 7.887e-6
Identity = 44/184 (23.91%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVN--YNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN----------GHPINSIQWEKN 1193
            L+     + D G+Y C+ +       +T+ L V  P  I  +G      ++     +I+ C + G P P ++W+ +     N +L  N  DI V+     + I      H G+Y C+  + + G+   S+ L++   PSI           GR + I  I+N          G P  S+ W K+
Sbjct: 1788 LQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIENSGELIQETVLAN-HNIILECKATGNPDPVVTWFKD-----NQQL-TNTGDISVSDRGQVLQISGAQVFHAGTYKCVAAS-IAGRAELSYNLQVHVPPSI----------SGRSSSITVIVNNVVRLECEATGFPAPSLTWLKD 1953          
BLAST of hmctn vs. Ensembl Xenopus
Match: ENSXETT00000024069.1 (hemicentin 2 [Source:NCBI gene;Acc:100490941])

HSP 1 Score: 66.2402 bits (160), Expect = 1.707e-10
Identity = 55/221 (24.89%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  549 SPKTTIVWRR-KMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV-IEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            SP   + WR+  +    ++ +H LL                   L++  L++ D G Y CL S        T  L V VP  + P       L+ +  +   + C +YG P P +SWY   K+G   R+  ++  +     ++++  V    +G+Y C+  +   G+ S  F+LE+  E   + G+DV +EQ+     ++   + G P   I+W KN  +L
Sbjct:  953 SPLPVVSWRKDSLPLPIVSARHHLLPS---------------WSLRLSELRVMDSGYYSCLASNPAGNTSLTYSLEVQVPPRVHPGAKVLKALLGRTLQ---LPCLAYGDPMPRLSWY---KDGEPMRV-GDQDSLQGPDGSISVLEVQLSDSGNYRCVATSSA-GEDSLEFRLEVLGEVP-EYGSDVLLEQTAYEPVILTCPVQGTPTPLIRWMKNGVVL 1149          

HSP 2 Score: 60.077 bits (144), Expect = 1.276e-8
Identity = 51/190 (26.84%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI------KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            L+I + +I D G Y C+ +      +K   + +LVP  I   G   + L V E + V +SC   G P P I+W  + +   +G    +  +  ++ +   +  +FNV     G YTCI  N +  ++S+S+ + +   P+I      +   DVI       ++I   + G PI S+ W KN +    S N
Sbjct: 2153 LRITHAQIQDAGHYTCVVTNTAGQAKKDFFVDILVPPSI--DGEDDNDLRVPEGQSVTLSCKVSGHPKPLITWLRDSQPVQSGDEVLISPDGSELHIQ--SANVFNV-----GHYTCIAINSI-AERSRSYIVTVLVSPTISGPLDDEANEDVIVIVNNPFSLICEAL-GFPIPSVTWLKNGEPFKDSDN 2331          

HSP 3 Score: 56.225 bits (134), Expect = 2.109e-7
Identity = 41/178 (23.03%), Postives = 76/178 (42.70%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIG 1238
            D G Y C+ ++    D +   +R+ VP  ++ + T    L V    ++++ C     P P I WY     G      + +  +      V I ++    +G YTCI  N   G+ S  F +EI   P I+ G  V+  S  +  ++   + G P+    W K+   L++  ++  ++ 
Sbjct: 3279 DAGIYVCVATSTAGRDSRATWVRMKVPPSVVGS-TEPRSLAVSVGGQLVLECKVEADPPPTIQWY----RGDIPLQTDGRVQVLSKGRYVQIHSLRPSDSGEYTCIASNPA-GRTSLHFTVEIQLAPMIQPGPSVVSVSVNQTAVLPCRMEGIPLPVASWRKDGSPLSVEISRMEFLA 3450          

HSP 4 Score: 54.299 bits (129), Expect = 7.478e-7
Identity = 59/237 (24.89%), Postives = 96/237 (40.51%), Query Frame = 3
Query:  552 PKTTIVWR------RKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDI-FVNYNTVTIFNVSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGH--PINSIQWEKNSKILNLSANKCFY 1232
            P  T+ W       R M KQYL      LT+    SL     +     ++ D     D G Y C         ++T  L +LVP  I   G+ QD +  ++  +V + C + G+P P + W    K+G    L      I       V   N +R+ + G Y C+  N   G+Q K F L +   P+I   N+  E +      ++        P+  I W K+ + + +S+++  Y
Sbjct: 1229 PFPTVTWSKDGKAVRYMRKQYLD-----LTEAPGLSLLAAGQSVRFHRIRKD-----DTGSYTCKAVNRAGEAQRTFNLMILVPPSIYGAGSLQD-MTARDGSEVELHCKASGVPRPQVEWT---KDG--QPLPPGDAHIQLTEGGQVLQLNGTRLSDQGRYQCLAFNHA-GQQVKDFNLRVHTPPTIWASNETTEVASLLHGTVELRCEARASPVPGITWFKDKRPI-VSSSRATY 1447          

HSP 5 Score: 53.1434 bits (126), Expect = 1.953e-6
Identity = 43/184 (23.37%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            L + +++ +D G Y C+       D +   L +LVP +      + D L      +V + C++ G     +SW+   K+G    L  ++     +   +  F+  ++ + G+YTC+  +   G   K+F L I   P ++      E +  +G         +G P+ S+ WEK+ + LNL +N
Sbjct: 2994 LVLRSVQASDSGRYTCVARNNAGEDTRVYVLNILVPPIFESGSNASDVLSSVPGGQVTLECHASGSLPLKLSWF---KDG--HPLSTSRYVRIASGGRILRFSQVQVSDAGTYTCVASSPA-GAAEKNFVLHIESLPVLERSESTEEVTAIKGASVTFTCEAHGTPLPSLSWEKDGQPLNLQSN 3171          

HSP 6 Score: 52.373 bits (124), Expect = 3.449e-6
Identity = 43/182 (23.63%), Postives = 81/182 (44.51%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG---NDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L+I  ++ +  G Y C+         K   L V V   I  +    +H  V E+++V + C + G P+P I W+ +  N L+  +      +F + N + + +V    +G YTC+  N   G+ ++ + L I   P  + G   +DV+    G +  ++   +G     + W K+   L+ S
Sbjct: 2901 LQITRVQQSHAGRYRCIAQNSISETHKDFVLLVQVAPRIFGSEMPSEH-SVPEKQEVKLECKTEGTPAPQILWFKD-GNPLDISVLFR---VFQDGNFLVLRSVQASDSGRYTCVARNNA-GEDTRVYVLNILVPPIFESGSNASDVLSSVPGGQVTLECHASGSLPLKLSWFKDGHPLSTS 3076          

HSP 7 Score: 51.6026 bits (122), Expect = 5.989e-6
Identity = 42/177 (23.73%), Postives = 74/177 (41.81%), Query Frame = 3
Query:  711 GEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK----------DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKIL 1205
            G+Y C+ + E    R+  KL V     I   G  ++ + V   + + + C   G+P P ++W    K+G   R Y  K+           +     +V    + +   GSYTC   N+  G+  ++F L I   PSI     + + +   G E  +    +G P   ++W K+ + L
Sbjct: 1175 GDYICVATNEAGSARRKTKLVVYAKPKIFEDGQGKN-ISVMANQPLTLRCEVSGVPFPTVTWS---KDGKAVR-YMRKQYLDLTEAPGLSLLAAGQSVRFHRIRKDDTGSYTCKAVNRA-GEAQRTFNLMILVPPSIYGAGSLQDMTARDGSEVELHCKASGVPRPQVEWTKDGQPL 1345          

HSP 8 Score: 50.8322 bits (120), Expect = 9.392e-6
Identity = 44/177 (24.86%), Postives = 76/177 (42.94%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHN-GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV-IEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            +L I   + +  G Y C+            ++ V VP  +  T T   ++         I+C + GIP P I+W+ N     N  L   +     +   V     ++I + G YTC+V N   G+  K F ++I   PSI   +D  +   +G+   +   ++GHP   I W ++S+
Sbjct: 2058 QLTILKAQPSHSGRYVCVAVNAAGQTDIKYEVFVQVPPELPNTQTELLNVSTSLHGTFTITCEATGIPPPVITWFRN-----NEALSPRENVHLQSGGRVLRITHAQIQDAGHYTCVVTNTA-GQAKKDFFVDILVPPSIDGEDDNDLRVPEGQSVTLSCKVSGHPKPLITWLRDSQ 2228          
BLAST of hmctn vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 73.9442 bits (180), Expect = 5.783e-13
Identity = 58/211 (27.49%), Postives = 91/211 (43.13%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--QAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQL 1304
            LK+  +   D G Y C         +K   + VLVP  IL   +S   + V     V + C   G+P P I W+   K+G    L +   ++     ++ + N  R   G Y C V N   GKQ+K  KL ++  PSIK GN   E S    +++  +    G P+ +I W K+ +++  S+              Y+DK      Q+AQ+
Sbjct: 1415 LKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNVLVPPSIL-GASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWF---KDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQCTVSNAA-GKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPAITWYKDGQVVTSSSQ-----------ALYIDKGQLLHIQRAQV 1609          

HSP 2 Score: 69.3218 bits (168), Expect = 1.539e-11
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L++ + ++ D G Y CL S+    D K   +RV VP  I     +QD  +++ R+ V + C S  +P P I W  N +  L A     +  I      + I N       +YTC+  N + GK ++ F L +   PSI  G   +     +   ++    G P   I W K+  +L
Sbjct: 3583 LRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQ-VTLECKSDAVPPPVIMWLKN-REQLQA---TPRVRILSGGRYLQINNADLGDTANYTCVASN-IAGKTTREFNLTVNVPPSIGGGPQSLVTLLNKSIALECRAEGVPAPRITWRKDGVVL 3752          

HSP 3 Score: 65.855 bits (159), Expect = 1.713e-10
Identity = 58/223 (26.01%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  588 KQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT--------IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            + Y     Q+L +D+      +QS+     L+I N +ITD G Y C+        +K   L V VP  ++  G + +HL V     + ++C   G P P++SW              N++ I  N N +T        I        G YTCI  N+  G+  K   L +   PSIK        ++   +G    ++   N  P   I W KN +++  S N
Sbjct: 2902 RNYWQKDGQILLEDEHHK---FQSDG--RSLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVI--GPNHEHLSVVVNHFISLNCEVSGFPPPDLSW------------LKNEEPIKPNTNVLTVPGGRTLQIIRAKISDGGDYTCIAINQA-GESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTN 3104          

HSP 4 Score: 63.5438 bits (153), Expect = 8.335e-10
Identity = 50/177 (28.25%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKNSK 1199
            L I   +++D G+Y C        D K   L V VP  I   G   + ++      V ++C++ GIP P I+W  N K   N+     +  I    + + I    R ++G+YTC+  N +EGK  K+F L I   PS+  G +V  +     G    +    +G P   +QW ++ K
Sbjct: 3114 LHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPTI--EGPETEVIVETISNPVTLTCDATGIPPPTITWLKNHKPIENSDPL--EVHILSGGSKLQIARPQRSNSGNYTCVASN-MEGKAQKNFILFIQVPPSVA-GAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGK 3284          

HSP 5 Score: 62.003 bits (149), Expect = 2.789e-9
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I+N  + D   Y C+ S       +   L V VP  I   G     L+    + + + C + G+P+P I+W    K+G+     + +  I  N   + I +      G Y C+  N V G   +   L++   PSI MG   +  +   +T +     G P  S+ W KN  +LN+  N+  Y
Sbjct: 3676 LQINNADLGDTANYTCVASNIAGKTTREFNLTVNVPPSI---GGGPQSLVTLLNKSIALECRAEGVPAPRITWR---KDGVVLAESHARYSILEN-GFLHIESAHVTDTGRYLCMATN-VAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSY 3852          

HSP 6 Score: 61.2326 bits (147), Expect = 4.971e-9
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L++ N+ ++D G Y C+      +  K   L V  P  I+      +++ V E+  V ++C + GIP P+I+W    K+G    L ++ K I      + +        G YTCIV N   G+  K F L +   P I +G + +E  + +E     +   + G+P+  I W K+ ++L
Sbjct: 2347 LQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWL---KDGWPVNLGSSVK-ILSGGRMLRLMQTRPEDAGQYTCIVRNAA-GEDRKMFGLSVLVPPHI-VGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLL 2519          

HSP 7 Score: 58.9214 bits (141), Expect = 2.073e-8
Identity = 49/192 (25.52%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN------GHPINSIQWEKNSKILNLSAN 1220
            +L+I   + ++ G Y C+ S  +   +K   L + VP  +    +P+  S     V   E V + CN+ GIP+P++ W  + K  +N      +  +  + +T+ I+       G YTC+  N   G++ + F L ++  P I+ GN   E+++    ++   IN      G P   I W KN   L +S++
Sbjct: 3207 KLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQVPPSVAGAEVPSEVS-----VLLGENVELVCNADGIPTPHLQWLRDGKPIVNGE--TERVRVTTDGSTLNIYRALTSDMGKYTCVATNPA-GEEDRIFNLNVYVPPKIR-GNK--EEAEKLMALVDTSINIECKATGTPPPQINWLKNGLPLPISSH 3387          

HSP 8 Score: 58.9214 bits (141), Expect = 2.181e-8
Identity = 53/216 (24.54%), Postives = 89/216 (41.20%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK ++ WR+            LL  D+       Q++Y L+    L I +  + D   YEC  +++   D++ V L V VP  I       D L+ ++   V+ +C++ G+P P+I W    KNGL      +   I ++   + I      H G YTC+  N   G   +   L +   P I+     ++       ++     G P   I W+K
Sbjct: 3830 PKPSVTWRK---------NGHLLNVDQN------QNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTI--ADEPMDFLVTRQAPAVM-TCSASGVPVPSIHWT---KNGLRLLPRGDGYRI-LSSGAIEIPTTQLNHAGRYTCVARNAA-GSAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITWQK 4022          

HSP 9 Score: 58.9214 bits (141), Expect = 2.219e-8
Identity = 42/170 (24.71%), Postives = 74/170 (43.53%), Query Frame = 3
Query:  702 TDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK--MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            +D G+Y C+ +     + +   L V VP  I       + L+      + I C + G P P I+W    KNGL   + ++ + +      V I          YTC+  N+  G  SK + L+++  P++   MG + I   +G  T +    +G P  S+ W ++ + L
Sbjct: 3311 SDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKEEAEKLMALVDTSINIECKATGTPPPQINWL---KNGLPLPISSHIR-LLSAGQVVRIVRAQVSDIAVYTCVASNRA-GVDSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPL 3475          

HSP 10 Score: 56.225 bits (134), Expect = 1.513e-7
Identity = 51/205 (24.88%), Postives = 89/205 (43.41%), Query Frame = 3
Query:  501 KSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQ--HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI--LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN 1103
            K K K+    T ++  +P   I W +  D Q L     H +++   RF             L+I N +++  G Y CL S       K+ +L V V   I  + +  S + +IV       + C +Y  P   I+W+   K+G       N + I     T+ I N    + G Y+C+  N+  G++ K ++++++  P IK G+
Sbjct: 2489 KIKEKQSVTLTCEVRGNPVPQITWHK--DGQLLQEDEAHHMMSGG-RF-------------LQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFVSPTIAGVDSDGSPEDVIVILNSPTSLVCEAYSYPPATITWF---KDGTPLESNRNIR-ILPGGRTLQILNAQEDNAGRYSCVATNEA-GEKIKHYEVKVYIPPIIKKGD 2672          

HSP 11 Score: 55.8398 bits (133), Expect = 1.920e-7
Identity = 62/237 (26.16%), Postives = 103/237 (43.46%), Query Frame = 3
Query:  537 QLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD--HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
            Q++ SP  TI+W +           QL+  D+R   KI  +     +L I   +++D G Y+C+ +      RK  ++ V VP    PT  S D     V   + V + C + GIP+P+I+W    K+       +    I  +   + I        G YTC+  N   G+  +  +L +   PS+    KM N+ +  +   +   +A   G P+  I W K+S  L+ SA+  F
Sbjct: 1756 QVSGSPPPTIMWLKG---------GQLI--DERDGFKILLNG---RKLVIAQAQVSDTGLYQCVATNIAGDHRKEFEVTVHVP----PTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWL---KDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAA-GEAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKA--TGKPLPVITWYKDSHPLSGSASAAF 1968          

HSP 12 Score: 55.4546 bits (132), Expect = 2.861e-7
Identity = 49/184 (26.63%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTS-QDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL ++N+ + D G Y C+ +     D + V L V      LPT T     L + + E++ +SC + GIP P ++W  N  N + A       D    ++ + I  VS+  +G+Y C  +N V   ++  F      EP +  G+   + IE   G   ++   + G P  +IQW +    + +S
Sbjct: 4222 ELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHT----LPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFN-NNIIPAHF-----DSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYV--KEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPAPTIQWSRKGADIEIS 4392          

HSP 13 Score: 54.6842 bits (130), Expect = 4.301e-7
Identity = 54/223 (24.22%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQD---HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYN--NKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            PK +I W +K +         + T   +FS     S YV+      +    + GEY C  +      ++ V+L V V   +     G SQD    + V   E+ I+ C +  +P P I+W        +++L +  + +  F+   ++ I       +G Y C+  N + G  ++S KL +   P I+ GN  I+   G+   I    +G P   I W K+ +
Sbjct: 1008 PKPSITWSKKGE--------LISTSSAKFSAGADGSLYVV------SPGSEESGEYICTATNAAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITW------AKDSQLISPFSPRHTFLPSGSMKITETRVSDSGMYLCVATN-IAGNVTQSVKLSVHVPPKIQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGR 1209          

HSP 14 Score: 54.6842 bits (130), Expect = 5.097e-7
Identity = 49/218 (22.48%), Postives = 86/218 (39.45%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT----IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK  IVW   M++ ++   H       R+ +    +      L I N    D G Y CL S     D++T  LR +  P +++     Q  L+V   +  ++ C + GIP P + W+   K  L  R        F++ + +     I     +  G YTC+  N+  G+ +    L++   P        +    G    +   + G+P   I+W +
Sbjct:  639 PKPKIVW--TMNEMFIMGSH-------RYRMTSEGT------LFIKNAVPKDAGTYACLASNAAGTDKQTSTLRYIEAPKLVV----EQSELLVALGDTTVMECKTSGIPPPQVKWF---KGDLELR-----PSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEA-GRATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRR 828          

HSP 15 Score: 53.9138 bits (128), Expect = 7.406e-7
Identity = 56/226 (24.78%), Postives = 90/226 (39.82%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            P+  I WRR  +    +         + FS+  + S      L I NL  +D G Y C    E    +   +  V V  ++ P  G S     V E + + + C    G P P   W  N     +A L  N      +  ++ I  V     G YTC+  N V G  +K+  + +   PSI+ G  ++   +G    +    +G P  SI W K  ++++ S+ K
Sbjct:  820 PEPKIKWRRLDNMPVFS---------RPFSVS-FISQLRTGALFISNLWASDKGTYIC--EAENQFGKIQSQTTVTVTGLVAPLIGISPSMASVIEGQPLTLPCTLLAGNPIPERRWMKN-----SAMLVQNPYITVRSDGSLHIERVRLQDGGKYTCVASN-VAGTNNKTTSVAVHVLPSIQHGQQILSTIEGVPVTLPCRASGIPKPSITWSKKGELISTSSAK 1027          

HSP 16 Score: 53.9138 bits (128), Expect = 9.003e-7
Identity = 46/196 (23.47%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI-----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGN--DVIEQSQGRETMIQAIINGH------PINSIQWEKNSKILNLS 1214
            L+I N +  + G Y C+ + E     K  +++V +P +I     L  G S   + ++    + + C +Y IPS ++ WY   K+G   +  ++   I  + +T+ I        G YTC+  N + G+    F + I   PS +    +GN  D     + ++ +I   ++ H      P  ++ W K+ + L  S
Sbjct: 2630 LQILNAQEDNAGRYSCVATNEAGEKIKHYEVKVYIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAIPSASLRWY---KDGQPLK-SDDHVTIAASGHTLQIKEAQISDTGRYTCVASN-LAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCETNAAPPPTLTWYKDGRPLTSS 2820          

HSP 17 Score: 53.1434 bits (126), Expect = 1.412e-6
Identity = 50/186 (26.88%), Postives = 76/186 (40.86%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYAN---WKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            L I ++   ++GEY C+   E     +   L+V VP VI      ++H+    V   +   + C   G PSP I+WY +          ++ NN K        + +F VS    G Y+C   N + G   K F + +   PSI   +   E S        +Q    G P  +I W K+ K L L
Sbjct: 1322 LVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVI----RDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGK-------ILKLFKVSAEDAGRYSCKAIN-IAGTSQKDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFL 1495          

HSP 18 Score: 53.1434 bits (126), Expect = 1.424e-6
Identity = 47/187 (25.13%), Postives = 80/187 (42.78%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK--DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII----NGHPINSIQWEKNSKILNLSAN 1220
            L+I   +  D G Y C+ S    + +K   L+V +   I  +G  +  + V   + + + C   GIP P ++W    K+G   R     K  +I      + + NV     G Y C+  N V G   K + L +   PSI +GN  + ++          +    +G P+ SI W K+   +NL ++
Sbjct: 2253 LQISIAEKADAGLYTCVASNVAGVAKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWM---KDG---RPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVN-VAGMTDKRYDLSVHAPPSI-IGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSS 2431          

HSP 19 Score: 52.373 bits (124), Expect = 2.310e-6
Identity = 45/176 (25.57%), Postives = 75/176 (42.61%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I      D G Y C+           VKL V VP VI    + Q   +V   + V + C + G P P+I+W+   K+G    L  + +   +N   + I        G YTC+  N + G  S S  L +   P I+        ++  + ++  + +G P  +I WEK+  ++
Sbjct: 4042 LQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPVI---SSHQKEYVVTMDKPVSLLCETEGSPPPDITWH---KDG--HALTESIRQRILNSGALQIAFAQPDDAGQYTCMAAN-MAGSSSVSSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLI 4208          

HSP 20 Score: 52.373 bits (124), Expect = 2.601e-6
Identity = 43/178 (24.16%), Postives = 80/178 (44.94%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEKNSKIL 1205
            L + + +++D G Y C+        ++ + LRV  P  I+  G  Q+ + V   + V + C S  +P P + W    K+G    L      I  N + + I +      G YTC   N V GK  K++ + +W  PSI   +++++ +     +I  +   +G P   + W+K   ++
Sbjct: 2067 LALTSAQMSDAGRYTCVAVNAAGEKQRDIDLRVYAPPNIM--GEEQN-VSVLIGQAVELFCQSDAVPPPTLMWL---KDG-RPLLKRPGLSISENGSVLKIEDAQAGDTGRYTCEATN-VAGKTEKNYNVNVWVPPSIYGSDELVQLTAIEGNLITLLCESSGIPPPDLTWKKKGSLV 2236          

HSP 21 Score: 51.9878 bits (123), Expect = 2.784e-6
Identity = 43/179 (24.02%), Postives = 74/179 (41.34%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            +KI   +++D G Y C+ +       ++VKL V VP  I        H+ V+  ++V I CN++G P P I+W+ + +  L+   +    D      T++I        G YTC   N + G       L +   PS++           E+   +         G P  +I+W  N +
Sbjct: 1135 MKITETRVSDSGMYLCVATNIAGNVTQSVKLSVHVPPKI---QHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGRPFLDGAQHPGSPD-----GTLSIEQAVISDAGVYTCAATN-IAGSDEAEVTLHVQEPPSVEDLQPPFNTPFQERLANQRIEFPCPAKGTPKPTIKWLHNGR 1304          

HSP 22 Score: 51.6026 bits (122), Expect = 4.593e-6
Identity = 45/177 (25.42%), Postives = 78/177 (44.07%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG-LNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   +  D G+Y C+ +        +  L V VP  I  T   + H  V E  + ++ C + GIP+P I W    K+G L A L    K     Y  + + NV    +G+YTC+ +N   G+ ++   L +   P+       +  ++G +  +     G P+  + W  N+ I+
Sbjct: 4132 LQIAFAQPDDAGQYTCMAANMAGSSSVSSTLTVHVPPRIQST---EVHFTVNENSQAVLPCVADGIPTPAIHWE---KDGVLIANLLG--KYTAQPYGELILENVVLEDSGTYTCVANNAA-GEDTRIVTLAVHTLPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFNNNII 4299          
BLAST of hmctn vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 73.9442 bits (180), Expect = 5.790e-13
Identity = 58/211 (27.49%), Postives = 91/211 (43.13%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--QAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQL 1304
            LK+  +   D G Y C         +K   + VLVP  IL   +S   + V     V + C   G+P P I W+   K+G    L +   ++     ++ + N  R   G Y C V N   GKQ+K  KL ++  PSIK GN   E S    +++  +    G P+ +I W K+ +++  S+              Y+DK      Q+AQ+
Sbjct: 1415 LKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNVLVPPSIL-GASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWF---KDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQCTVSNAA-GKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPAITWYKDGQVVTSSSQ-----------ALYIDKGQLLHIQRAQV 1609          

HSP 2 Score: 69.3218 bits (168), Expect = 1.541e-11
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L++ + ++ D G Y CL S+    D K   +RV VP  I     +QD  +++ R+ V + C S  +P P I W  N +  L A     +  I      + I N       +YTC+  N + GK ++ F L +   PSI  G   +     +   ++    G P   I W K+  +L
Sbjct: 3583 LRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQ-VTLECKSDAVPPPVIMWLKN-REQLQA---TPRVRILSGGRYLQINNADLGDTANYTCVASN-IAGKTTREFNLTVNVPPSIGGGPQSLVTLLNKSIALECRAEGVPAPRITWRKDGVVL 3752          

HSP 3 Score: 65.855 bits (159), Expect = 1.714e-10
Identity = 58/223 (26.01%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  588 KQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT--------IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            + Y     Q+L +D+      +QS+     L+I N +ITD G Y C+        +K   L V VP  ++  G + +HL V     + ++C   G P P++SW              N++ I  N N +T        I        G YTCI  N+  G+  K   L +   PSIK        ++   +G    ++   N  P   I W KN +++  S N
Sbjct: 2902 RNYWQKDGQILLEDEHHK---FQSDG--RSLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVI--GPNHEHLSVVVNHFISLNCEVSGFPPPDLSW------------LKNEEPIKPNTNVLTVPGGRTLQIIRAKISDGGDYTCIAINQA-GESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTN 3104          

HSP 4 Score: 63.5438 bits (153), Expect = 8.343e-10
Identity = 50/177 (28.25%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKNSK 1199
            L I   +++D G+Y C        D K   L V VP  I   G   + ++      V ++C++ GIP P I+W  N K   N+     +  I    + + I    R ++G+YTC+  N +EGK  K+F L I   PS+  G +V  +     G    +    +G P   +QW ++ K
Sbjct: 3114 LHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPTI--EGPETEVIVETISNPVTLTCDATGIPPPTITWLKNHKPIENSDPL--EVHILSGGSKLQIARPQRSNSGNYTCVASN-MEGKAQKNFILFIQVPPSVA-GAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGK 3284          

HSP 5 Score: 62.003 bits (149), Expect = 2.721e-9
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I+N  + D   Y C+ S       +   L V VP  I   G     L+    + + + C + G+P+P I+W    K+G+     + +  I  N   + I +      G Y C+  N V G   +   L++   PSI MG   +  +   +T +     G P  S+ W KN  +LN+  N+  Y
Sbjct: 3676 LQINNADLGDTANYTCVASNIAGKTTREFNLTVNVPPSI---GGGPQSLVTLLNKSIALECRAEGVPAPRITWR---KDGVVLAESHARYSILEN-GFLHIESAHVTDTGRYLCMATN-VAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSY 3852          

HSP 6 Score: 61.2326 bits (147), Expect = 4.934e-9
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L++ N+ ++D G Y C+      +  K   L V  P  I+      +++ V E+  V ++C + GIP P+I+W    K+G    L ++ K I      + +        G YTCIV N   G+  K F L +   P I +G + +E  + +E     +   + G+P+  I W K+ ++L
Sbjct: 2347 LQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWL---KDGWPVNLGSSVK-ILSGGRMLRLMQTRPEDAGQYTCIVRNAA-GEDRKMFGLSVLVPPHI-VGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLL 2519          

HSP 7 Score: 58.9214 bits (141), Expect = 2.075e-8
Identity = 49/192 (25.52%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN------GHPINSIQWEKNSKILNLSAN 1220
            +L+I   + ++ G Y C+ S  +   +K   L + VP  +    +P+  S     V   E V + CN+ GIP+P++ W  + K  +N      +  +  + +T+ I+       G YTC+  N   G++ + F L ++  P I+ GN   E+++    ++   IN      G P   I W KN   L +S++
Sbjct: 3207 KLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQVPPSVAGAEVPSEVS-----VLLGENVELVCNADGIPTPHLQWLRDGKPIVNGE--TERVRVTTDGSTLNIYRALTSDMGKYTCVATNPA-GEEDRIFNLNVYVPPKIR-GNK--EEAEKLMALVDTSINIECKATGTPPPQINWLKNGLPLPISSH 3387          

HSP 8 Score: 58.9214 bits (141), Expect = 2.183e-8
Identity = 53/216 (24.54%), Postives = 89/216 (41.20%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK ++ WR+            LL  D+       Q++Y L+    L I +  + D   YEC  +++   D++ V L V VP  I       D L+ ++   V+ +C++ G+P P+I W    KNGL      +   I ++   + I      H G YTC+  N   G   +   L +   P I+     ++       ++     G P   I W+K
Sbjct: 3830 PKPSVTWRK---------NGHLLNVDQN------QNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTI--ADEPMDFLVTRQAPAVM-TCSASGVPVPSIHWT---KNGLRLLPRGDGYRI-LSSGAIEIPTTQLNHAGRYTCVARNAA-GSAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITWQK 4022          

HSP 9 Score: 58.9214 bits (141), Expect = 2.221e-8
Identity = 42/170 (24.71%), Postives = 74/170 (43.53%), Query Frame = 3
Query:  702 TDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK--MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            +D G+Y C+ +     + +   L V VP  I       + L+      + I C + G P P I+W    KNGL   + ++ + +      V I          YTC+  N+  G  SK + L+++  P++   MG + I   +G  T +    +G P  S+ W ++ + L
Sbjct: 3311 SDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKEEAEKLMALVDTSINIECKATGTPPPQINWL---KNGLPLPISSHIR-LLSAGQVVRIVRAQVSDIAVYTCVASNRA-GVDSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPL 3475          

HSP 10 Score: 56.225 bits (134), Expect = 1.515e-7
Identity = 51/205 (24.88%), Postives = 89/205 (43.41%), Query Frame = 3
Query:  501 KSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQ--HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI--LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN 1103
            K K K+    T ++  +P   I W +  D Q L     H +++   RF             L+I N +++  G Y CL S       K+ +L V V   I  + +  S + +IV       + C +Y  P   I+W+   K+G       N + I     T+ I N    + G Y+C+  N+  G++ K ++++++  P IK G+
Sbjct: 2489 KIKEKQSVTLTCEVRGNPVPQITWHK--DGQLLQEDEAHHMMSGG-RF-------------LQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFVSPTIAGVDSDGSPEDVIVILNSPTSLVCEAYSYPPATITWF---KDGTPLESNRNIR-ILPGGRTLQILNAQEDNAGRYSCVATNEA-GEKIKHYEVKVYIPPIIKKGD 2672          

HSP 11 Score: 55.8398 bits (133), Expect = 1.921e-7
Identity = 62/237 (26.16%), Postives = 103/237 (43.46%), Query Frame = 3
Query:  537 QLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD--HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
            Q++ SP  TI+W +           QL+  D+R   KI  +     +L I   +++D G Y+C+ +      RK  ++ V VP    PT  S D     V   + V + C + GIP+P+I+W    K+       +    I  +   + I        G YTC+  N   G+  +  +L +   PS+    KM N+ +  +   +   +A   G P+  I W K+S  L+ SA+  F
Sbjct: 1756 QVSGSPPPTIMWLKG---------GQLI--DERDGFKILLNG---RKLVIAQAQVSDTGLYQCVATNIAGDHRKEFEVTVHVP----PTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWL---KDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAA-GEAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKA--TGKPLPVITWYKDSHPLSGSASAAF 1968          

HSP 12 Score: 55.4546 bits (132), Expect = 2.864e-7
Identity = 49/184 (26.63%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTS-QDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL ++N+ + D G Y C+ +     D + V L V      LPT T     L + + E++ +SC + GIP P ++W  N  N + A       D    ++ + I  VS+  +G+Y C  +N V   ++  F      EP +  G+   + IE   G   ++   + G P  +IQW +    + +S
Sbjct: 4222 ELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHT----LPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFN-NNIIPAHF-----DSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYV--KEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPAPTIQWSRKGADIEIS 4392          

HSP 13 Score: 54.6842 bits (130), Expect = 4.305e-7
Identity = 54/223 (24.22%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQD---HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYN--NKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            PK +I W +K +         + T   +FS     S YV+      +    + GEY C  +      ++ V+L V V   +     G SQD    + V   E+ I+ C +  +P P I+W        +++L +  + +  F+   ++ I       +G Y C+  N + G  ++S KL +   P I+ GN  I+   G+   I    +G P   I W K+ +
Sbjct: 1008 PKPSITWSKKGE--------LISTSSAKFSAGADGSLYVV------SPGSEESGEYICTATNAAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITW------AKDSQLISPFSPRHTFLPSGSMKITETRVSDSGMYLCVATN-IAGNVTQSVKLSVHVPPKIQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGR 1209          

HSP 14 Score: 54.6842 bits (130), Expect = 5.101e-7
Identity = 49/218 (22.48%), Postives = 86/218 (39.45%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT----IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK  IVW   M++ ++   H       R+ +    +      L I N    D G Y CL S     D++T  LR +  P +++     Q  L+V   +  ++ C + GIP P + W+   K  L  R        F++ + +     I     +  G YTC+  N+  G+ +    L++   P        +    G    +   + G+P   I+W +
Sbjct:  639 PKPKIVW--TMNEMFIMGSH-------RYRMTSEGT------LFIKNAVPKDAGTYACLASNAAGTDKQTSTLRYIEAPKLVV----EQSELLVALGDTTVMECKTSGIPPPQVKWF---KGDLELR-----PSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEA-GRATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRR 828          

HSP 15 Score: 53.9138 bits (128), Expect = 7.412e-7
Identity = 56/226 (24.78%), Postives = 90/226 (39.82%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            P+  I WRR  +    +         + FS+  + S      L I NL  +D G Y C    E    +   +  V V  ++ P  G S     V E + + + C    G P P   W  N     +A L  N      +  ++ I  V     G YTC+  N V G  +K+  + +   PSI+ G  ++   +G    +    +G P  SI W K  ++++ S+ K
Sbjct:  820 PEPKIKWRRLDNMPVFS---------RPFSVS-FISQLRTGALFISNLWASDKGTYIC--EAENQFGKIQSQTTVTVTGLVAPLIGISPSMASVIEGQPLTLPCTLLAGNPIPERRWMKN-----SAMLVQNPYITVRSDGSLHIERVRLQDGGKYTCVASN-VAGTNNKTTSVAVHVLPSIQHGQQILSTIEGVPVTLPCRASGIPKPSITWSKKGELISTSSAK 1027          

HSP 16 Score: 53.9138 bits (128), Expect = 9.010e-7
Identity = 46/196 (23.47%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI-----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGN--DVIEQSQGRETMIQAIINGH------PINSIQWEKNSKILNLS 1214
            L+I N +  + G Y C+ + E     K  +++V +P +I     L  G S   + ++    + + C +Y IPS ++ WY   K+G   +  ++   I  + +T+ I        G YTC+  N + G+    F + I   PS +    +GN  D     + ++ +I   ++ H      P  ++ W K+ + L  S
Sbjct: 2630 LQILNAQEDNAGRYSCVATNEAGEKIKHYEVKVYIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAIPSASLRWY---KDGQPLK-SDDHVTIAASGHTLQIKEAQISDTGRYTCVASN-LAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCETNAAPPPTLTWYKDGRPLTSS 2820          

HSP 17 Score: 53.1434 bits (126), Expect = 1.389e-6
Identity = 47/187 (25.13%), Postives = 80/187 (42.78%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK--DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII----NGHPINSIQWEKNSKILNLSAN 1220
            L+I   +  D G Y C+ S    + +K   L+V +   I  +G  +  + V   + + + C   GIP P ++W    K+G   R     K  +I      + + NV     G Y C+  N V G   K + L +   PSI +GN  + ++          +    +G P+ SI W K+   +NL ++
Sbjct: 2253 LQISIAEKADAGLYTCVASNVAGVAKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWM---KDG---RPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVN-VAGMTDKRYDLSVHAPPSI-IGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSS 2431          

HSP 18 Score: 53.1434 bits (126), Expect = 1.413e-6
Identity = 50/186 (26.88%), Postives = 76/186 (40.86%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYAN---WKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            L I ++   ++GEY C+   E     +   L+V VP VI      ++H+    V   +   + C   G PSP I+WY +          ++ NN K        + +F VS    G Y+C   N + G   K F + +   PSI   +   E S        +Q    G P  +I W K+ K L L
Sbjct: 1322 LVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVI----RDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGK-------ILKLFKVSAEDAGRYSCKAIN-IAGTSQKDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFL 1495          

HSP 19 Score: 52.373 bits (124), Expect = 2.292e-6
Identity = 45/176 (25.57%), Postives = 75/176 (42.61%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I      D G Y C+           VKL V VP VI    + Q   +V   + V + C + G P P+I+W+   K+G    L  + +   +N   + I        G YTC+  N + G  S S  L +   P I+        ++  + ++  + +G P  +I WEK+  ++
Sbjct: 4042 LQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPVI---SSHQKEYVVTMDKPVSLLCETEGSPPPDITWH---KDG--HALTESIRQRILNSGALQIAFAQPDDAGQYTCMAAN-MAGSSSVSSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLI 4208          

HSP 20 Score: 52.373 bits (124), Expect = 2.603e-6
Identity = 43/178 (24.16%), Postives = 80/178 (44.94%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII--NGHPINSIQWEKNSKIL 1205
            L + + +++D G Y C+        ++ + LRV  P  I+  G  Q+ + V   + V + C S  +P P + W    K+G    L      I  N + + I +      G YTC   N V GK  K++ + +W  PSI   +++++ +     +I  +   +G P   + W+K   ++
Sbjct: 2067 LALTSAQMSDAGRYTCVAVNAAGEKQRDIDLRVYAPPNIM--GEEQN-VSVLIGQAVELFCQSDAVPPPTLMWL---KDG-RPLLKRPGLSISENGSVLKIEDAQAGDTGRYTCEATN-VAGKTEKNYNVNVWVPPSIYGSDELVQLTAIEGNLITLLCESSGIPPPDLTWKKKGSLV 2236          

HSP 21 Score: 51.9878 bits (123), Expect = 2.786e-6
Identity = 43/179 (24.02%), Postives = 74/179 (41.34%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK-----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            +KI   +++D G Y C+ +       ++VKL V VP  I        H+ V+  ++V I CN++G P P I+W+ + +  L+   +    D      T++I        G YTC   N + G       L +   PS++           E+   +         G P  +I+W  N +
Sbjct: 1135 MKITETRVSDSGMYLCVATNIAGNVTQSVKLSVHVPPKI---QHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGRPFLDGAQHPGSPD-----GTLSIEQAVISDAGVYTCAATN-IAGSDEAEVTLHVQEPPSVEDLQPPFNTPFQERLANQRIEFPCPAKGTPKPTIKWLHNGR 1304          

HSP 22 Score: 51.6026 bits (122), Expect = 4.558e-6
Identity = 45/177 (25.42%), Postives = 78/177 (44.07%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG-LNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   +  D G+Y C+ +        +  L V VP  I  T   + H  V E  + ++ C + GIP+P I W    K+G L A L    K     Y  + + NV    +G+YTC+ +N   G+ ++   L +   P+       +  ++G +  +     G P+  + W  N+ I+
Sbjct: 4132 LQIAFAQPDDAGQYTCMAANMAGSSSVSSTLTVHVPPRIQST---EVHFTVNENSQAVLPCVADGIPTPAIHWE---KDGVLIANLLG--KYTAQPYGELILENVVLEDSGTYTCVANNAA-GEDTRIVTLAVHTLPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFNNNII 4299          
BLAST of hmctn vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 65.855 bits (159), Expect = 9.906e-11
Identity = 63/239 (26.36%), Postives = 111/239 (46.44%), Query Frame = 3
Query:  507 KPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC----LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT-VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            K  +D+     +  S   TI+W+ K        +  +L KD RF   +  +NY    L+I  +K TD+G Y C    L   E  I+ K +++ V VP    PT  ++  ++       + V + C++ G P P +SW  + +   N    +++K IF + ++ +TI NV +     Y CI +NK  G+Q  S  L+++ +P I    +        +  +    +G PI SI W  +++
Sbjct:  130 KEGEDAVIVCDVVSSLPPTIIWKHKG-------RDVILKKDVRF--IVLSNNY----LQIRGIKKTDEGTYRCEGRILARGE--INFKDIQVIVNVP----PTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEE-EDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKA-GEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTR 347          

HSP 2 Score: 55.4546 bits (132), Expect = 1.964e-7
Identity = 40/180 (22.22%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            EL I N+   D+ EY C+   +      ++ L+V     I      ++   ++  E+V ++C + G P P+I+W  + +N  +     +   +  ++  V+   +  I     G Y C   N + G+ S+S  LE+ Y P ++ G   +   +G +  I   +  +P  +I W ++ ++L
Sbjct:  272 ELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKIT---YVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTI-GQDSQSMYLEVQYAPKLQ-GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLL 446          
BLAST of hmctn vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 65.855 bits (159), Expect = 1.163e-10
Identity = 85/328 (25.91%), Postives = 149/328 (45.43%), Query Frame = 3
Query:  258 SKNSKRLNSI-NEDNLDT----NSNINDFDISNMEKLKMRLKYEILSKVKKMNIKVKI-QKVKMKFPKSATNAESDCEYVQILNQIAKSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC----LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT-VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            S N +R++ + N+D+  T    N+NI+D  I      K  +  E  ++  +  + VKI QK+  K      NA +  E+          K  +D+     +  S   TI+W+ K        +  +L KD RF   +  +NY    L+I  +K TD+G Y C    L   E  I+ K +++ V VP    PT  ++  ++       + V + C++ G P P +SW  + +   N    +++K IF + ++ +TI NV +     Y CI +NK  G+Q  S  L+++ +P I    +        +  +    +G PI SI W  +++
Sbjct:   63 SPNQQRISVVWNDDDSSTLTIYNANIDDAGI-----YKCVVTAEDGTQ-SEATVNVKIFQKLMFK------NAPTPQEF----------KEGEDAVIVCDVVSSLPPTIIWKHKG-------RDVILKKDVRF--IVLSNNY----LQIRGIKKTDEGTYRCEGRILARGE--INFKDIQVIVNVP----PTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEE-EDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKA-GEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTR 347          

HSP 2 Score: 55.4546 bits (132), Expect = 2.015e-7
Identity = 40/180 (22.22%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            EL I N+   D+ EY C+   +      ++ L+V     I      ++   ++  E+V ++C + G P P+I+W  + +N  +     +   +  ++  V+   +  I     G Y C   N + G+ S+S  LE+ Y P ++ G   +   +G +  I   +  +P  +I W ++ ++L
Sbjct:  272 ELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKIT---YVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTI-GQDSQSMYLEVQYAPKLQ-GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLL 446          
BLAST of hmctn vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 65.855 bits (159), Expect = 1.348e-10
Identity = 85/328 (25.91%), Postives = 149/328 (45.43%), Query Frame = 3
Query:  258 SKNSKRLNSI-NEDNLDT----NSNINDFDISNMEKLKMRLKYEILSKVKKMNIKVKI-QKVKMKFPKSATNAESDCEYVQILNQIAKSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC----LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNT-VTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            S N +R++ + N+D+  T    N+NI+D  I      K  +  E  ++  +  + VKI QK+  K      NA +  E+          K  +D+     +  S   TI+W+ K        +  +L KD RF   +  +NY    L+I  +K TD+G Y C    L   E  I+ K +++ V VP    PT  ++  ++       + V + C++ G P P +SW  + +   N    +++K IF + ++ +TI NV +     Y CI +NK  G+Q  S  L+++ +P I    +        +  +    +G PI SI W  +++
Sbjct:   63 SPNQQRISVVWNDDDSSTLTIYNANIDDAGI-----YKCVVTAEDGTQ-SEATVNVKIFQKLMFK------NAPTPQEF----------KEGEDAVIVCDVVSSLPPTIIWKHKG-------RDVILKKDVRFI--VLSNNY----LQIRGIKKTDEGTYRCEGRILARGE--INFKDIQVIVNVP----PTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEE-EDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKA-GEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTR 347          

HSP 2 Score: 55.0694 bits (131), Expect = 2.694e-7
Identity = 41/183 (22.40%), Postives = 83/183 (45.36%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL I N+   D+ EY C+   +      ++ L+V     I      ++   ++  E+V ++C + G P P+I+W  + +N  +     +   +  ++  V+   +  I     G Y C   N + G+ S+S  LE+ Y P ++ G   +   +G +  I   +  +P  +I W ++ ++L  S
Sbjct:  272 ELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKIT---YVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTI-GQDSQSMYLEVQYAPKLQ-GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSS 449          
BLAST of hmctn vs. UniProt/SwissProt
Match: sp|Q24372|LACH_DROME (Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 1.703e-14
Identity = 65/232 (28.02%), Postives = 111/232 (47.84%), Query Frame = 3
Query:  585 DKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC--LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKT 1274
            D  +L+    L+ KD RFSL+ Y  N    +L+I +++ TD G Y C  + ST   +  + VKL V  P VI  +  S   ++  E  +V + C + G P+P I+W    +   NA L  +    +V  NT+ I +V +   G+Y C+ DN V     ++  +E+ + P I +    + Q+   +  ++  I  +P  +I W K+   + L+ N+ + I        Y D T
Sbjct:   68 DPVFLSTGSTLVIKDSRFSLR-YDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE-VKLSVRRPPVI--SDNSTQSVVASEGSEVQMECYASGYPTPTITW----RRENNAILPTDSA-TYVG-NTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDD--IQLANNQHYSISHFATADEYTDST 287          
BLAST of hmctn vs. UniProt/SwissProt
Match: sp|P15364|AMAL_DROME (Protein amalgam OS=Drosophila melanogaster OX=7227 GN=Ama PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 8.373e-13
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = 3
Query:  597 LTFQHQLLTKDKRFSLKIYQ---SNYVLMELKIDNLKITDDGEYEC---LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSF-KLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L+ ++ L   D+R+++ + +   +   +   +I N++++D G YEC   + +TEK    K + L++  P VI     +    +V E + + ++C++ G P P ISW       + A  +       +   T+ I +V R+  G Y CI  N  EG+  K   ++E+ + P I +    I Q       ++  + G+P  ++ W KN   L  S
Sbjct:   72 LSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVT--KKLSLQIKTPPVI--AENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGH------LLAEPTLRIRSVHRMDRGGYYCIAQNG-EGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSS 273          
BLAST of hmctn vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.864e-12
Identity = 48/179 (26.82%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L++ N+ ++D G Y C+      +  K   L V  P  I+    S +++ V E+  V ++C + GIP P+I+W+   K+G    L N+ + I      + +   +    G YTC+V N   G++ K F L +   P I +G + +E  + +E     +   + G+P+  I W K+ + L
Sbjct: 2348 LQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWF---KDGWPVSLSNSVR-ILSGGRMLRLMQTTMEDAGQYTCVVRNAA-GEERKIFGLSVLVPPHI-VGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPL 2520          

HSP 2 Score: 74.7146 bits (182), Expect = 2.407e-12
Identity = 51/177 (28.81%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I   ++ D G Y CL S+    D K   +RV VP  I  T   +D  +++ R+ V + C S  +P P I+W  N       RL    +  I      + I N       +YTC+  N + GK ++ F L +   P+IK G   +     + T+++ I  G P   I W K+  +L
Sbjct: 3584 LRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQ-VTLECKSDAVPPPVITWLRN-----GERLQATPRVRILSGGRYLQINNADLGDTANYTCVASN-IAGKTTREFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEGVPTPRITWRKDGAVL 3753          

HSP 3 Score: 70.8626 bits (172), Expect = 3.910e-11
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--QAIINGHPINSIQWEKNSKILNLSANKCFYIGR 1241
            LK+      D G Y C         +K   + VLVP  I+ T    +  +V  R+ V + C   G P P+I W+   K+G    L +   ++      + + N  R   G Y C V N   GKQ+K  KL I+  PSIK GN   + S    ++I  +    G P+ +I W K+ + + +S+++  YI +
Sbjct: 1416 LKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRD-VALECQVKGTPFPDIHWF---KDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAA-GKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPI-MSSSQALYIDK 1599          

HSP 4 Score: 67.0106 bits (162), Expect = 5.574e-10
Identity = 74/309 (23.95%), Postives = 124/309 (40.13%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN------GHPINSIQWEKNSKILNLSAN-KCFYIGRTKKYCFYLDKTGHFQEQKAQLWIY-----NLSAIDFTSYRLLIVSP--FGNIFGTTKIIEFK 1406
            T   T  P  TI W +          H+ +       ++I        +L+I   + +D G Y C+ S  +   +K   L + VP  +       D + V   E V + CN+ GIP+P I W  + K   +G   R+      +  N +T+ I+       G YTC+  N   G++ + F L ++  P+I+   D  E+     T++   IN      G P   I W KN   L LS++ +    G+  +           + Q + + +Y     N + +D   Y L + +P    N  GT +I   K
Sbjct: 3172 TCDATGIPPPTIAWLK---------NHKRIENSDSLEVRILSGG---SKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSD-VSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERI-----RVSANGSTLNIYGALTSDTGKYTCVATNPA-GEEDRIFNLNVYVTPTIRGNKDEAEKLM---TLVDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIV---------RAQVSDVAVYTCVASNRAGVDNKHYNLQVFAPPNMDNSMGTEEITVLK 3449          

HSP 5 Score: 66.6254 bits (161), Expect = 6.896e-10
Identity = 57/215 (26.51%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDI-FVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            P   I WR+  D   L   H       R+S  I ++ +    L I +  +TD G Y C+ +     DR+ + L+V VP  I P  T+   + V    +  ++C + GIP P+I+W    KNG    +  N+     ++  ++ I + S     +Y C V N   G   ++  L +   PSI         ++    +I    +G P  SI W KN
Sbjct: 3740 PTPRITWRK--DGAVLAGNH------ARYS--ILENGF----LHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTN---MTVIVNVQTTLACEATGIPKPSINWR---KNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGA-GDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKN 3933          

HSP 6 Score: 64.3142 bits (155), Expect = 3.329e-9
Identity = 53/186 (28.49%), Postives = 79/186 (42.47%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI-VKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK--DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSK 1199
            L+I   K++D GEY C+   +    +K   L V VP  I    +    ++ V+E   V + C S  +P P I+WY   KNG   R+       +I  +   + I        G Y C   N V G+  K+F L ++  PSI        +   RE +++ I N         G P  +I W KN K
Sbjct: 3020 LQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWY---KNG---RMITESTHVEILADGQMLHIKKAEVSDTGQYVCRAIN-VAGRDDKNFHLNVYVPPSI--------EGPEREVIVETISNPVTLTCDATGIPPPTIAWLKNHK 3190          

HSP 7 Score: 61.6178 bits (148), Expect = 2.563e-8
Identity = 51/190 (26.84%), Postives = 79/190 (41.58%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD---HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII------NGHPINSIQWEKNSKILNLSAN 1220
            L+I   K+ D G Y C+   E   D     +RVLVP +I   G + D    + V   +  +I C S G P+P  SW    K+G    L ++      N   + I N      G Y C+ +N   G   K F L +   PS+     +  +S+    ++   I      +G P   + W KN + + L+ N
Sbjct: 2833 LQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPII--KGANSDLPEEVTVLVNKSALIECLSSGSPAPRNSWQ---KDG-QPLLEDDHHKFLSNGRILQILNTQITDIGRYVCVAENTA-GSAKKYFNLNVHVPPSV-----IGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTN 3010          

HSP 8 Score: 61.2326 bits (147), Expect = 2.814e-8
Identity = 43/175 (24.57%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  702 TDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI--KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            +D G+Y C+ +     + +   L V V   I       + L+      + I C + G P P I+W    KNGL   L ++ + +      + I          YTC+  N+  G  +K + L+++  P++   MG + I   +G  T +  I +G P  S+ W ++ + L L A+
Sbjct: 3312 SDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSINIECRATGTPPPQINWL---KNGLPLPLSSHIR-LLAAGQVIRIVRAQVSDVAVYTCVASNRA-GVDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAH 3481          

HSP 9 Score: 61.2326 bits (147), Expect = 3.012e-8
Identity = 60/235 (25.53%), Postives = 108/235 (45.96%), Query Frame = 3
Query:  537 QLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
             +T SP  TI+W +  D Q +         D+R   KI  +     +L I   ++++ G Y C+ +      +K  ++ V VP  I  +G S+   +V + + V + C + GIP+P+I+W  +    +N    N K  I  +   + I        G YTC+  N   G+  +  +L +   PS+    KM N+ +  S   +   +A   G+P+  I W K++++L+ S +  F
Sbjct: 1757 HVTGSPPPTIMWLK--DGQLI---------DERDGFKILLNG---RKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSER--VVVKYKPVALQCIANGIPNPSITWLKD-DQPVNTAQGNLK--IQSSGRVLQIAKTLLEDAGRYTCVATNAA-GETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAA--GNPVPVITWYKDNRLLSGSTSMTF 1969          

HSP 10 Score: 60.4622 bits (145), Expect = 5.370e-8
Identity = 44/179 (24.58%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHL---IVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I      D G Y C+           +KL V VP VI P      HL   ++   + + +SC + G+P P+I+W+ + +      +  + +   ++  ++ I  V     G YTC+  N V G  S S KL +   P I+        ++  + ++  + +G P  +I W+K++ +L
Sbjct: 4043 LQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVISP------HLKEYVIAVDKPITLSCEADGLPPPDITWHKDGR-----AIVESIRQRVLSSGSLQIAFVQPGDAGHYTCMAAN-VAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLL 4209          

HSP 11 Score: 58.5362 bits (140), Expect = 1.988e-7
Identity = 53/214 (24.77%), Postives = 92/214 (42.99%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI-----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGN--DVIEQSQGRETMIQAII------NGHPINSIQWEKN-------SKILNLSANKCFYIGRTK 1247
            L+I N +  + G Y C+ + E     K  +++V +P +I        G S   + +K    + + C +Y IPS ++SWY   K+G   +  ++  +I  N +T+ I        G YTC+  N + G+    F + I   PS +    +GN  D     + ++ +I   I      N  P  ++ W K+        K+L L   +   I R K
Sbjct: 2631 LQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWY---KDGQPLK-SDDHVNIAANGHTLQIKEAQISDTGRYTCVASN-IAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAK 2839          

HSP 12 Score: 58.151 bits (139), Expect = 2.768e-7
Identity = 65/276 (23.55%), Postives = 112/276 (40.58%), Query Frame = 3
Query:  444 SATNAESDCEY---VQILNQIAKSKPKKDSR--RTLQLTFS------PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK--NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            S+   + D EY   V +   IA +   +D    R  Q+T        P   I W R  ++   T + ++L+  +               L+I+N  + D   Y C+ S       +   L V VP  I   G  Q  L++   +  ++ C + G+P+P I+W  +     G +AR Y+  ++ F++  +  + +  R     Y C+  N   G   +   L++   PSI  G   +      +T +     G P  SI W KN  +LN+  N+  Y
Sbjct: 3602 SSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQATPRVRILSGGRY--------------LQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNI--KGGPQS-LVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHAR-YSILENGFLHIQSAHVTDTGR-----YLCMATNAA-GTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSY 3853          

HSP 13 Score: 58.151 bits (139), Expect = 2.768e-7
Identity = 46/176 (26.14%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L+I  ++  D G Y C+ +        + KL V VP  I  T   + H  V E  + I+ C + GIP+P I+W  +  N L A L    K     Y  + + NV    +G YTC+ +N   G+ + +  L +   P+       +  ++G +  +     G P+  + W  N+ I+
Sbjct: 4133 LQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRST---EGHYTVNENSQAILPCVADGIPTPAINWKKD--NVLLANLLG--KYTAEPYGELILENVVLEDSGFYTCVANNAA-GEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNII 4300          

HSP 14 Score: 55.8398 bits (133), Expect = 1.606e-6
Identity = 49/174 (28.16%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII---NGHPINSIQWEK 1190
            L + + +I+D G Y C+        ++ + LRV VP  I+  G  Q+ + V   + V + C S  IP P ++W    K+G +  L      I  N + + I +      G YTC   N V GK  K++ + IW  P+I  G+D + Q    E  + +++   +G P  ++ W+K
Sbjct: 2068 LALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIM--GEEQN-VSVLISQAVELLCQSDAIPPPTLTWL---KDG-HPLLKKPGLSISENRSVLKIEDAQVQDTGRYTCEATN-VAGKTEKNYNVNIWVPPNIG-GSDELTQLTVIEGNLISLLCESSGIPPPNLIWKK 2232          

HSP 15 Score: 55.4546 bits (132), Expect = 1.904e-6
Identity = 44/184 (23.91%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN----DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            +L+I   + +D   Y C+ S      +K   L+V +   I  +G+    +IV   + + + C   GIP P ++W  +    + A+      +I    + + + N+     G Y C+  N V G   K + L +   PSI +GN    + I   +     +    +G P+ SI W K+   ++LS
Sbjct: 2253 QLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAK----GVEILDEGHILQLKNIHVSDTGRYVCVAVN-VAGMTDKKYDLSVHAPPSI-IGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLS 2430          

HSP 16 Score: 55.0694 bits (131), Expect = 2.415e-6
Identity = 50/184 (27.17%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTS-QDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL ++N+ + D G Y C+ +     D  TV L V V    LPT T     + + + E++ +SC + GIP P ++W  N  N + A       D    ++ + I  VS+  +G+Y C  +N V   ++  F      EP +  G+   + IE   G   ++   + G P  +IQW +    + +S
Sbjct: 4223 ELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHV----LPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFN-NNIIPAHF-----DSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYV--KEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPTPTIQWNRKGVDIEIS 4393          

HSP 17 Score: 53.9138 bits (128), Expect = 5.549e-6
Identity = 46/203 (22.66%), Postives = 84/203 (41.38%), Query Frame = 3
Query:  501 KSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGT--SQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN 1103
            K K K+    T ++T +P   I W +          H +++   RF             L+I N+++   G Y CL S+      ++  L V V   I   G+  + + + V       + C +Y  P   I+W+   K+G       N + I     T+ I N    + G Y+C+  N+  G+  K ++++++  P I  G+
Sbjct: 2490 KVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGG-RF-------------LQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVGSDGNPEDVTVILNSPTSLVCEAYSYPPATITWF---KDGTPLESNRNIR-ILPGGRTLQILNAQEDNAGRYSCVATNEA-GEMIKHYEVKVYIPPIINKGD 2673          

HSP 18 Score: 53.5286 bits (127), Expect = 8.269e-6
Identity = 55/223 (24.66%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD--HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIE--QSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            P  T+ W        L   H LL   K+  L I ++  VL   KI++ ++ D G Y C  +       K   + + VP  I   G S +   L V E   + + C S GIP PN+ W       L   +   +  I      + I    +     Y+C+  N V G   K + L+++  P+I   G+   E   ++G+   ++  + G P  ++ W K+   L
Sbjct: 2131 PPPTLTW--------LKDGHPLL---KKPGLSISENRSVL---KIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNI---GGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSM--GRVRILSGGRQLQISIAEKSDAALYSCVASN-VAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPL 2333          
BLAST of hmctn vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.050e-12
Identity = 58/211 (27.49%), Postives = 91/211 (43.13%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--QAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQL 1304
            LK+  +   D G Y C         +K   + VLVP  IL   +S   + V     V + C   G+P P I W+   K+G    L +   ++     ++ + N  R   G Y C V N   GKQ+K  KL ++  PSIK GN   E S    +++  +    G P+ +I W K+ +++  S+              Y+DK      Q+AQ+
Sbjct: 1415 LKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNVLVPPSIL-GASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWF---KDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQCTVSNAA-GKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPAITWYKDGQVVTSSSQ-----------ALYIDKGQLLHIQRAQV 1609          

HSP 2 Score: 69.3218 bits (168), Expect = 1.078e-10
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            L++ + ++ D G Y CL S+    D K   +RV VP  I     +QD  +++ R+ V + C S  +P P I W  N +  L A     +  I      + I N       +YTC+  N + GK ++ F L +   PSI  G   +     +   ++    G P   I W K+  +L
Sbjct: 3583 LRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQ-VTLECKSDAVPPPVIMWLKN-REQLQA---TPRVRILSGGRYLQINNADLGDTANYTCVASN-IAGKTTREFNLTVNVPPSIGGGPQSLVTLLNKSIALECRAEGVPAPRITWRKDGVVL 3752          

HSP 3 Score: 65.855 bits (159), Expect = 1.199e-9
Identity = 58/223 (26.01%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  588 KQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT--------IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            + Y     Q+L +D+      +QS+     L+I N +ITD G Y C+        +K   L V VP  ++  G + +HL V     + ++C   G P P++SW              N++ I  N N +T        I        G YTCI  N+  G+  K   L +   PSIK        ++   +G    ++   N  P   I W KN +++  S N
Sbjct: 2902 RNYWQKDGQILLEDEHHK---FQSDG--RSLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVI--GPNHEHLSVVVNHFISLNCEVSGFPPPDLSW------------LKNEEPIKPNTNVLTVPGGRTLQIIRAKISDGGDYTCIAINQA-GESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTN 3104          

HSP 4 Score: 63.5438 bits (153), Expect = 5.836e-9
Identity = 50/177 (28.25%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKNSK 1199
            L I   +++D G+Y C        D K   L V VP  I   G   + ++      V ++C++ GIP P I+W  N K   N+     +  I    + + I    R ++G+YTC+  N +EGK  K+F L I   PS+  G +V  +     G    +    +G P   +QW ++ K
Sbjct: 3114 LHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPTI--EGPETEVIVETISNPVTLTCDATGIPPPTITWLKNHKPIENSDPL--EVHILSGGSKLQIARPQRSNSGNYTCVASN-MEGKAQKNFILFIQVPPSVA-GAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGK 3284          

HSP 5 Score: 62.003 bits (149), Expect = 1.903e-8
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I+N  + D   Y C+ S       +   L V VP  I   G     L+    + + + C + G+P+P I+W    K+G+     + +  I  N   + I +      G Y C+  N V G   +   L++   PSI MG   +  +   +T +     G P  S+ W KN  +LN+  N+  Y
Sbjct: 3676 LQINNADLGDTANYTCVASNIAGKTTREFNLTVNVPPSI---GGGPQSLVTLLNKSIALECRAEGVPAPRITWR---KDGVVLAESHARYSILEN-GFLHIESAHVTDTGRYLCMATN-VAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSY 3852          

HSP 6 Score: 61.2326 bits (147), Expect = 3.451e-8
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRE---TMIQAIINGHPINSIQWEKNSKIL 1205
            L++ N+ ++D G Y C+      +  K   L V  P  I+      +++ V E+  V ++C + GIP P+I+W    K+G    L ++ K I      + +        G YTCIV N   G+  K F L +   P I +G + +E  + +E     +   + G+P+  I W K+ ++L
Sbjct: 2347 LQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWL---KDGWPVNLGSSVK-ILSGGRMLRLMQTRPEDAGQYTCIVRNAA-GEDRKMFGLSVLVPPHI-VGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLL 2519          

HSP 7 Score: 58.9214 bits (141), Expect = 1.451e-7
Identity = 49/192 (25.52%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN------GHPINSIQWEKNSKILNLSAN 1220
            +L+I   + ++ G Y C+ S  +   +K   L + VP  +    +P+  S     V   E V + CN+ GIP+P++ W  + K  +N      +  +  + +T+ I+       G YTC+  N   G++ + F L ++  P I+ GN   E+++    ++   IN      G P   I W KN   L +S++
Sbjct: 3207 KLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQVPPSVAGAEVPSEVS-----VLLGENVELVCNADGIPTPHLQWLRDGKPIVNGE--TERVRVTTDGSTLNIYRALTSDMGKYTCVATNPA-GEEDRIFNLNVYVPPKIR-GNK--EEAEKLMALVDTSINIECKATGTPPPQINWLKNGLPLPISSH 3387          

HSP 8 Score: 58.9214 bits (141), Expect = 1.527e-7
Identity = 53/216 (24.54%), Postives = 89/216 (41.20%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK ++ WR+            LL  D+       Q++Y L+    L I +  + D   YEC  +++   D++ V L V VP  I       D L+ ++   V+ +C++ G+P P+I W    KNGL      +   I ++   + I      H G YTC+  N   G   +   L +   P I+     ++       ++     G P   I W+K
Sbjct: 3830 PKPSVTWRK---------NGHLLNVDQN------QNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTI--ADEPMDFLVTRQAPAVM-TCSASGVPVPSIHWT---KNGLRLLPRGDGYRI-LSSGAIEIPTTQLNHAGRYTCVARNAA-GSAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITWQK 4022          

HSP 9 Score: 58.9214 bits (141), Expect = 1.553e-7
Identity = 42/170 (24.71%), Postives = 74/170 (43.53%), Query Frame = 3
Query:  702 TDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK--MGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            +D G+Y C+ +     + +   L V VP  I       + L+      + I C + G P P I+W    KNGL   + ++ + +      V I          YTC+  N+  G  SK + L+++  P++   MG + I   +G  T +    +G P  S+ W ++ + L
Sbjct: 3311 SDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKEEAEKLMALVDTSINIECKATGTPPPQINWL---KNGLPLPISSHIR-LLSAGQVVRIVRAQVSDIAVYTCVASNRA-GVDSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPL 3475          

HSP 10 Score: 56.225 bits (134), Expect = 1.060e-6
Identity = 51/205 (24.88%), Postives = 89/205 (43.41%), Query Frame = 3
Query:  501 KSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQ--HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI--LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN 1103
            K K K+    T ++  +P   I W +  D Q L     H +++   RF             L+I N +++  G Y CL S       K+ +L V V   I  + +  S + +IV       + C +Y  P   I+W+   K+G       N + I     T+ I N    + G Y+C+  N+  G++ K ++++++  P IK G+
Sbjct: 2489 KIKEKQSVTLTCEVRGNPVPQITWHK--DGQLLQEDEAHHMMSGG-RF-------------LQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFVSPTIAGVDSDGSPEDVIVILNSPTSLVCEAYSYPPATITWF---KDGTPLESNRNIR-ILPGGRTLQILNAQEDNAGRYSCVATNEA-GEKIKHYEVKVYIPPIIKKGD 2672          

HSP 11 Score: 55.8398 bits (133), Expect = 1.344e-6
Identity = 62/237 (26.16%), Postives = 103/237 (43.46%), Query Frame = 3
Query:  537 QLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD--HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI----KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCF 1229
            Q++ SP  TI+W +           QL+  D+R   KI  +     +L I   +++D G Y+C+ +      RK  ++ V VP    PT  S D     V   + V + C + GIP+P+I+W    K+       +    I  +   + I        G YTC+  N   G+  +  +L +   PS+    KM N+ +  +   +   +A   G P+  I W K+S  L+ SA+  F
Sbjct: 1756 QVSGSPPPTIMWLKG---------GQLI--DERDGFKILLNG---RKLVIAQAQVSDTGLYQCVATNIAGDHRKEFEVTVHVP----PTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWL---KDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAA-GEAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKA--TGKPLPVITWYKDSHPLSGSASAAF 1968          

HSP 12 Score: 55.4546 bits (132), Expect = 2.003e-6
Identity = 49/184 (26.63%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTS-QDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN---DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            EL ++N+ + D G Y C+ +     D + V L V      LPT T     L + + E++ +SC + GIP P ++W  N  N + A       D    ++ + I  VS+  +G+Y C  +N V   ++  F      EP +  G+   + IE   G   ++   + G P  +IQW +    + +S
Sbjct: 4222 ELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHT----LPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFN-NNIIPAHF-----DSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYV--KEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPAPTIQWSRKGADIEIS 4392          

HSP 13 Score: 54.6842 bits (130), Expect = 3.011e-6
Identity = 54/223 (24.22%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL--PTGTSQD---HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYN--NKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            PK +I W +K +         + T   +FS     S YV+      +    + GEY C  +      ++ V+L V V   +     G SQD    + V   E+ I+ C +  +P P I+W        +++L +  + +  F+   ++ I       +G Y C+  N + G  ++S KL +   P I+ GN  I+   G+   I    +G P   I W K+ +
Sbjct: 1008 PKPSITWSKKGE--------LISTSSAKFSAGADGSLYVV------SPGSEESGEYICTATNAAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITW------AKDSQLISPFSPRHTFLPSGSMKITETRVSDSGMYLCVATN-IAGNVTQSVKLSVHVPPKIQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGR 1209          

HSP 14 Score: 54.6842 bits (130), Expect = 3.568e-6
Identity = 49/218 (22.48%), Postives = 86/218 (39.45%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVL-VPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVT----IFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            PK  IVW   M++ ++   H       R+ +    +      L I N    D G Y CL S     D++T  LR +  P +++     Q  L+V   +  ++ C + GIP P + W+   K  L  R        F++ + +     I     +  G YTC+  N+  G+ +    L++   P        +    G    +   + G+P   I+W +
Sbjct:  639 PKPKIVW--TMNEMFIMGSH-------RYRMTSEGT------LFIKNAVPKDAGTYACLASNAAGTDKQTSTLRYIEAPKLVV----EQSELLVALGDTTVMECKTSGIPPPQVKWF---KGDLELR-----PSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEA-GRATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRR 828          

HSP 15 Score: 53.9138 bits (128), Expect = 5.185e-6
Identity = 56/226 (24.78%), Postives = 90/226 (39.82%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILP-TGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            P+  I WRR  +    +         + FS+  + S      L I NL  +D G Y C    E    +   +  V V  ++ P  G S     V E + + + C    G P P   W  N     +A L  N      +  ++ I  V     G YTC+  N V G  +K+  + +   PSI+ G  ++   +G    +    +G P  SI W K  ++++ S+ K
Sbjct:  820 PEPKIKWRRLDNMPVFS---------RPFSVS-FISQLRTGALFISNLWASDKGTYIC--EAENQFGKIQSQTTVTVTGLVAPLIGISPSMASVIEGQPLTLPCTLLAGNPIPERRWMKN-----SAMLVQNPYITVRSDGSLHIERVRLQDGGKYTCVASN-VAGTNNKTTSVAVHVLPSIQHGQQILSTIEGVPVTLPCRASGIPKPSITWSKKGELISTSSAK 1027          

HSP 16 Score: 53.9138 bits (128), Expect = 6.302e-6
Identity = 46/196 (23.47%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVI-----LPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK----MGN--DVIEQSQGRETMIQAIINGH------PINSIQWEKNSKILNLS 1214
            L+I N +  + G Y C+ + E     K  +++V +P +I     L  G S   + ++    + + C +Y IPS ++ WY   K+G   +  ++   I  + +T+ I        G YTC+  N + G+    F + I   PS +    +GN  D     + ++ +I   ++ H      P  ++ W K+ + L  S
Sbjct: 2630 LQILNAQEDNAGRYSCVATNEAGEKIKHYEVKVYIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAIPSASLRWY---KDGQPLK-SDDHVTIAASGHTLQIKEAQISDTGRYTCVASN-LAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCETNAAPPPTLTWYKDGRPLTSS 2820          

HSP 17 Score: 53.1434 bits (126), Expect = 9.717e-6
Identity = 47/187 (25.13%), Postives = 80/187 (42.78%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK--DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII----NGHPINSIQWEKNSKILNLSAN 1220
            L+I   +  D G Y C+ S    + +K   L+V +   I  +G  +  + V   + + + C   GIP P ++W    K+G   R     K  +I      + + NV     G Y C+  N V G   K + L +   PSI +GN  + ++          +    +G P+ SI W K+   +NL ++
Sbjct: 2253 LQISIAEKADAGLYTCVASNVAGVAKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWM---KDG---RPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVN-VAGMTDKRYDLSVHAPPSI-IGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSS 2431          

HSP 18 Score: 53.1434 bits (126), Expect = 9.883e-6
Identity = 50/186 (26.88%), Postives = 76/186 (40.86%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLI---VKEREKVIISCNSYGIPSPNISWYAN---WKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQWEKNSKILNL 1211
            L I ++   ++GEY C+   E     +   L+V VP VI      ++H+    V   +   + C   G PSP I+WY +          ++ NN K        + +F VS    G Y+C   N + G   K F + +   PSI   +   E S        +Q    G P  +I W K+ K L L
Sbjct: 1322 LVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVI----RDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGK-------ILKLFKVSAEDAGRYSCKAIN-IAGTSQKDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFL 1495          
BLAST of hmctn vs. UniProt/SwissProt
Match: sp|Q26474|LACH_SCHAM (Lachesin OS=Schistocerca americana OX=7009 GN=LAC PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.054e-12
Identity = 51/213 (23.94%), Postives = 100/213 (46.95%), Query Frame = 3
Query:  576 RKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC--LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN 1208
            R++D   ++    L+ +D RF+L+ Y +      L+I +++ TD G Y+C  +      I  + V L+V  P VI  +  S   L+V E + V + C + G P+P +SW        N  +      I+   N + I  + +   G+Y C+ +N V     ++  +E+ + P I +    + Q+   +  ++  +  +P  +I W K+  +L+
Sbjct:   62 RQVDPLPISTGSSLIIRDSRFALR-YDTASSTYTLQIKDIQETDAGFYQCQVIIGLNNKITAE-VDLQVRRPPVI--SDNSTRSLVVSEGQAVRLECYAGGYPAPRVSWRRE-----NNAILPTGGSIYRG-NVLKISRIGKEDRGTYYCVAENGVGKGARRNIAVEVEFPPVITVPRPRLGQALQYDMDLECHVEAYPPPAITWLKDETVLS 264          
BLAST of hmctn vs. TrEMBL
Match: S5WES3 (Hmctn (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 4.896e-152
Identity = 213/215 (99.07%), Postives = 214/215 (99.53%), Query Frame = 3
Query:  783 PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFN+SRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYR LIVSPFGNIFGTTKIIEFKPINHDSW
Sbjct:    1 PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNISRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRCLIVSPFGNIFGTTKIIEFKPINHDSW 215          

HSP 2 Score: 101.679 bits (252), Expect = 6.314e-20
Identity = 52/56 (92.86%), Postives = 52/56 (92.86%), Query Frame = 2
Query: 1430 YLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGESNYLNY 1597
            YLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGE   L Y
Sbjct:  218 YLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGEKKELEY 273          
BLAST of hmctn vs. TrEMBL
Match: A0A419Q306 (Opioid-binding protein/cell adhesion molecule-like protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=OPCML PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.203e-50
Identity = 99/311 (31.83%), Postives = 171/311 (54.98%), Query Frame = 3
Query:  507 KPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN---ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQ-EQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            +P K S   +    + K T++W+R     YL   ++ L  D RF L +   +  +M+L+IDN++  D+G Y CLYST +++ ++ ++L VLVP +I    +S   ++V+E +  ++ C ++G+P PN++WY   ++G +    RL N+ +   V  N + IFNV+R  NG Y C+  N +E   S+  +L++ + P+I+M N  I Q   R TM++A+I G+PIN   WE   + +    + C      +KYC  +D  G  Q E K  L+I NL+  D+  Y  ++ +P+G    +T++    P +   W
Sbjct:   68 RPIKKSAEGVGWDATNKGTLLWKRASTNDYLIHDNRRLHPDTRFILDMSSFDQTIMDLRIDNVQQADEGTYICLYSTGQHVYKRKIRLNVLVPPIIYENSSSPTRVVVQEGDDTVLHCKAWGVPQPNVTWYLLGQDGSSIQLGRLVNSPR-FTVEANHLQIFNVTRTMNGLYKCVAQNGLERMASRVIELDVHFPPTIRMANTKIGQLLYRTTMVRALITGNPINRFHWEFEQRPIYGPNSNCLVPMPNEKYCMIVDTMGSLQKELKTTLFITNLTMHDYGLYTCVVETPYGIFRNSTEVFRTYPSHGFPW 377          
BLAST of hmctn vs. TrEMBL
Match: H2KUX2 (Opioid-binding protein/cell adhesion molecule homolog OS=Clonorchis sinensis OX=79923 GN=CLF_110631 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.783e-50
Identity = 112/377 (29.71%), Postives = 193/377 (51.19%), Query Frame = 3
Query:  333 ISNMEKLKMRLKYEILSKVKKMNIKVKIQKVKMKFPKSATNAESDCE-YVQIL-------NQIAKSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN---ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQ-EQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            ISN E   +     I  K  +++I     K +    K   N + D E +  I+         +   +P K S   +    + K T++W+R     YL   ++ L  D RF L +   +  +M+L+IDN++  D+G Y CLYST +++ ++ ++L VLVP +I    +S   ++V+E +  ++ C ++G+P PN++WY   ++G +    RL N+ +   V  N + IFNV+R  NG Y C+  N +E   S+  +L++ + P+I+M N  I Q   R TM++A+I G+PIN   WE   + +    + C      +KYC  +D  G  Q E K  L+I NL+  D+  Y  ++ +P+G    +T++    P +   W
Sbjct:   34 ISNSEPADL-----IWPKQPEVDIGSSDPKEEGTLEKDTENKQFDAEDFASIIVEAVVNNTALLPCRPIKKSAEGVGWDATNKGTLLWKRASTNDYLIHDNRRLHPDTRFILDMSSFDQTIMDLRIDNVQQADEGTYICLYSTGQHVYKRKIRLNVLVPPIIYENSSSPTRVVVQEGDDTVLHCKAWGVPQPNVTWYLLGQDGSSIQLGRLVNSPR-FTVEANHLQIFNVTRTMNGLYKCVAQNGLERMASRVIELDVHFPPTIRMANTKIGQLLYRTTMVRALITGNPINRFHWEFEQRPIYGPNSNCLVPMPNEKYCMIVDTMGSLQKELKTTLFITNLTMHDYGLYTCVVETPYGIFRNSTEVFRTYPSHGFPW 404          
BLAST of hmctn vs. TrEMBL
Match: A0A4S2LSS5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005101 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.785e-50
Identity = 99/311 (31.83%), Postives = 171/311 (54.98%), Query Frame = 3
Query:  507 KPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLN---ARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQ-EQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            +P K S   +    + K T++W+R     YL   ++ L  D RF L +   +  +M+L+IDN++  D+G Y CLYST +++ ++ ++L VLVP +I    +S   ++V+E +  ++ C ++G+P PN++WY   ++G +    RL N+ +   V  N + IFNV+R  NG Y C+  N +E   S+  +L++ + P+I+M N  I Q   R TM++A+I G+PIN   WE   + +    + C      +KYC  +D  G  Q E K  L+I NL+  D+  Y  ++ +P+G    +T++    P +   W
Sbjct:   95 RPIKKSVEGVGWDATNKGTLLWKRASTNDYLIHDNRRLHPDTRFILDMSSFDQTIMDLRIDNVQQADEGTYICLYSTGQHVYKRKIRLNVLVPPIIYENSSSPTRVVVQEGDDTVLHCKAWGVPQPNVTWYLLGQDGSSIQLGRLVNSPR-FTVEANHLQIFNVTRTMNGLYKCMAQNGLERMASRVIELDVHFPPTIRMANTKIGQLLYRTTMVRALITGNPINRFHWEFEQRPIYGPNSNCLVPMPNEKYCMIVDTMGSLQKELKTTLFITNLTMHDYGLYTCVVETPYGIFRNSTEVFRTYPSHGFPW 404          
BLAST of hmctn vs. TrEMBL
Match: A0A0R3WAJ2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7580 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 5.734e-48
Identity = 92/280 (32.86%), Postives = 160/280 (57.14%), Query Frame = 3
Query:  567 VWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKD--IFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDK-TGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKII 1397
            +WRR  +  YLTF ++ +++D+R+ + +   N   M+L+I+ +  +D+GEY CLY  EK +  K V L+VL+P  I P G+S   ++V+E     + CN  G+P+P I WY +  +G   R+   K      ++ + + I NV+R   G +TC+  N +EGK S++  L++++ P +KM  ++I +   + TMI A + G+PI S+ WE + K +      CF+     KYC   D+   +    + +L IYNL+  D+ +Y  ++ SPFG   G+T+++
Sbjct:  106 IWRRLEEPAYLTFNYRRISQDQRYHVVMADFNEFKMDLRIEQVMPSDEGEYICLYRGEKLVHEKHVYLKVLIPPFINPNGSSNTRVVVREGLTQKLICNVSGVPAPTIKWYMSTTDGKTRRIITAKDQPRFLLSISALIISNVTRDLRGVFTCVAYNGIEGKVSRNIHLDVYFRPVVKMSAEIIYRKPYQSTMIFATVVGNPIYSLYWEFDHKPIRSVNGDCFFTLSGDKYCVVSDREVANPMTVRTKLTIYNLTLDDYGTYTCVVHSPFGMERGSTELV 385          
BLAST of hmctn vs. Ensembl Cavefish
Match: ENSAMXT00000033537.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27646037:27658799:-1 gene:ENSAMXG00000043229.1 transcript:ENSAMXT00000033537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.614e-11
Identity = 46/171 (26.90%), Postives = 74/171 (43.27%), Query Frame = 3
Query:  681 KIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAV-ILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            +I    +TD+G YEC+  +   + R    LRV  P V + P   S         ++V +SC++ G P+P + W  N       +L  N   +     T+TI +      G Y C   N+  G  S+S  L  +  PSI     V+    GR+ +++    G P   ++W K
Sbjct:  440 EISRASVTDEGVYECVARSAAGVGRALTNLRVTTPGVAVFPLTQS-----FSRGDEVHLSCSASGSPTPKVHWSHN-----GIQLIENHMTV-TQTGTLTIKDTQPEDAGDYRCTATNEA-GTDSQSVTLS-YAPPSIYAAQTVVIAEVGRQAVLECTATGVPNPVVKWRK 597          
BLAST of hmctn vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 64.3142 bits (155), Expect = 2.849e-10
Identity = 50/183 (27.32%), Postives = 84/183 (45.90%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKY--IDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L++  +   D+G Y C    E    ID + + L V VP V L       +      E V  +C +YG P P+++W+   + G+   L  +++ +      T+TI N+ +   GSYTC   NK  G+  +   L+++ +P I K+ N  +   +G   MI     G P+  I W + S   + S
Sbjct:  285 LQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPV-LSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWH---RKGVE--LQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNKA-GEVQQEIVLKVFVQPHITKLRN--VTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFS 458          

HSP 2 Score: 50.8322 bits (120), Expect = 4.911e-6
Identity = 48/223 (21.52%), Postives = 92/223 (41.26%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISW--------YANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            SP+  + W RK  +         L + +++ ++   +      L I N+K  D G Y C  S +    ++ + L+V V     P  T   ++   E    +ISC + G P P+ISW        +++     + R+    +      + +TI  V     G + C   +++ G Q KS  L+I Y P  +  + +    +G    I   +  +P  ++ W ++
Sbjct:  351 SPEPDVTWHRKGVE---------LQESEQYVMRARGTT-----LTIRNIKQDDGGSYTCKASNKAGEVQQEIVLKVFV----QPHITKLRNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVRGRR---GESMLTIVGVGLSDWGRFDCEALSRIGGHQ-KSMFLDIEYAPKFQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRD 551          
BLAST of hmctn vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 64.3142 bits (155), Expect = 3.233e-10
Identity = 50/183 (27.32%), Postives = 84/183 (45.90%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKY--IDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L++  +   D+G Y C    E    ID + + L V VP V L       +      E V  +C +YG P P+++W+   + G+   L  +++ +      T+TI N+ +   GSYTC   NK  G+  +   L+++ +P I K+ N  +   +G   MI     G P+  I W + S   + S
Sbjct:  188 LQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPV-LSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWH---RKGV--ELQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNKA-GEVQQEIVLKVFVQPHITKLRN--VTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFS 361          

HSP 2 Score: 50.8322 bits (120), Expect = 4.522e-6
Identity = 48/223 (21.52%), Postives = 92/223 (41.26%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISW--------YANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            SP+  + W RK  +         L + +++ ++   +      L I N+K  D G Y C  S +    ++ + L+V V     P  T   ++   E    +ISC + G P P+ISW        +++     + R+    +      + +TI  V     G + C   +++ G Q KS  L+I Y P  +  + +    +G    I   +  +P  ++ W ++
Sbjct:  254 SPEPDVTWHRKGVE---------LQESEQYVMRARGTT-----LTIRNIKQDDGGSYTCKASNKAGEVQQEIVLKVFV----QPHITKLRNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVRGRR---GESMLTIVGVGLSDWGRFDCEALSRIGGHQ-KSMFLDIEYAPKFQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRD 454          
BLAST of hmctn vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 63.929 bits (154), Expect = 3.932e-10
Identity = 50/183 (27.32%), Postives = 84/183 (45.90%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKY--IDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLS 1214
            L++  +   D+G Y C    E    ID + + L V VP V L       +      E V  +C +YG P P+++W+   + G+   L  +++ +      T+TI N+ +   GSYTC   NK  G+  +   L+++ +P I K+ N  +   +G   MI     G P+  I W + S   + S
Sbjct:  285 LQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPV-LSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWH---RKGVE--LQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNKA-GEVQQEIVLKVFVQPHITKLRN--VTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFS 458          

HSP 2 Score: 50.447 bits (119), Expect = 5.470e-6
Identity = 48/223 (21.52%), Postives = 92/223 (41.26%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISW--------YANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            SP+  + W RK  +         L + +++ ++   +      L I N+K  D G Y C  S +    ++ + L+V V     P  T   ++   E    +ISC + G P P+ISW        +++     + R+    +      + +TI  V     G + C   +++ G Q KS  L+I Y P  +  + +    +G    I   +  +P  ++ W ++
Sbjct:  351 SPEPDVTWHRKGVE---------LQESEQYVMRARGTT-----LTIRNIKQDDGGSYTCKASNKAGEVQQEIVLKVFV----QPHITKLRNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVRGRR---GESMLTIVGVGLSDWGRFDCEALSRIGGHQ-KSMFLDIEYAPKFQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRD 551          
BLAST of hmctn vs. Ensembl Cavefish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 63.929 bits (154), Expect = 3.963e-10
Identity = 60/224 (26.79%), Postives = 99/224 (44.20%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC--LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKERE---------KVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQW 1184
            SP  T++W+ K  K     Q +   KD RF  KI  +N+    L+I  +K TD+G Y C     T   ID + +++ V V    LPT      + V++ E           +++C+  G P P + W  + +N  +  L +  K  F  + + +TI +V ++  G YTCI  NK  GK  +   L ++ +P I    +        +  +     G P  +I W
Sbjct:   46 SPPPTVIWKHKRVK----VQSE---KDVRF--KILNNNH----LQIRGIKKTDEGVYNCEGRVMTRGEIDFRPIRVVVNV----LPT------VRVRQAEVNATADLGLSAMLACDGDGFPEPTVMWKRSLRN--DVLLESGDKYSFNEDGSEMTIMDVKKLDEGDYTCIASNKA-GKAEEEVSLRVFVKPRITFLENQTATEMEEQMTLTCEATGDPTPTITW 243          
BLAST of hmctn vs. Ensembl Sea Lamprey
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 55.8398 bits (133), Expect = 2.202e-8
Identity = 34/127 (26.77%), Postives = 61/127 (48.03%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKS 1058
            ++IDN++  D G+Y C+   +    R   KL VL P  IL    +++  +    + +I+ C + G P P ISW+       N  L      I +   ++ +  V R   G Y C+ +++V+G Q+ +
Sbjct:  154 MRIDNVQEDDAGDYTCIIKAQNETQRLYAKLTVLEPPRILHGPENRNASV---SDDIILECQAEGRPRPVISWFQ------NGDLIIPDDFIQIVDGSLHVLGVMRSDEGVYQCMAESEVDGMQAAA 271          
BLAST of hmctn vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005303.1 (pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1 gene:ENSPMAG00000004817.1 transcript:ENSPMAT00000005303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 4.286e-8
Identity = 64/284 (22.54%), Postives = 105/284 (36.97%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLME---LKIDNLKITDDGEYECLYSTEKY--IDRKTVKL---RVLVPAVILPTGTSQDHLIVKEREKVIISCNSY-GIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEI--------WYEPSIKMGNDVIEQSQGRETMIQAIINGHPIN--SIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSY 1343
            SP     W R           Q L +     + IY+  +   +   LK+ NL+  D   Y C+ S      I  +       R   P V+    + Q  L+++  E+V + C    G P P+++W +    GL            +  + +TI +V    +G+YTC+V N V G   ++  + +        W  P     +D I+   GRE  I   +   PI   S  W +N ++L           R+            F    + L I +L   DF +Y
Sbjct:   34 SPAARHTWHRGA---------QPLQQGADSGVDIYEPLFTHADTNILKLKNLRAQDYANYTCVVSVGSVCNIPARAASFPLTRTTAPPVLEHPASEQ--LVLEPGERVRLRCAVIKGDPIPSVTW-SRSPGGL-------PPTCLIGKDNLTIQSVRESDSGTYTCLVSNGVGGAVRRAINVTVRSLRRGRFWITPDPYHEDDNIQ--IGREVKISCQVEAVPIEELSFTWYRNGRML-----------RSSDRLLISKSDSDFAPGTSSLDIIDLRFTDFGTY 285          
BLAST of hmctn vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.988e-6
Identity = 49/211 (23.22%), Postives = 81/211 (38.39%), Query Frame = 3
Query:  654 QSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG---LNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTG 1277
            ++   +  L I N+    +G Y CL   E        +L V VP   +     QD +  K    V+++C++ G P P I W  +  NG       L    +   +   ++ +  V     G Y C V N V    SKS  L +     +    +V   ++G+ + +Q    G     I+WEK   +++          R  +Y  Y   TG
Sbjct:  479 ETTEFISSLLIPNVTQLHNGNYTCLARNEAATVSHGSQLIVRVPPRFVVQPKDQDGIFGK---PVVLNCSADGYPIPKIIWKYSKGNGNPQFQPVLSGGGRFQPLGNGSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVKIPALVTSQANVTLATRGQHSNLQCSARGERPIIIRWEKEETLIDPE--------RMFRYVVYTQDTG 678          
BLAST of hmctn vs. Ensembl Sea Lamprey
Match: nfasca (neurofascin homolog (chicken) a [Source:ZFIN;Acc:ZDB-GENE-080229-6])

HSP 1 Score: 47.7506 bits (112), Expect = 7.589e-6
Identity = 50/218 (22.94%), Postives = 95/218 (43.58%), Query Frame = 3
Query:  612 QLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYS----TEKYIDRKTVKLRV--------LVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYN-TVTIFNVSRIHNGSYTCIVDNKVE-GKQSKSFKLEIWYEPSIKMGNDVIEQSQ-GRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            Q L++D+R S  +        +L   N++ +D  +    Y+    T+    ++ +KL V          P  + P G S   +++K  + + + C + G+P+P I W+   K+G        K    +N+N T+ + NV+   +G+Y C+  N++   + + +  +E    P    G       Q G +T I     G+P  SI+W  N   +  + N
Sbjct:  149 QRLSQDERVSQGLNG------DLYFSNVRASDARDDYICYARFVYTQTIQQKQPIKLTVQPGSRVDLYPPRFLSPVGASSTKMVLKG-DVLSLECIAAGLPTPRIQWF---KSGAEMPWERAK---LLNFNKTLILANVTEGDDGNYVCLASNRLGVQRHTTTVAIEDTAAPYWLTGGPESRVVQPGEQTTIMCRATGNPKPSIRWLLNGGPIEEAGN 353          
BLAST of hmctn vs. Ensembl Nematostella
Match: EDO30350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T115])

HSP 1 Score: 63.929 bits (154), Expect = 1.477e-11
Identity = 49/173 (28.32%), Postives = 86/173 (49.71%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTG-TSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGH-PINSIQWEK 1190
            L I ++KI+D G Y C  +    I  +     V V +   P+G T   ++ V E E + ++C + G P+PNI+W    K+G++A L +N     ++     I +V + H G YTC  +N++ G  S++  + +   PSI      +  ++G    +Q   +G  P+N + W K
Sbjct:   30 LTISDVKISDGGCYVC--TAYNNIGSEANPASVHVTSTT-PSGDTFASNITVIEGESLTLNCTATGCPTPNITWT---KHGVSAALRSNITTEIIHQ----IASVQKSHAGRYTCAANNEI-GTVSRTLSVTVHSAPSITFITANMTVTEGSLVNLQCNTSGSLPLN-VSWSK 190          
BLAST of hmctn vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 58.151 bits (139), Expect = 6.830e-9
Identity = 47/182 (25.82%), Postives = 73/182 (40.11%), Query Frame = 3
Query:  834 EREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFG 1370
            E + V   C + G PSPN++W  +       ++ R Y+N   +        I NVSRI +G+Y+C   N++ G  S    L++ Y P           ++G     +    G+P  ++ W KN   LN S +  FY   T                   L I N++  D  +YR    S  G
Sbjct:   10 EGQVVKFECQTTGNPSPNVTWLKSGSAVNTSVDPRFYSNDTILM-------ITNVSRIDSGTYSCNASNEL-GIISAEAALDVRYGPEFVNVPQDKTPNEGWSVTFECHTKGNPPPTVTWLKNGSALNTSVDPRFYSNGT------------------HLMITNVNRTDSGAYRCNASSILG 165          
BLAST of hmctn vs. Ensembl Nematostella
Match: EDO32002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB1])

HSP 1 Score: 53.9138 bits (128), Expect = 8.058e-9
Identity = 33/120 (27.50%), Postives = 56/120 (46.67%), Query Frame = 3
Query:  834 EREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            E E + ++C + G P+PNI+W    K G++A L +N     ++     I +V +   G YTC  +N++ G  S++  + + Y P+I           G    +    + HP   I W KN
Sbjct:    3 EGESLTLNCTATGCPTPNITWT---KQGVSAALRSNITTEIIH----QIASVQKSDAGRYTCAANNEI-GAVSRTLSVTVHYPPTIVTTPKNTTAYLGGNVTLYCNASSHPAPQIYWAKN 114          
BLAST of hmctn vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 53.9138 bits (128), Expect = 1.939e-8
Identity = 35/132 (26.52%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  801 TGTSQD-HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            T  S D  + +   + V + C++ G P+PNI+W         A L +N        + +T++NV+R   GSY C  DN +      S  L + + P I +      E S G+   +   + G P+ S+ W +
Sbjct:    4 TAISPDVSVTINRTDSVTLQCHASGDPAPNITWSHE-----GAPLEHNG-------SILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFETSLGKAINLTCDVEGGPLPSVTWSR 123          
BLAST of hmctn vs. Ensembl Nematostella
Match: EDO44777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUN7])

HSP 1 Score: 52.373 bits (124), Expect = 3.765e-7
Identity = 41/152 (26.97%), Postives = 70/152 (46.05%), Query Frame = 3
Query:  636 FSLKIYQSNYVLMELKIDNLKITDDGEYEC----LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWY 1079
            +SLK+ +   VL    I+ +K + +GEY       ++   Y  R T  L+VLVP  I  T  +   +IV E   V + C + G P PNI+W   ++             +    + + +  V R+++G Y C  DN +   ++ S  L++ Y
Sbjct:   87 YSLKVKRLEAVLT---INKVKTSLEGEYSIKIVGGFNGTTYQSRGT-SLKVLVPLSI--TSPANKTIIVLENNTVELVCETTGSPPPNITWTKGYR-------------VIGTGSPLRLAGVGRLNDGCYDCTADNGMGTSKNASVCLDVQY 219          
BLAST of hmctn vs. Ensembl Medaka
Match: hmcn1 (hemicentin 1 [Source:NCBI gene;Acc:101172646])

HSP 1 Score: 72.0182 bits (175), Expect = 1.551e-12
Identity = 52/225 (23.11%), Postives = 95/225 (42.22%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKN---GLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFG 1370
            D G Y CL ++    D K   ++V  P ++    T QD  +++ R+  +  C S  +P P ++W  + +        R+ +  + + +N + ++           YTC+  N V GK ++ F L +   P+IK G  ++     +  +++ ++NG P   + W KN  IL          G    Y F         E+   L I++    D   Y  L+ +P G
Sbjct: 3350 DTGRYSCLANSPAGDDDKEFLVQVHPPNIV-GENTPQDVSVLQNRQATL-ECKSDAVPPPTLTWLKDGQQLQASARVRILSGGRYLQINLSELS-------DTAQYTCVASN-VAGKTTREFNLNVNVAPTIKDGPQIVTVHVDKSAVLECVVNGVPPPRVTWRKNGAIL----------GGNNPYTF---------EENGSLHIHSAQVSDTGRYLCLVTNPAG 3545          

HSP 2 Score: 69.707 bits (169), Expect = 8.976e-12
Identity = 52/187 (27.81%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQ-----SQGRETMIQAIINGHPINSIQWEKNSKILNLSANK 1223
            LKI   +++D G+Y C+ +       K   L +  P +    G+ ++ L+      V  +C++ GIP PN+SW    KNG      + +  I    + + I  +     G+YTC+  N VEGK  KS+ L I  +P    G+D+  +     ++  + + QA   G P+ +IQW K+ K +N + ++
Sbjct: 2882 LKIKTSEVSDTGQYVCIATNVAGQVDKNFHLNIHPPRI---DGSVRESLVEIISNSVSFACDASGIPPPNLSWL---KNGQPINSESLEMHISSGGSKLQIARLQLSDGGTYTCVASN-VEGKARKSYHLTI--QPPSITGSDMPSEMGVLLNESIQMVCQA--QGAPVPTIQWLKDGKAVNRTGHR 3057          

HSP 3 Score: 62.3882 bits (150), Expect = 1.445e-9
Identity = 45/172 (26.16%), Postives = 75/172 (43.60%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKN 1193
            L I + +++D G Y CL +      R+ V ++V  P++      SQ ++ V    +  + C + GIP P +SW    K G       N+    ++  ++ I   +      YTC+V N+  G  SKS +L +   PSI      +   +    +I     G P  SI W K+
Sbjct: 3523 LHIHSAQVSDTGRYLCLVTNPAGTQRRRVDMQVYPPSI----ANSQTNVTVIVNVQTTLPCEASGIPKPTVSWQ---KKGRTISTDQNQNMYLLSSGSLVILAPTVEDTAVYTCVVSNEA-GNNSKSIRLTV-IPPSIADEPAELVVLRQSPVVISCTAYGVPKPSIHWSKD 3685          

HSP 4 Score: 62.3882 bits (150), Expect = 1.727e-9
Identity = 48/175 (27.43%), Postives = 79/175 (45.14%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ--GRETMIQAIINGHPINSIQWEKN 1193
            EL ID+ +  D G Y C  +     D  TVKL V    V +        + +   E+++++C + GIP P I+W  N     +    N + ++ V         VS+   G+YTC+ +N V   +S  F   +  +P I  G+    + +  G  T++   + G P  +IQW KN
Sbjct: 3967 ELVIDSAQPGDAGSYTCFATNAVGQDSWTVKLSVHTHPVFVEL---LGDMALNRGERLLLACGASGIPQPKITWTFNNNIIPHYDQTNGRSELLVE-------RVSKGDTGTYTCVAENSVGTIKSLGF---VHVKPPIIDGDLHSNRVEPLGGNTILNCEVRGDPPPTIQWSKN 4128          

HSP 5 Score: 62.003 bits (149), Expect = 1.929e-9
Identity = 60/260 (23.08%), Postives = 115/260 (44.23%), Query Frame = 3
Query:  417 QKVKMK-FPKSATNAESDCEYVQILNQIAKSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTV-TIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEK 1190
            ++V M+ +P S  N++++   V ++  +  + P + S         PK T+ W++K          + ++ D+  ++ +  S      L I    + D   Y C+ S E   + K+++L V+ P++          L+V  +  V+ISC +YG+P P+I W    K+G+  +L N  +     YN + TI +    H G Y+C   N + G   +   L + + P I+     ++        +     G P  +I W+K
Sbjct: 3549 RRVDMQVYPPSIANSQTN---VTVIVNVQTTLPCEASG-------IPKPTVSWQKK---------GRTISTDQNQNMYLLSSG----SLVILAPTVEDTAVYTCVVSNEAGNNSKSIRLTVIPPSI----ADEPAELVVLRQSPVVISCTAYGVPKPSIHWS---KDGM--KLPNKGQ----GYNILPTISSAELSHAGRYSCTAKN-IAGSTQRHVPLTV-HLPVIQSHPSSLDVIFNTPITLPCKATGSPRPTITWQK 3770          

HSP 6 Score: 61.6178 bits (148), Expect = 3.080e-9
Identity = 47/175 (26.86%), Postives = 78/175 (44.57%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQ---GRETMIQAIINGHPINSIQWEKN 1193
            L+I + ++ D   Y+C  S       K   L V  P++    G     +   +   V + C + G+P P I+WY   + G  A L N +       + + I  V     G YTC V   V G   K+++LE+ Y P+I  G+D   + +    +  +++  + GHP  SI W K+
Sbjct: 1326 LRIKSARLGDQALYQCSVSNPAGKQSKDFNLIVYPPSI--KGGNLTTEVTALQDTTVNLECEARGVPLPTITWY---RKG-TAVLSNRQTQYVERGHFLKIPRVQATDAGQYTCKV-TSVAGSAEKNYELEV-YPPTIVRGDDGPTEKKVIVAKSLILECEVAGHPPPSITWLKD 1492          

HSP 7 Score: 60.8474 bits (146), Expect = 4.958e-9
Identity = 54/221 (24.43%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQL-LTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLV-PAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIE-QSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            PK  + W +  D + +T QH   +  D R              L+I +  +TD G Y C+  +   + +   K  V V P  IL    S +++ V  +  V ++C + GIP P ISW  +     N  +  +   + ++  +V + + +    G YTCIV N   G++ K+F L I   P +     V++ + + +  +       +P+  I+W K+  +L
Sbjct: 2122 PKPAVSWLK--DGRPITGQHGAKVLNDGRL-------------LQIRDADVTDTGRYTCV--SVNVVGQADSKYDVSVHPPSILGQVHSPENISVVVKNPVALTCEASGIPLPTISWLKD-----NQPIQTSSSVLILSGRSVRLMHTAVTDAGRYTCIVSNS-GGEERKNFDLVILVPPRVVAEGTVVDTKVKEKRNITLTCEASNPVPEIKWLKDGLLL 2319          

HSP 8 Score: 60.077 bits (144), Expect = 7.846e-9
Identity = 45/178 (25.28%), Postives = 79/178 (44.38%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQ-DHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG---NDVIEQSQGRETMIQAIINGHPINSIQWEKNSK 1199
            LKI++ ++ D G Y C  +       K   L V  P++    G+ +  HL V E   + + C   GIP P+++W  +++   + RL      I      + I +  +    +YTC+  +   G  SK + L++ Y PSI+ G    D I   +G    +     G P  ++ W K+ +
Sbjct: 1966 LKINSAQVQDSGRYTCEATNVAGKTEKNYNLDVWSPSI---RGSGEVSHLTVIEGNLISLVCELSGIPPPSLTWKKDFELKSDQRL-----RILSGGRQLQISSAQKADTAAYTCLASSAA-GATSKEYNLQV-YRPSIRRGEGETDDITVIKGGNITLDCAAEGVPKPAVSWLKDGR 2133          

HSP 9 Score: 55.4546 bits (132), Expect = 2.367e-7
Identity = 47/186 (25.27%), Postives = 77/186 (41.40%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGND-----VIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
            L++ +  + D G Y C+         K   L V  P++    G S +++       V +SC   G P P +SW ++        +  +   + +   T+ I        G YTC+  N   G+  K   L + + PSI+ GN      V+    G+   +Q   N  P  +I W KN ++L  SAN
Sbjct: 2698 LQVVSALVPDTGRYVCVAENVAGSSEKQFNLNVHPPSIF---GVSLENVTAVVNNFVSLSCEVTGFPPPTLSWLSD-----RGPIQASSNTLIMPGRTLQILKPKVSDGGKYTCVAMNAA-GEAYKHIHLTV-FPPSIR-GNSGDAPVVVNALVGKSITLQCESNAVPPPNIIWYKNGRVLTESAN 2872          

HSP 10 Score: 54.6842 bits (130), Expect = 3.410e-7
Identity = 48/231 (20.78%), Postives = 99/231 (42.86%), Query Frame = 3
Query:  705 DDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS--QGRETMIQAIINGHPINSIQW---------EKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSP 1364
            D G+Y C+ +     + +   L V  P ++  +G  +    V +   V I C + G P P+++W    KNGL   + ++ +   ++   V I  +     G YTC+  N+  G  +K + L++ + P +       + +  +G    +  + +G P+ +I W         E N ++LNL+      + +       ++ TGH+  +     +YN +      + L ++ P
Sbjct: 3076 DSGKYTCVATNAAGEEDRIFNLNVYPPVIVGNSGAPEHQTAVLD-SSVSIQCVAAGTPLPHLNWL---KNGLPLPVSSHVR--LLSAGQVLIMRIQVSDGGKYTCVASNRA-GVDNKHYNLQV-HPPGLDGAGSTEDVTVIRGNTASLLCVADGTPVPTISWLREDVPVLSEHNIRLLNLNTTLQISLAQ-------VNDTGHYTCK-----VYNTAGEASRHFNLKVLPP 3286          

HSP 11 Score: 54.6842 bits (130), Expect = 4.111e-7
Identity = 55/201 (27.36%), Postives = 84/201 (41.79%), Query Frame = 3
Query:  657 SNYVLM---ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKER---EKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKD--IFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSKILN 1208
            SN ++M    L+I   K++D G+Y C+         K + L V  P++    G S D  +V      + + + C S  +P PNI WY   KNG   R+     +  I      + I        G Y CI  N V G+  K+F L I + P I            RE++++ I N         G P  ++ W KN + +N
Sbjct: 2778 SNTLIMPGRTLQILKPKVSDGGKYTCVAMNAAGEAYKHIHLTVFPPSI---RGNSGDAPVVVNALVGKSITLQCESNAVPPPNIIWY---KNG---RVLTESANLQILAEGQILKIKTSEVSDTGQYVCIATN-VAGQVDKNFHLNI-HPPRI--------DGSVRESLVEIISNSVSFACDASGIPPPNLSWLKNGQPIN 2959          

HSP 12 Score: 53.5286 bits (127), Expect = 7.640e-7
Identity = 42/178 (23.60%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMG--NDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            LKI+  ++ D G Y+CL             L+V  P +   +  S   ++V E  K  + C + G+P P+++W    K+G    + +++  +      +++ +      G+YTC+  N   G+Q + ++L++ Y P+IK    N  +   Q  E + Q+  +  P  ++ W K+ + L
Sbjct: 1785 LKIERAQLLDAGVYKCLAVNLAGAAELLYSLQVFPPTI--SSRGSTVAVVVNEAAK--LECEASGVPLPSLTWL---KDGSPVAIVSHRTQVLSAGRVLSLSSAQISDTGTYTCVAINP-GGEQQREYELKV-YPPNIKGEEVNSTVMLGQSVELLCQS--DAIPPPTLSWRKDGRPL 1951          

HSP 13 Score: 53.1434 bits (126), Expect = 1.091e-6
Identity = 53/224 (23.66%), Postives = 96/224 (42.86%), Query Frame = 3
Query:  618 LTKDKRFSLKIYQSNYVL---MELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIIN---------GHPINSIQWEKNSKILNLSANKCFYIGRT 1244
            LT  K F LK  Q   +L    +L+I + +  D   Y CL S+      K   L+V  P++    G + D  ++K    + + C + G+P P +SW  + +       A++ N+ + + +    VT         G YTC+  N V G+    + + + + PSI      + Q    E +   + N         G P+ +I W K+++ +  S++     GR+
Sbjct: 2034 LTWKKDFELKSDQRLRILSGGRQLQISSAQKADTAAYTCLASSAAGATSKEYNLQVYRPSIRRGEGETDDITVIKG-GNITLDCAAEGVPKPAVSWLKDGRPITGQHGAKVLNDGRLLQIRDADVT-------DTGRYTCVSVNVV-GQADSKYDVSV-HPPSI------LGQVHSPENISVVVKNPVALTCEASGIPLPTISWLKDNQPIQTSSSVLILSGRS 2241          

HSP 14 Score: 52.7582 bits (125), Expect = 1.326e-6
Identity = 58/228 (25.44%), Postives = 93/228 (40.79%), Query Frame = 3
Query:  552 PKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVIL-PTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAII------NGHPINSIQWEKNSKILNLS 1214
            P  TI W RK        Q Q + +                 LKI  ++ TD G+Y C  ++      K  +L V  P ++    G ++  +IV   + +I+ C   G P P+I+W    K+G+  R   + + +F     V I + S   +GSY C+    + G +   + + +   P I   +DV     GR  +I + +       G P   I W KN K L  S
Sbjct: 1390 PLPTITWYRKGTAVLSNRQTQYVERGHF--------------LKIPRVQATDAGQYTCKVTSVAGSAEKNYELEVYPPTIVRGDDGPTEKKVIVA--KSLILECEVAGHPPPSITWL---KDGVPVRDGESVR-VFEQGKKVEIVSASTSDSGSYVCVA-TSIAGDKEVKYDVRV-LPPFIDGADDV----TGRTVLINSPVELECESTGTPAPVI-WFKNGKPLRQS 1590          

HSP 15 Score: 51.6026 bits (122), Expect = 3.346e-6
Identity = 43/188 (22.87%), Postives = 76/188 (40.43%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQD----HLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMI--------QAIINGHPINSIQWEKNSKIL 1205
            L+I   ++ D G Y CL S       +   L VL P +    G S D     +IV       + C     P   I+W    K+G+      N +   +   T+ I N    + G YTC+  N+  G+  K ++++++  P I   +    +   +E  +        + +    P  ++QW K+ +IL
Sbjct: 2334 LQISEAQVADTGRYSCLASNSAGDRSRHYNLNVLSPTI---AGNSPDFSAEEVIVTLSSPTSLVCEVQSYPPALITWL---KDGIQFESTRNVR--VLPGRTLQILNAKVENAGRYTCVATNEA-GETLKHYEVKVYVPPQINKNDISGHELSSKEVKVTINSTLTLECVAQAFPSPTLQWYKDGQIL 2512          

HSP 16 Score: 51.6026 bits (122), Expect = 3.403e-6
Identity = 43/187 (22.99%), Postives = 79/187 (42.25%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREK-VIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYI 1235
            L+I+  +++D  +Y C+ S       +   L V V     PT      ++    +K  ++ C   G+P P ++W    KNG  A L  N    F    ++ I +      G Y C+V N   G Q +   +++ Y PSI      +      +T +    +G P  ++ W+K  + ++   N+  Y+
Sbjct: 3433 LQINLSELSDTAQYTCVASNVAGKTTREFNLNVNVA----PTIKDGPQIVTVHVDKSAVLECVVNGVPPPRVTWR---KNG--AILGGNNPYTFEENGSLHIHSAQVSDTGRYLCLVTNPA-GTQRRRVDMQV-YPPSIANSQTNVTVIVNVQTTLPCEASGIPKPTVSWQKKGRTISTDQNQNMYL 3608          

HSP 17 Score: 51.6026 bits (122), Expect = 3.491e-6
Identity = 44/192 (22.92%), Postives = 81/192 (42.19%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRI--HNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRT 1244
            L+I   ++ D G Y C+   E   D     +RVL P +        D + V   +   + C+  G P+P ++W+       +++L +++    V  +  T+  VS +    G Y C+ +N V G   K F L + + PSI  +  + +         +   + G P  ++ W  +   +  S+N     GRT
Sbjct: 2604 LQIPRARLEDSGRYTCVAINEAGQDSIQYDVRVLPPVIREKDSDVPDEVTVLINQTAQLDCHVDGNPTPKVTWFK------DSQLISSEGPYRVLSSGRTLQVVSALVPDTGRYVCVAEN-VAGSSEKQFNLNV-HPPSIFGVSLENVTAVVNNFVSLSCEVTGFPPPTLSWLSDRGPIQASSNTLIMPGRT 2787          

HSP 18 Score: 50.447 bits (119), Expect = 6.430e-6
Identity = 48/188 (25.53%), Postives = 79/188 (42.02%), Query Frame = 3
Query:  699 ITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGN------DVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRT 1244
            +TD G Y C+ S     +RK   L +LVP  ++  GT  D   VKE+  + ++C +   P P I W    K+GL   + +    I  +   + I        G Y+C+  N   G +S+ + L +   P+I  GN      + +  +    T +   +  +P   I W K+      + N     GRT
Sbjct: 2249 VTDAGRYTCIVSNSGGEERKNFDLVILVPPRVVAEGTVVD-TKVKEKRNITLTCEASN-PVPEIKWL---KDGL-LLVPDRHHQILSHGRFLQISEAQVADTGRYSCLASNSA-GDRSRHYNLNV-LSPTIA-GNSPDFSAEEVIVTLSSPTSLVCEVQSYPPALITWLKDGIQFESTRNVRVLPGRT 2427          
BLAST of hmctn vs. Ensembl Medaka
Match: ntm (opioid-binding protein/cell adhesion molecule-like [Source:NCBI gene;Acc:101164539])

HSP 1 Score: 68.9366 bits (167), Expect = 3.344e-12
Identity = 56/232 (24.14%), Postives = 103/232 (44.40%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGN 1373
            +KIDN+ +TD+G+Y C   T       +V + V VP  I+    S D ++V E   V + C + G P P+ISW          +  +   D+  +   + I ++SR   G+Y C   N ++    ++  + + Y P++  G DV   + G+  +++   +  P    +W KN + +    +    I            TG      +QL  +N+S  D+ +Y  + ++  GN
Sbjct:  103 IKIDNVDMTDEGQYVCAVQTSSRPRTTSVHILVQVPPKII--NLSGD-IVVNEGSNVTLMCQASGKPEPSISW----------KFLSTSVDLVSDDEFLEIPSISRQRAGTYECTAVNNID-TDLQTLDIIVNYAPAVTEGRDV-GVAPGQYGVLECEADAVPEADFEWYKNDRRIFTGLDDLNII-----------NTGSL----SQLTFFNVSEGDYGNYTCVAINKIGN 304          
BLAST of hmctn vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 67.781 bits (164), Expect = 2.470e-11
Identity = 62/226 (27.43%), Postives = 102/226 (45.13%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYEC--LYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKERE---KVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILN 1208
            SP  TI+W+ K  K   +       KD R+  KI  + +    L+I  +K TD+G Y C         ID KT+K+ V V    LPT  ++   +    +     +++C++ G P P ++W  N     N  L    K  +  + + + I +V ++  G YTCI  NK  G++S+   L ++ +P I   N+        E ++    +G P  +I W   SKI  
Sbjct:  158 SPPPTIIWKHKGSKIQAS-------KDVRY--KIMANGH----LQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNV----LPTIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHN-----NVVLEEGDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKA-GEKSQEVSLNVFVQPKITYLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIFT 360          

HSP 2 Score: 55.0694 bits (131), Expect = 2.495e-7
Identity = 51/190 (26.84%), Postives = 82/190 (43.16%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTV----------TIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            EL I ++   D+G+Y C+   +     + V L V V   I       +   ++  E+VI++C + G P+P ISW +  K    G  A      K   ++ N V          T+ NV   + G Y CI  N + G+ S+S  LE+ Y P I+ G       +     +   ++ HP  S+ W K+   L
Sbjct:  282 ELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNVFVQPKIT---YLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQASWTRPDKYESLDRNIVVYSHARVSSLTLKNVQFTYAGQYLCIASNSI-GQDSQSVYLEVRYSPKIQ-GVVASYTWEKNPANLSCEVDAHPEASVVWFKDGSHL 466          
BLAST of hmctn vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 67.3958 bits (163), Expect = 2.835e-11
Identity = 62/225 (27.56%), Postives = 102/225 (45.33%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYS--TEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKERE---KVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            SP  TI+W+ K  K   +       KD R+  KI  + +    L+I  +K TD+G Y C         ID KT+K+ V V    LPT  ++   +    +     +++C++ G P P ++W  N     N  L    K  +  + + + I +V ++  G YTCI  NK  G++S+   L ++ +P I   N+        E ++    +G P  +I W   SKI 
Sbjct:   78 SPPPTIIWKHKGSKIQAS-------KDVRY--KIMANGH----LQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNV----LPTIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHN-----NVVLEEGDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKA-GEKSQEVSLNVFVQPKITYLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIF 279          

HSP 2 Score: 56.6102 bits (135), Expect = 7.476e-8
Identity = 48/188 (25.53%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  651 YQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNY---NTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            Y  N    EL I ++   D+G+Y C+   +     + V L V V   I       +   ++  E+VI++C + G P+P ISW +  K         ++  +  ++   +++T+ NV   + G Y CI  N + G+ S+S  LE+ Y P I+ G       +     +   ++ HP  S+ W K+   L
Sbjct:  194 YSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNVFVQPKIT---YLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQSLDRNIVVYSHARVSSLTLKNVQFTYAGQYLCIASNSI-GQDSQSVYLEVRYSPKIQ-GVVASYTWEKNPANLSCEVDAHPEASVVWFKDGSHL 376          
BLAST of hmctn vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 67.3958 bits (163), Expect = 3.109e-11
Identity = 62/225 (27.56%), Postives = 102/225 (45.33%), Query Frame = 3
Query:  549 SPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYS--TEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKERE---KVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            SP  TI+W+ K  K   +       KD R+  KI  + +    L+I  +K TD+G Y C         ID KT+K+ V V    LPT  ++   +    +     +++C++ G P P ++W  N     N  L    K  +  + + + I +V ++  G YTCI  NK  G++S+   L ++ +P I   N+        E ++    +G P  +I W   SKI 
Sbjct:   78 SPPPTIIWKHKGSKIQAS-------KDVRY--KIMANGH----LQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNV----LPTIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHN-----NVVLEEGDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKA-GEKSQEVSLNVFVQPKITYLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIF 279          

HSP 2 Score: 54.299 bits (129), Expect = 3.606e-7
Identity = 53/198 (26.77%), Postives = 84/198 (42.42%), Query Frame = 3
Query:  651 YQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWK---NGLNARLYNNKKDIFVNYNTV----------TIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            Y  N    EL I ++   D+G+Y C+   +     + V L V V   I       +   ++  E+VI++C + G P+P ISW +  K    G  A      K   ++ N V          T+ NV   + G Y CI  N + G+ S+S  LE+ Y P I+ G       +     +   ++ HP  S+ W K+   L
Sbjct:  194 YSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNVFVQPKIT---YLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQASWTRPDKYESLDRNIVVYSHARVSSLTLKNVQFTYAGQYLCIASNSI-GQDSQSVYLEVRYSPKIQ-GVVASYTWEKNPANLSCEVDAHPEASVVWFKDGSHL 386          
BLAST of hmctn vs. Planmine SMEST
Match: SMESG000006452.1 (SMESG000006452.1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 295/298 (98.99%), Postives = 295/298 (98.99%), Query Frame = 3
Query:  534 LQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            L   FSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW
Sbjct:  116 LNNNFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 413          

HSP 2 Score: 102.449 bits (254), Expect = 9.702e-23
Identity = 52/57 (91.23%), Postives = 52/57 (91.23%), Query Frame = 2
Query: 1427 GYLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGESNYLNY 1597
             YLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGE   L Y
Sbjct:  415 SYLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGEKKELEY 471          
BLAST of hmctn vs. Planmine SMEST
Match: SMESG000006452.1 (SMESG000006452.1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 288/288 (100.00%), Postives = 288/288 (100.00%), Query Frame = 3
Query:  564 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 1427
            IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW
Sbjct:  120 IVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKIIEFKPINHDSW 407          

HSP 2 Score: 102.449 bits (254), Expect = 9.150e-23
Identity = 52/57 (91.23%), Postives = 52/57 (91.23%), Query Frame = 2
Query: 1427 GYLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGESNYLNY 1597
             YLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGE   L Y
Sbjct:  409 SYLSIANDYRKLLNTHKNKKAIDSNIESNKAIYFQNQKQNLNKSLFINFGEKKELEY 465          
BLAST of hmctn vs. Planmine SMEST
Match: SMESG000067482.1 (SMESG000067482.1)

HSP 1 Score: 102.449 bits (254), Expect = 4.328e-23
Identity = 81/305 (26.56%), Postives = 144/305 (47.21%), Query Frame = 3
Query:  534 LQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLK---IYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG--------LNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYI-GRTKKYCFYLDKTGH---FQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI 1394
            ++L  +    + W  K+ ++ LT     +T D RF      I  +N  +  L I+ +K +D+GEY C    +  I  K V L V VPA I P    +  + V++  K+ + CN+ G P P + WY+   +         LNA  +  ++     ++   +  +SR+H    G Y C+ +NKVE +    F+L + ++P I M N  I Q    +T+I+ ++   P+ +++W  N++ +N     C  +  R+ KYC   ++  H         +L I+NL   D+  Y   + +  G  +G TK+
Sbjct:   56 IKLNLTDYNNVTWM-KVPRRLLTRGIYRVTPDTRFRFNFQGILDNN--MFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPP--LKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKFKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKIN--PFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKL 353          
BLAST of hmctn vs. Planmine SMEST
Match: SMESG000067482.1 (SMESG000067482.1)

HSP 1 Score: 102.064 bits (253), Expect = 6.244e-23
Identity = 81/305 (26.56%), Postives = 144/305 (47.21%), Query Frame = 3
Query:  534 LQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLK---IYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG--------LNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYI-GRTKKYCFYLDKTGH---FQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI 1394
            ++L  +    + W  K+ ++ LT     +T D RF      I  +N  +  L I+ +K +D+GEY C    +  I  K V L V VPA I P    +  + V++  K+ + CN+ G P P + WY+   +         LNA  +  ++     ++   +  +SR+H    G Y C+ +NKVE +    F+L + ++P I M N  I Q    +T+I+ ++   P+ +++W  N++ +N     C  +  R+ KYC   ++  H         +L I+NL   D+  Y   + +  G  +G TK+
Sbjct:   40 IKLNLTDYNNVTWM-KVPRRLLTRGIYRVTPDTRFRFNFQGILDNN--MFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPP--LKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKFKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKIN--PFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKL 337          
BLAST of hmctn vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.074e-11
Identity = 48/173 (27.75%), Postives = 78/173 (45.09%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHN---GSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQW 1184
            ++KI N+K  D GE  C       ID   +KL  +    IL    +++  I  E ++  + C++ G+P P I+W        N        +I +N  T+   +++RI     G + C+  N   G   KSF L+I + P IK     I+ S G    I+  + GHP   ++W
Sbjct:  689 QIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKE--IPLEGDQQTVRCSANGVPQPKITWE------FNGSPVTIDGNIIIN-ETIGTLDINRIEKNMKGQWVCVATNNA-GSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGHPPPRVKW 851          

HSP 2 Score: 57.3806 bits (137), Expect = 3.839e-8
Identity = 55/238 (23.11%), Postives = 106/238 (44.54%), Query Frame = 3
Query:  675 ELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV---IEQSQGRETMIQAIINGHPINSIQWEKNSKILN-LSANKCFYIGRTKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNI 1376
            +L + N + +D G Y+CL S +  +D++   + +++P  I     +  H  V     + + C S G P P I W    K+G  +R+   +  +  +   +T+ +      G Y CI +N   G+   SF +++ Y P++  G      +E++ G   +++ +++G P  +I W K+   +N L + +   IG +K                 QL I  + A D   Y  +  + FG +
Sbjct: 1718 QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQ-VALGGNLYLFCVSEGRPKPKIEWR---KDG--SRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAEN-THGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK-----------------QLEIIAMQASDAGRYSCVAKNTFGQM 1931          

HSP 3 Score: 55.4546 bits (132), Expect = 1.421e-7
Identity = 49/188 (26.06%), Postives = 87/188 (46.28%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQA---IINGHPINSIQWEKNSKILNLSANKCFY 1232
            L+I + K  D G Y C  + +   D K+V + ++ P  I    + +  ++V+  E+V++ C   G     I WY    N +++ +    +  F++   + I  V + H+G Y C+ +N   G Q     LE+  +P I    +  E +    T++Q    I+ G P   I WE+N   + LS  K +Y
Sbjct: 2487 LEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIE---SPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQ--FLSEQGLIIDRVRKDHSGVYRCVANNDA-GYQEIRITLEVLVQPKIFRPTET-ETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYY 2665          

HSP 4 Score: 55.4546 bits (132), Expect = 1.600e-7
Identity = 50/228 (21.93%), Postives = 93/228 (40.79%), Query Frame = 3
Query:  531 TLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFS-LKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCN--SYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYN---TVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDVIEQS----QGRETMIQAIINGHPINSIQW 1184
            + + T  P  T++W R+        + ++L   +R+    I + N V+   +I N++  D   Y C  +       K  ++ V++P  I+      ++  VKE  ++   C+  +Y +  P I W        N+ +     D ++ +N   ++TI N     +G YTC   N + G+ S +F L +   P       +  ++     G     Q    G P  SI W
Sbjct: 2164 SCECTGYPPPTLLWYRQ--------EQEILADKERYPKFDILRGNSVM---QITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKE-----NSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKN-LAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMW 2374          

HSP 5 Score: 53.1434 bits (126), Expect = 8.036e-7
Identity = 46/180 (25.56%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  687 DNLKITDDGEYECLYSTEKYIDRKTVKLRV-LVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIW------YEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKIL 1205
            ++LKI D+G   C+       DR T ++ V L+P V LP   + D     E   V I C   G P P ++W    K+G + +     +  F + N + I+++     G+Y CI +       + S  L I+      Y+P +K   +V+++++ +    +A    HP   I+W  N + +
Sbjct: 2676 NSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGD-----EGSSVTIICKVEGKPKPTVTWK---KDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLK---NVVQETRWKSFRCEA--TSHPKPDIKWMFNGRAI 2842          

HSP 6 Score: 51.9878 bits (123), Expect = 1.558e-6
Identity = 53/195 (27.18%), Postives = 88/195 (45.13%), Query Frame = 3
Query:  609 HQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKK-DIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIK--MGNDVIEQSQGRETMIQAIINGHPINSIQW 1184
            ++ L KD RF + +  S   L E+K       D G Y+CL       +     L VL+   IL   +S+  + + E   + I+C S G P+P   WY +     N++L +  + +I     T+ I  V R  +  Y C V N+  G+  K+F + ++  PSI      +  E  +G  T +   ++G P   I+W
Sbjct: 1428 YKSLPKD-RFKISLDGSTLTLFEVKH-----LDSGIYKCL--AINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKD-----NSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEA-GEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW 1608          

HSP 7 Score: 49.6766 bits (117), Expect = 8.731e-6
Identity = 55/233 (23.61%), Postives = 90/233 (38.63%), Query Frame = 3
Query:  534 LQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFSLKIYQSNYVLMELKIDNLKITDD--GEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCN-SYGIPSPNISWYANWKNGLNARLYNNKKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSIKMGNDV-IEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSAN 1220
             Q    PK  I WR+      +    +++       L +Y               IT++  G + C  + +     K  K+ V  P  I   G S     +  +E V ++C  + G PSP I WY   KNG        + +I    N + ++  +    GSY C   N+V    S+ F++ I   P       + I   +G +  +   I+G P  + +W   S IL+L  N
Sbjct: 1028 CQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYS--------------ITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYE--IGSKENVELNCIITSGNPSPKIEWY---KNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVS-SDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRN 1240          

HSP 8 Score: 49.6766 bits (117), Expect = 9.668e-6
Identity = 42/179 (23.46%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  678 LKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNNKKDIF-VNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI-KMGNDVIEQSQGRETMIQAII-NGHPINSIQWEKNSKIL 1205
            L I  +K  D+  Y C+   +    +  ++L V    +I+  G  +  +  K+ + +++ C + G P P I W    K G    +    + +   + + +T+++++  H G++TC   N       K FK+ +   P I K G    E        +  II +G+P   I+W KN + L
Sbjct:  970 LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII--GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWR---KGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATND-HAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL 1142          
The following BLAST results are available for this feature:
BLAST of hmctn vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN13.881e-1326.82hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
HMCN27.535e-1225.14hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
NEGR14.076e-1127.78neuronal growth regulator 1 [Source:HGNC Symbol;Ac... [more]
HMCN26.441e-1025.43hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
HMCN27.838e-1025.33hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
back to top
BLAST of hmctn vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rig-59.122e-1124.18NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-59.937e-1124.18NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-51.027e-1024.34NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-51.446e-1024.34NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
him-42.674e-1022.16High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of hmctn vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIP-eta2.106e-2125.89gene:FBgn0031725 transcript:FBtr0343246[more]
DIP-eta2.106e-2125.89gene:FBgn0031725 transcript:FBtr0302933[more]
DIP-iota7.535e-1826.64gene:FBgn0031837 transcript:FBtr0113026[more]
DIP-theta1.318e-1725.27gene:FBgn0051646 transcript:FBtr0079114[more]
DIP-delta1.015e-1624.91gene:FBgn0085420 transcript:FBtr0333611[more]
back to top
BLAST of hmctn vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn25.045e-1326.90hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
hmcn11.740e-1228.34hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn11.740e-1228.34hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
boc3.454e-1022.93BOC cell adhesion associated, oncogene regulated [... [more]
cadm2b5.562e-1022.98cell adhesion molecule 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of hmctn vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eftud22.862e-1328.49elongation factor Tu GTP binding domain containing... [more]
eftud22.911e-1328.49elongation factor Tu GTP binding domain containing... [more]
ENSXETT00000036915.12.235e-1224.89hemicentin 2 [Source:NCBI gene;Acc:100490941][more]
eftud25.022e-1224.31elongation factor Tu GTP binding domain containing... [more]
ENSXETT00000024069.11.707e-1024.89hemicentin 2 [Source:NCBI gene;Acc:100490941][more]
back to top
BLAST of hmctn vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn15.783e-1327.49hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn15.790e-1327.49hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Ncam19.906e-1126.36neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam11.163e-1025.91neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam11.348e-1025.91neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
back to top
BLAST of hmctn vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24372|LACH_DROME1.703e-1428.02Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac... [more]
sp|P15364|AMAL_DROME8.373e-1324.88Protein amalgam OS=Drosophila melanogaster OX=7227... [more]
sp|Q96RW7|HMCN1_HUMAN1.864e-1226.82Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|D3YXG0|HMCN1_MOUSE4.050e-1227.49Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|Q26474|LACH_SCHAM8.054e-1223.94Lachesin OS=Schistocerca americana OX=7009 GN=LAC ... [more]
back to top
BLAST of hmctn vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5WES34.896e-15299.07Hmctn (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A419Q3061.203e-5031.83Opioid-binding protein/cell adhesion molecule-like... [more]
H2KUX21.783e-5029.71Opioid-binding protein/cell adhesion molecule homo... [more]
A0A4S2LSS57.785e-5031.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0R3WAJ25.734e-4832.86Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of hmctn vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033537.11.614e-1126.90pep primary_assembly:Astyanax_mexicanus-2.0:6:2764... [more]
ncam22.849e-1027.32neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam23.233e-1027.32neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam23.932e-1027.32neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam1b3.963e-1026.79neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of hmctn vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
neo1b2.202e-826.77neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
ENSPMAT00000005303.14.286e-822.54pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1... [more]
ENSPMAT00000008186.13.988e-623.22pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
nfasca7.589e-622.94neurofascin homolog (chicken) a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of hmctn vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hmctn vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO303501.477e-1128.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453836.830e-925.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320028.058e-927.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274771.939e-826.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447773.765e-726.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of hmctn vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn11.551e-1223.11hemicentin 1 [Source:NCBI gene;Acc:101172646][more]
ntm3.344e-1224.14opioid-binding protein/cell adhesion molecule-like... [more]
ncam1a2.470e-1127.43neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ncam1a2.835e-1127.56neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ncam1a3.109e-1127.56neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
back to top
BLAST of hmctn vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006452.19.702e-2398.99SMESG000006452.1[more]
SMESG000006452.19.150e-23100.00SMESG000006452.1[more]
SMESG000067482.14.328e-2326.56SMESG000067482.1[more]
SMESG000067482.16.244e-2326.56SMESG000067482.1[more]
SMESG000021248.14.074e-1127.75SMESG000021248.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010595
GenBankAGS83416.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010595 ID=SMED30010595|Name=hmctn|organism=Schmidtea mediterranea sexual|type=transcript|length=1969bp
CGGATAACAGCGAGATTTCTATCTCCCGTGTCATCGTTAACCGGGAGACG
GGAGATTAATGTCTATTCAGGGAGACTCCCGACAAGAACGAGAGAATTGG
CAAGCCTATATGCAATGGCGGACAACAATACGTATTTGTATTCATTTTAC
ATCGGTTTCAGACATTTATAGCACATTTTTCATATAAATTTATATTGAAA
TTATTTTTTGTATATCCCAGTCAACAATGAAACTATTTCCAGGATGCAAA
ATATTATTCGAAGAATTCAAAAAGACTGAATAGCATAAATGAAGACAATT
TGGACACTAATTCAAATATTAATGATTTCGACATATCTAACATGGAGAAA
TTGAAGATGAGATTGAAGTACGAGATATTGAGCAAAGTGAAGAAGATGAA
TATAAAAGTGAAGATTCAAAAAGTGAAGATGAAATTTCCCAAAAGCGCCA
CAAACGCAGAAAGCGATTGCGAATATGTACAGATACTGAATCAGATAGCC
AAATCGAAACCGAAAAAAGACAGCAGAAGGACTTTGCAGTTAACGTTTTC
TCCTAAAACTACTATCGTTTGGAGGAGGAAAATGGACAAACAGTACTTGA
CATTTCAGCATCAATTATTAACGAAAGACAAAAGATTTTCTCTGAAAATT
TATCAGTCTAATTATGTTTTAATGGAATTAAAAATAGATAATCTTAAAAT
AACAGACGATGGAGAATATGAGTGTTTATATAGCACGGAAAAATACATTG
ATAGGAAAACAGTAAAGCTAAGAGTATTAGTTCCAGCTGTTATACTTCCA
ACAGGAACTTCACAGGATCATTTGATTGTTAAAGAAAGAGAAAAAGTCAT
TATATCGTGCAATTCCTACGGTATTCCGTCGCCCAATATTTCTTGGTATG
CCAATTGGAAAAATGGGCTGAATGCTAGATTATACAATAATAAAAAAGAT
ATTTTCGTAAACTATAACACAGTTACAATTTTTAACGTTTCCCGAATTCA
TAACGGTTCATACACTTGCATCGTTGACAACAAAGTTGAGGGTAAGCAGT
CAAAATCTTTCAAATTAGAAATATGGTATGAACCTTCTATCAAAATGGGC
AATGATGTCATTGAACAGTCCCAAGGACGCGAAACCATGATTCAGGCAAT
AATAAACGGTCACCCTATAAATTCCATTCAATGGGAAAAGAATTCTAAGA
TTTTGAATCTGAGTGCCAATAAATGCTTTTATATTGGTAGGACTAAGAAG
TATTGTTTTTATTTAGATAAAACTGGTCACTTCCAGGAACAGAAAGCTCA
ATTATGGATCTATAATCTTTCAGCAATTGATTTCACCTCTTATCGGTTGT
TGATCGTCTCACCTTTCGGAAACATATTTGGAACTACCAAGATTATAGAA
TTCAAACCGATAAATCATGATTCATGGGTTATTTGAGCATCGCAAATGAT
TATAGGAAACTTTTGAATACTCACAAAAACAAAAAAGCTATTGACAGTAA
TATAGAAAGTAATAAAGCCATCTACTTTCAAAATCAAAAGCAAAACCTAA
ACAAATCTTTATTTATCAATTTTGGAGAAAGTAATTATTTAAATTATTAA
CTTTGTTATATTCTACGTTAAAATTTACGAAGAATGTTGGTGGATACATA
ATTTAAGAATAAGAAGCAGTTTTGCGAGTGAACTATTGCGTGTCACCAAA
GGTTTAATCGTTTATTTGATCGATATTAGTTATATGCATATTCAAAACTT
ATTTTGTCTAATAATCGCATCACAGAATCGACTGTACTACATTGTCCCTA
TGCAGCCGACCACTAATAAAGCTTCATTAAAGATTTTGAATTTAAAACTT
AAAAGAGGCAGAAGCCATTGAATTTAAGCTAAATTAGTTATTAGTTAAGT
TTAAATTAATATATAAATTTTATTTTTTAAATCTTTTAATTTTATTCTTG
TTTTCTTTATGGGCCGCCC
back to top

protein sequence of SMED30010595-orf-1

>SMED30010595-orf-1 ID=SMED30010595-orf-1|Name=SMED30010595-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MEKLKMRLKYEILSKVKKMNIKVKIQKVKMKFPKSATNAESDCEYVQILN
QIAKSKPKKDSRRTLQLTFSPKTTIVWRRKMDKQYLTFQHQLLTKDKRFS
LKIYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAV
ILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNGLNARLYNN
KKDIFVNYNTVTIFNVSRIHNGSYTCIVDNKVEGKQSKSFKLEIWYEPSI
KMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYIGR
TKKYCFYLDKTGHFQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTK
IIEFKPINHDSWVI*
back to top
Aliases
The feature 'hmctn' has the following synonyms
Synonym
hmctn
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000481serotonergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0042995cell projection
GO:0044295axonal growth cone
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030426growth cone
Vocabulary: biological process
TermDefinition
GO:0045773positive regulation of axon extension
GO:0060536cartilage morphogenesis
GO:0007155cell adhesion
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0010628positive regulation of gene expression
GO:0030154cell differentiation
GO:0031103axon regeneration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 54..146
e-value: 0.37
score: 19.8
coord: 158..245
e-value: 4.7E-6
score: 36.1
NoneNo IPR availablePFAMPF13927Ig_3coord: 158..230
e-value: 1.0E-10
score: 42.1
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 32..321
e-value: 2.4E-14
score: 50.1
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 73..354
NoneNo IPR availablePANTHERPTHR12231:SF105coord: 73..354
NoneNo IPR availableCDDcd00096Igcoord: 169..241
e-value: 1.17763E-9
score: 52.2444
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 52..150
e-value: 2.3E-12
score: 48.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 154..245
e-value: 7.7E-14
score: 53.5
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 148..243
score: 11.188
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 159..251
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 244..351
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 70..148