Wnt11-2

Overview
NameWnt11-2 (ACJ64866.1)
Smed IDSMED30010593
Length (bp)1651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Wnt11-2 (SMED30010593) t-SNE clustered cells

Violin plots show distribution of expression levels for Wnt11-2 (SMED30010593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Wnt11-2 (SMED30010593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Wnt11-2 (SMED30010593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal midlineSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 dd_Smed_v4_16209_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 dd_Smed_v4_16209_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30010593SMESG000074928.1 SmedASXL_014750SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior muscle cellSMED30010593SMESG000074928.1 dd_Smed_v4_16209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010593SMESG000074928.1 dd_Smed_v4_16209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30010593SMESG000074928.1 dd_Smed_v6_16209_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
posterior poleSMED30010593SMESG000074928.1 dd_Smed_v6_16209_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30010593SMESG000074928.1 OX_Smed_1.0.01500ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
posterior poleSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30010593SMESG000074928.1 FJ463751smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Wnt11-2 vs. Ensembl Human
Match: WNT4 (Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:12783])

HSP 1 Score: 147.902 bits (372), Expect = 3.073e-39
Identity = 99/341 (29.03%), Postives = 160/341 (46.92%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ + LP  GK +  GT+E A V+A SSA + F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R+K     + +  +N HN EAG +  L + ++ CKCHGVSG C  + C+R         + + L++++  A  V+     S  A  P      + KP +  DL + E SPDFCE D  +G +GT GR C   N +  + + C  +CCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   48 GLIQRQVQMCK--RNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRT----VHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVR----------------------ERSKGASSSRAL--MNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR--AVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVP---RNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTC---NKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC 350          
BLAST of Wnt11-2 vs. Ensembl Human
Match: WNT2 (Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:12780])

HSP 1 Score: 141.739 bits (356), Expect = 8.413e-37
Identity = 102/344 (29.65%), Postives = 148/344 (43.02%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAER-LPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLF--AGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL   Q + C   +H   M  + +        C   F+  RWNC++ +R     G+ L   ++E A V+A SSA ++F I R C+Q ++  CSC   +P         K +F   GC DN++ G+++ R F                         E++ K  + L     +N HN  AG +      K  CKCHGVSG C  R C+         +        YL  KY   +          F  + ER K  ++ DL + E+SPD+C  D   GS+GT GRVC   N +    + C  MCCGRG+ T    + TKCGC       ++C DC   +    C
Sbjct:   46 GLVSSQRQLCH--RHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSC---DPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVD---------------------AKERKGKDARAL-----MNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCW-------LAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVC---NLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTC 348          
BLAST of Wnt11-2 vs. Ensembl Human
Match: WNT3 (Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:12782])

HSP 1 Score: 138.658 bits (348), Expect = 9.475e-36
Identity = 97/340 (28.53%), Postives = 148/340 (43.53%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSD-------DSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ + G+   R+F                        A+ R   + +      +N HN EAG    LD+  + CKCHG+SG C  + C+                  +L  KY D  S+       +S    +         KP ++ DL + E+SP+FCEP+P TGS GT  R C   N +    + C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSH----HKGPPGEGWKWGGCSEDADFGVLVSREF------------------------ADAR---ENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCW-------WAQPDFRAIGDFLKDKY-DSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Ensembl Human
Match: WNT3 (Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:12782])

HSP 1 Score: 138.658 bits (348), Expect = 9.475e-36
Identity = 97/340 (28.53%), Postives = 148/340 (43.53%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSD-------DSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ + G+   R+F                        A+ R   + +      +N HN EAG    LD+  + CKCHG+SG C  + C+                  +L  KY D  S+       +S    +         KP ++ DL + E+SP+FCEP+P TGS GT  R C   N +    + C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSH----HKGPPGEGWKWGGCSEDADFGVLVSREF------------------------ADAR---ENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCW-------WAQPDFRAIGDFLKDKY-DSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Ensembl Human
Match: WNT3 (Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:12782])

HSP 1 Score: 138.658 bits (348), Expect = 9.475e-36
Identity = 97/340 (28.53%), Postives = 148/340 (43.53%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSD-------DSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ + G+   R+F                        A+ R   + +      +N HN EAG    LD+  + CKCHG+SG C  + C+                  +L  KY D  S+       +S    +         KP ++ DL + E+SP+FCEP+P TGS GT  R C   N +    + C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSH----HKGPPGEGWKWGGCSEDADFGVLVSREF------------------------ADAR---ENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCW-------WAQPDFRAIGDFLKDKY-DSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 137.502 bits (345), Expect = 8.603e-36
Identity = 106/343 (30.90%), Postives = 159/343 (46.36%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRL-NGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSL-VAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL   Q + C   +    M  V   ++ A+  C + F   RWNCS+      +G   +  T+E A  +A  SA +  EI RRC Q  +   SCG S+ T  + +  +   + GC DNVE G ++ R F                       + EK    ++     + L N  N EAG +I   ++K  CKCHGVSG CN + C+ Q      + +  +LR +Y  A  V I    +L + AD    ++ER      TDL F + SPD+C  D  +G++GT GRVCK         E C ++CCGRG+ T  ++ ++KC C  +   K+ C  C +  +   C
Sbjct:   50 GLSPGQAQVCELFKDH--MPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLT--SCGCSDETKPKNVPTD-WSWGGCGDNVEYGYKFSRDFID---------------------IREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQ--LPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADE--ATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCK---RGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDIC 359          
BLAST of Wnt11-2 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 130.954 bits (328), Expect = 2.857e-33
Identity = 95/356 (26.69%), Postives = 159/356 (44.66%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCS-----SAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPI---------SQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            GL +RQ +FC   ++   M  V   S AA   C   F  RRWNC+     + E +P +   L   T+E A VHA SSA++ +++ R CA+     C C  S    N    + +  + GC DNV+ G+   ++F    +      K+                  Q     +  +N HN +AG ++   + +  CKCHG+SG C  R C+      +   +   ++ ++  A  V ++ +D +          E+P+ +         +  DL +   SPDFCE DP  G +GT GR C     +  + + C+ +CCGRG+   ++    KC C      +++C+ C   ++ + CL
Sbjct:   47 GLTRRQMRFCK--KNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVF--LYENTRESAFVHAISSAAVAYKVTRDCARGISERCGCDYSK---NDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLL--------GPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCW--DSLPNFRHIGMAIKDKFDGAAEVKVVKEDGI----------EKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQC---TLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQKRIEKYLCL 372          
BLAST of Wnt11-2 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 122.094 bits (305), Expect = 5.188e-30
Identity = 100/407 (24.57%), Postives = 166/407 (40.79%), Query Frame = 3
Query:  426 YFVIILSFLMDENYSIRWLGISRYTRPE--NQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLP---------YIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTS------NPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSE--ERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            Y  + L+F+   +Y           RP   + + E F  L  R + LN   Q       L  ++ +++  V R  + A+  C   F+  RWNCSS + +           +GK L S  +E A ++A  +AS++  I + C    +  C C +          ++  +++++  + GC DNV  G+ Y +KF    +                       A+  K       +  HN   G      N +  C+CHGVSG C  + C+ Q+++              L  +Y       +  A       E  ER  P+   ++A+   SP +CE + T G +GT GR C     +  S+E C  +CCGRG+ T LE ++T+C C      +++C  C   V    C
Sbjct:   33 YNWLTLAFVGSNDY---------LPRPHYHSTDREHFKELCRRLDGLNPNQQA------LCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWET----------------------AQFDKTKNVAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQV-------SDLLKKRYDHFAVQVTRKATKRLRRKERTERKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGRECIH---NSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTC 392          
BLAST of Wnt11-2 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 107.842 bits (268), Expect = 2.559e-25
Identity = 97/373 (26.01%), Postives = 157/373 (42.09%), Query Frame = 3
Query:  531 SPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKD-LESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEIT--------QEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQT----------DLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            SP+ C+  N+  GL  +Q + C   ++   +  ++   ++A+  C  TFQ   WNC+    LP +G   L+  ++E A V+A S+A +   +AR C++  +  C CG + P  +  +             ++AGC DNV+ G  + RKF   +                  +  E R++M          N HN   G R+ ++     CKCHGVSG C  + C++       D   + L ++Y  AK V        V + P  GS  R +  ++           +L + + SP++C  D      G                E+C N+CCGRG RT  E     C C      +++C  C   V+  YCL
Sbjct:   41 SPILCK--NV-PGLTPQQKRMCH--ENPNIIKYLISGLRSALHTCEYTFQREAWNCTLT--LPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGET-PQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYD---------------RQHATEPRSQM----------NLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWK--VMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVKDRECG----------------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYCL 362          
BLAST of Wnt11-2 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 107.842 bits (268), Expect = 2.559e-25
Identity = 97/373 (26.01%), Postives = 157/373 (42.09%), Query Frame = 3
Query:  531 SPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKD-LESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEIT--------QEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQT----------DLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            SP+ C+  N+  GL  +Q + C   ++   +  ++   ++A+  C  TFQ   WNC+    LP +G   L+  ++E A V+A S+A +   +AR C++  +  C CG + P  +  +             ++AGC DNV+ G  + RKF   +                  +  E R++M          N HN   G R+ ++     CKCHGVSG C  + C++       D   + L ++Y  AK V        V + P  GS  R +  ++           +L + + SP++C  D      G                E+C N+CCGRG RT  E     C C      +++C  C   V+  YCL
Sbjct:   41 SPILCK--NV-PGLTPQQKRMCH--ENPNIIKYLISGLRSALHTCEYTFQREAWNCTLT--LPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGET-PQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYD---------------RQHATEPRSQM----------NLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWK--VMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVKDRECG----------------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYCL 362          
BLAST of Wnt11-2 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 96.6709 bits (239), Expect = 1.512e-21
Identity = 82/320 (25.62%), Postives = 136/320 (42.50%), Query Frame = 3
Query:  663 CMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGT---SNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDS----LVAADPFGGSEERPKPI----SQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            C   F+  RWNCS   +       + + ++E A  +A +SA   + +   CA+  ++ C C     + PT       E   + GC  +V+ G+ Y R+F    +L                   E+ ++          +N HN  AG  +     +  CKCHGVSG C  + C++ +          +L  +Y  AK V  +        +++     G+    KP+     + +L + E SP++CE    TGS GT GR C+       S   C  +CCGRGH T   ++ T+C C      +++CD+C  + + F C
Sbjct:   65 CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGG-TPDEPWKWGGCSADVDFGMRYARRFMDAREL-------------------ERDSRTL--------MNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLML--KYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQS---CDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351          
BLAST of Wnt11-2 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 96.2857 bits (238), Expect = 4.550e-21
Identity = 64/242 (26.45%), Postives = 107/242 (44.21%), Query Frame = 3
Query:  867 NQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            N +  + +  + GC DNV  GL + R F                       +  K+ + +  L  + +   HN  AG     D  ++ CKCHG+SG C  + C+ +        +   LR +Y SA+ V + +D      + F       +P ++  L F + SPDFC P+  TG++GT GR C   N + + ++ C  +CC RGH   + +++T C C      ++ C+ C  +     CL
Sbjct:  214 NIKFPEGQWEWGGCSDNVNFGLRHSRVF-----------------------LDAKQRQRRSDLGTLVKF--HNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLK--MPPFREVAGRLRDRYDSARKVTLRND-----GNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGREC---NVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL 420          
BLAST of Wnt11-2 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 96.2857 bits (238), Expect = 4.550e-21
Identity = 64/242 (26.45%), Postives = 107/242 (44.21%), Query Frame = 3
Query:  867 NQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            N +  + +  + GC DNV  GL + R F                       +  K+ + +  L  + +   HN  AG     D  ++ CKCHG+SG C  + C+ +        +   LR +Y SA+ V + +D      + F       +P ++  L F + SPDFC P+  TG++GT GR C   N + + ++ C  +CC RGH   + +++T C C      ++ C+ C  +     CL
Sbjct:  214 NIKFPEGQWEWGGCSDNVNFGLRHSRVF-----------------------LDAKQRQRRSDLGTLVKF--HNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLK--MPPFREVAGRLRDRYDSARKVTLRND-----GNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGREC---NVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL 420          
BLAST of Wnt11-2 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 94.3597 bits (233), Expect = 6.247e-21
Identity = 82/320 (25.62%), Postives = 136/320 (42.50%), Query Frame = 3
Query:  663 CMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGT---SNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDS----LVAADPFGGSEERPKPI----SQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            C   F+  RWNCS   +       + + ++E A  +A +SA   + +   CA+  ++ C C     + PT       E   + GC  +V+ G+ Y R+F    +L                   E+ ++          +N HN  AG  +     +  CKCHGVSG C  + C++ +          +L  +Y  AK V  +        +++     G+    KP+     + +L + E SP++CE    TGS GT GR C+       S   C  +CCGRGH T   ++ T+C C      +++CD+C  + + F C
Sbjct:   38 CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGG-TPDEPWKWGGCSADVDFGMRYARRFMDAREL-------------------ERDSRTL--------MNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLML--KYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQS---CDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 324          
BLAST of Wnt11-2 vs. Ensembl Fly
Match: wg (gene:FBgn0284084 transcript:FBtr0079432)

HSP 1 Score: 84.7297 bits (208), Expect = 3.489e-17
Identity = 59/245 (24.08%), Postives = 110/245 (44.90%), Query Frame = 3
Query:  477 WLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS---AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTS----NPTANQEITQ----EKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICY 1178
            W GI++   P N      +P+      ++  L+++Q +  L   +   +  +++ +  A+  C   F++RRWNCS+   +      GK ++ G +E + ++A +SA++   IAR C++  +  C+C  S    +P AN +           + GC DN+  G ++ R+F    + G                         + L+  +++N HN EAG        +  CKCHG+SG C  + C+
Sbjct:   38 WWGIAKVGEPNN-----ITPIMYMDPAIHSTLRRKQRR--LVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERG-------------------------RNLR--EKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCW 248          

HSP 2 Score: 58.5362 bits (140), Expect = 9.179e-9
Identity = 32/92 (34.78%), Postives = 44/92 (47.83%), Query Frame = 3
Query: 1317 KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            KP    DL + E SP FCE +   G +GTHGR C   N +    + C  MCCGRG+R        +C C      +++C  C +    + CL
Sbjct:  380 KPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQC---NETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTCL 468          
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 151.369 bits (381), Expect = 1.170e-40
Identity = 101/342 (29.53%), Postives = 165/342 (48.25%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ E   ++GC DN+  G+ + + F                          +R+K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V++    +     P      + KP +  DL + + SPDFCE DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   48 GLIQRQVQICK--RNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLESVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRN----VHGVSPEGFQWSGCSDNIAYGVAFSQSFVDIR----------------------ERSKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVELRKVGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 351          
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 145.206 bits (365), Expect = 2.072e-38
Identity = 98/342 (28.65%), Postives = 155/342 (45.32%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPT-ANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL  RQ   C S   +  + G    ++  +  C   F+  RWNCS+       G++L  G++E A  +A ++A +   +   C+Q  M+HC C        NQE   E   + GC  +++ G+E+ RKF    ++                         +K  +++  +N HN EAG ++  +  K+ CKCHGVSG C  + C+          +  VL+ +Y  A  V+++    L           R +   +TDL + E SP++CE D  TGSVGT GR+C   N +   T+ C  MCCGRG+ T    K  +C C       ++C+ C    + F C
Sbjct:   43 GLAPRQRAICQSRPDAIIVIG--EGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQE---EGWKWGGCSADIKYGIEFSRKFVDAREI-------------------------KKNARRL--MNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTC 347          
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 145.206 bits (365), Expect = 2.400e-38
Identity = 98/342 (28.65%), Postives = 155/342 (45.32%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPT-ANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL  RQ   C S   +  + G    ++  +  C   F+  RWNCS+       G++L  G++E A  +A ++A +   +   C+Q  M+HC C        NQE   E   + GC  +++ G+E+ RKF    ++                         +K  +++  +N HN EAG ++  +  K+ CKCHGVSG C  + C+          +  VL+ +Y  A  V+++    L           R +   +TDL + E SP++CE D  TGSVGT GR+C   N +   T+ C  MCCGRG+ T    K  +C C       ++C+ C    + F C
Sbjct:   47 GLAPRQRAICQSRPDAIIVIG--EGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQE---EGWKWGGCSADIKYGIEFSRKFVDAREI-------------------------KKNARRL--MNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTC 351          
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Match: wnt11 (wingless-type MMTV integration site family, member 11 [Source:ZFIN;Acc:ZDB-GENE-980526-249])

HSP 1 Score: 139.813 bits (351), Expect = 1.817e-36
Identity = 117/388 (30.15%), Postives = 168/388 (43.30%), Query Frame = 3
Query:  471 IRWLGISRYTRPENQELERFSPLECRFNNLNH-----GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKK----LKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            IRWL +S+  +                N   H     GL   Q + C S  +   M  +++A++     C KTF D RWNCSS +  P    DLE GT+E A V+A S+A++   IAR C    +  CSCG   P    EI +    + GC DN+  GL    KF+                        +   KM+KK      K+  L  HN E G +   D   + CKCHGVSG C+ R C+R +  L D  +      +YLSA         + V   P G  ++  PK     P+ + +L + + SPD+C  +   GS GT  R C   N + + ++ C  MCCGRG+    E+   +C C       + C  C   V+ + C
Sbjct:   25 IRWLALSQTAQ--------------HINKTQHCKTLPGLVSSQAQLCRS--NLELMQTIIQAAREVKKVCQKTFTDMRWNCSSIDG-PKFLPDLERGTRESAFVYALSAAAISHTIARACTSGDLRLCSCG---PIPG-EIPEPGYRWGGCADNIHYGLLMGSKFS------------------------DAPMKMKKKSGSHANKLMHL--HNSEVGRQALRDALVMKCKCHGVSGSCSIRTCWRGLLDLKDIAIDLKT--KYLSA---------TKVVHRPMGTRKQLVPKDIDIRPVRENELVYLQSSPDYCMKNDKLGSFGTQDRQC---NKTSSGSDSCDLMCCGRGYNPYTERVVERCHCKYHWCCYVTCKKCDKTVEKYVC 351          
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 139.813 bits (351), Expect = 2.338e-36
Identity = 101/340 (29.71%), Postives = 147/340 (43.24%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSD-------DSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ E G+   R+F                        A+ R   + +      +N HN EAG    L+N  + CKCHG+SG C  + C+              L   YL  KY D  S+       +S    +         K  ++ DL + E SP+FCEP+P TGS GT  R C   N S    E C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIKDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTMCGCDSH----HKGPPGEGWKWGGCSEDAEFGVLVSREF------------------------ADAR---ENRPDARSAMNRHNNEAGRMTILENMHLRCKCHGLSGSCEVKTCW-------WAQPDFRLLGDYLKDKY-DSASEMVVEKHRESRGWVETLRAKYAFFKHPTERDLVYYEGSPNFCEPNPETGSFGTRDRAC---NVSSHGIEGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Ensembl Xenopus
Match: wnt11b-2 (wingless-type MMTV integration site family, member 11B [Source:NCBI gene;Acc:549489])

HSP 1 Score: 153.68 bits (387), Expect = 2.273e-41
Identity = 112/375 (29.87%), Postives = 168/375 (44.80%), Query Frame = 3
Query:  468 SIRWLGIS-RYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            +I+WLG++   +R    E E      CR   L  GL   Q++ C   ++   M  V+ A+K A   C  TF D RWNCSS E  P    DL  GT+E A V+A +SA++   IAR CA  ++  CSCG +      E+      + GC DN+  GL     F                        A  ++      +  + +N HN   G ++ +D+ +  CKCHGVSG C+ + C++     D   + N L+ +YL A  V      +     P    E   +P+ +++L +   SPD+C  +P  GS GT  RVC   N +   ++ C  MCCGRG+    E    +C C       + C  C   V+ + C
Sbjct:   22 AIQWLGLTVNGSRVAWNESE-----HCR---LLDGLVPEQSQLCK--RNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSCGATPA----EVPGTGFRWGGCGDNLHYGLNMGSAFVD----------------------APMKSSKSGGTQATKMINLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWK--GLQDLPHIANELKSKYLGATKVIHRQTGTRRQLVP---RELDIRPVRESELVYLVSSPDYCAKNPKLGSYGTQDRVC---NKTSVGSDSCNLMCCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVC 352          
BLAST of Wnt11-2 vs. Ensembl Xenopus
Match: rhbdl1 (rhomboid, veinlet-like 1 [Source:Xenbase;Acc:XB-GENE-953355])

HSP 1 Score: 149.058 bits (375), Expect = 1.137e-39
Identity = 118/405 (29.14%), Postives = 182/405 (44.94%), Query Frame = 3
Query:  423 IYFV--IILSFLMDENY--SIRWLGISRYTRPENQELERFSPLECRFNNLNH-----GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRL-NGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            IYF+  I L+FL+       I+WL +++            +PL    N   H     GL   Q + C S  +   M  ++ A+K     C+K F D RWNCSS E  P   +DLE GT+E A V+A S+A++   IAR C    +  CSC    P    E       + GC DN+  G+    KF+                        +   KM+K   +  +L + HN E G ++   + ++ CKCHGVSG C+ + C+R ++ L +  L      +YLSA         + V   P G  ++  PK     P+ +T++ + + SPD+C  +   GS GTH R C   N +   ++ C  MCCGRG+   +++   +C C       + C  C   V+ + C
Sbjct:    3 IYFLLGIFLTFLLHTRICQGIKWLALAK------------TPLSLALNQSQHCKQLEGLVSSQMQLCRS--NLELMQTIIHAAKEVKKTCIKAFTDMRWNCSSIELAPTFHQDLERGTRESAFVYALSAAAISHTIARACTTGDIPGCSCA---PIPG-ESPGPGYRWGGCADNLNYGILMGSKFS------------------------DAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWRGLQELREIALDLKT--KYLSA---------TKVVHRPMGTRKQLVPKDIDIRPVQETEMIYLQSSPDYCLKNEKMGSHGTHERQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 351          
BLAST of Wnt11-2 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 145.206 bits (365), Expect = 3.415e-38
Identity = 98/341 (28.74%), Postives = 160/341 (46.92%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ + LP  GK +  GT+E A V+A SSA + F + R C+   +  C C  +       ++ +   ++GC DN+  G+ + + F                          +R+K     + +  +N HN +AG +  L+N ++ CKCHGVSG C  + C++         + NVL++++  A  V+     S     P      + KP +  DL + + SPDFC+ D   G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C+  V+   C
Sbjct:   48 GLIQRQVQMCK--RNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRT----VHGVSPQGFQWSGCSDNIAYGVAFSQSFVD----------------------VRERSKGGSSSRAL--MNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWK--AMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVP---KNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQC---NKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVVEMHTC 350          
BLAST of Wnt11-2 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 143.665 bits (361), Expect = 1.059e-37
Identity = 98/341 (28.74%), Postives = 160/341 (46.92%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ + LP  GK +  GT+E A V+A SSA + F + R C+   +  C C  +       ++ +   ++GC DN+  G+ + + F                          +R+K     + +  +N HN +AG +  L+N ++ CKCHGVSG C  + C++         + NVL++++  A  V+     S     P      + KP +  DL + + SPDFC+ D   G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C+  V+   C
Sbjct:   46 GLIQRQVQMCK--RNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRT----VHGVSPQGFQWSGCSDNIAYGVAFSQSFVD----------------------VRERSKGGSSSRAL--MNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWK--AMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVP---KNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQC---NKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVVEMHTC 348          
BLAST of Wnt11-2 vs. Ensembl Xenopus
Match: rps6kb1 (ribosomal protein S6 kinase B1 [Source:Xenbase;Acc:XB-GENE-482409])

HSP 1 Score: 143.28 bits (360), Expect = 1.869e-37
Identity = 102/340 (30.00%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSA-ERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEE--RP-----KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +      M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++++ G    R+F                        A+ R   + +      +N HN EAG    LD++ + CKCHG+SG C  + C+              +   YL  KY D  S+  +       G  E  RP     KP ++ DL + E SP+FCEP+P TGS GT  RVC   N +    + C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   49 GLVAKQMRFCRNYME--IMPSVAEGVKIGIQECQHQFRGRRWNCTTVNDNLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSATICGCDSH----HKGPPGEGWKWGGCSEDMDFGSMVSREF------------------------ADAR---ENRPDARSAMNRHNNEAGRTSILDHRHLKCKCHGLSGSCEVKTCW-------WSQPDFRVIGDYLKDKY-DSASEMVVEKHRESRGWVETLRPKYTFFKPPTERDLIYYESSPNFCEPNPETGSFGTRDRVC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 344          
BLAST of Wnt11-2 vs. Ensembl Mouse
Match: Wnt4 (wingless-type MMTV integration site family, member 4 [Source:MGI Symbol;Acc:MGI:98957])

HSP 1 Score: 150.984 bits (380), Expect = 1.778e-40
Identity = 100/341 (29.33%), Postives = 161/341 (47.21%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ + LP  GK +  GT+E A V+A SSA + F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R+K     + +  +N HN EAG +  L + ++ CKCHGVSG C  + C+R         + + L++++  A  V+     S  A  P      + KP +  DL + E SPDFCE D  +G +GT GR C   N +  + + C  +CCGRG  T   +   +CGC       ++C  C   V+   C
Sbjct:   48 GLIQRQVQMCK--RNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRT----VHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVR----------------------ERSKGASSSRAL--MNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR--AVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVP---RNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTC---NKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTC 350          
BLAST of Wnt11-2 vs. Ensembl Mouse
Match: Wnt11 (wingless-type MMTV integration site family, member 11 [Source:MGI Symbol;Acc:MGI:101948])

HSP 1 Score: 139.043 bits (349), Expect = 4.363e-36
Identity = 112/386 (29.02%), Postives = 163/386 (42.23%), Query Frame = 3
Query:  465 YSIRWLGISRYTRPENQELERFSPLECRFNNLNH-----GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            Y I+WL +S+            +P     N   H     GL   Q + C S  +   M  ++ A++ A+  C + F D RWNCSS E  P    DLE GT+E A V+A S+A++   IAR C    +  CSCG           +    + GC DN+  GL    KF+                         K  K   +  K+ RL  HN E G +    + +  CKCHGVSG C+ R C++ ++ L D         +YLSA         + V   P G  +   PK     P+  ++L + + SPDFC  +   GS GT  R C   N +   ++ C  MCCGRG+    ++   +C C       + C  C   V+ + C
Sbjct:   23 YGIKWLALSK------------TPAALALNQTQHCKQLEGLVSAQVQLCRS--NLELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCGPVPGEPPGPGNR----WGGCADNLSYGLLMGAKFSD---------------------APMKVKKTGSQANKLMRL--HNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAADLKT--RYLSA---------TKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353          
BLAST of Wnt11-2 vs. Ensembl Mouse
Match: Wnt11 (wingless-type MMTV integration site family, member 11 [Source:MGI Symbol;Acc:MGI:101948])

HSP 1 Score: 139.043 bits (349), Expect = 4.363e-36
Identity = 112/386 (29.02%), Postives = 163/386 (42.23%), Query Frame = 3
Query:  465 YSIRWLGISRYTRPENQELERFSPLECRFNNLNH-----GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            Y I+WL +S+            +P     N   H     GL   Q + C S  +   M  ++ A++ A+  C + F D RWNCSS E  P    DLE GT+E A V+A S+A++   IAR C    +  CSCG           +    + GC DN+  GL    KF+                         K  K   +  K+ RL  HN E G +    + +  CKCHGVSG C+ R C++ ++ L D         +YLSA         + V   P G  +   PK     P+  ++L + + SPDFC  +   GS GT  R C   N +   ++ C  MCCGRG+    ++   +C C       + C  C   V+ + C
Sbjct:   23 YGIKWLALSK------------TPAALALNQTQHCKQLEGLVSAQVQLCRS--NLELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCGPVPGEPPGPGNR----WGGCADNLSYGLLMGAKFSD---------------------APMKVKKTGSQANKLMRL--HNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELQDVAADLKT--RYLSA---------TKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQC---NKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 353          
BLAST of Wnt11-2 vs. Ensembl Mouse
Match: Wnt3a (wingless-type MMTV integration site family, member 3A [Source:MGI Symbol;Acc:MGI:98956])

HSP 1 Score: 138.658 bits (348), Expect = 6.239e-36
Identity = 100/340 (29.41%), Postives = 146/340 (42.94%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKP-------ISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    KA +  C   F+ RRWNC++ +  L   G  L+  T+E A VHA +SA + F + R CA+   A C C +      Q    E   + GC +++E G    R+F                        A+ R   + +      +N HN EAG +    +  + CKCHG+SG C  + C+                  +L  KY D  S+  +       G  E  +P        ++ DL + E SP+FCEP+P TGS GT  R C   N S    + C  +CCGRGH    E++R KC C       + C +C
Sbjct:   47 GLVPKQLRFCRN--YVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSR----LQGSPGEGWKWGGCSEDIEFGGMVSREF------------------------ADAR---ENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCW-------WSQPDFRTIGDFLKDKY-DSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTC---NVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQEC 342          
BLAST of Wnt11-2 vs. Ensembl Mouse
Match: Wnt3 (wingless-type MMTV integration site family, member 3 [Source:MGI Symbol;Acc:MGI:98955])

HSP 1 Score: 138.272 bits (347), Expect = 8.344e-36
Identity = 97/340 (28.53%), Postives = 148/340 (43.53%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSD-------DSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ + G+   R+F                        A+ R   + +      +N HN EAG    LD+  + CKCHG+SG C  + C+                  +L  KY D  S+       +S    +         KP ++ DL + E+SP+FCEP+P TGS GT  R C   N +    + C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSH----HKGPPGEGWKWGGCSEDADFGVLVSREF------------------------ADAR---ENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCW-------WAQPDFRAIGDFLKDKY-DSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC---NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. UniProt/SwissProt
Match: sp|Q28J82|W11B2_XENTR (Protein Wnt-11b-2 OS=Xenopus tropicalis OX=8364 GN=wnt11b-2 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.204e-40
Identity = 112/375 (29.87%), Postives = 168/375 (44.80%), Query Frame = 3
Query:  468 SIRWLGIS-RYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            +I+WLG++   +R    E E      CR   L  GL   Q++ C   ++   M  V+ A+K A   C  TF D RWNCSS E  P    DL  GT+E A V+A +SA++   IAR CA  ++  CSCG +      E+      + GC DN+  GL     F                        A  ++      +  + +N HN   G ++ +D+ +  CKCHGVSG C+ + C++     D   + N L+ +YL A  V      +     P    E   +P+ +++L +   SPD+C  +P  GS GT  RVC   N +   ++ C  MCCGRG+    E    +C C       + C  C   V+ + C
Sbjct:   22 AIQWLGLTVNGSRVAWNESE-----HCR---LLDGLVPEQSQLCK--RNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENAPNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSCGATPA----EVPGTGFRWGGCGDNLHYGLNMGSAFVD----------------------APMKSSKSGGTQATKMINLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWK--GLQDLPHIANELKSKYLGATKVIHRQTGTRRQLVP---RELDIRPVRESELVYLVSSPDYCAKNPKLGSYGTQDRVC---NKTSVGSDSCNLMCCGRGYNAYTETIVERCQCKYYWCCYVMCKKCERTVERYVC 352          
BLAST of Wnt11-2 vs. UniProt/SwissProt
Match: sp|P47793|WNT4A_DANRE (Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.836e-40
Identity = 101/342 (29.53%), Postives = 165/342 (48.25%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ E   ++GC DN+  G+ + + F                          +R+K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V++    +     P      + KP +  DL + + SPDFCE DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   48 GLIQRQVQICK--RNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLESVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRN----VHGVSPEGFQWSGCSDNIAYGVAFSQSFVDIR----------------------ERSKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVELRKVGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 351          
BLAST of Wnt11-2 vs. UniProt/SwissProt
Match: sp|P22724|WNT4_MOUSE (Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.244e-39
Identity = 100/341 (29.33%), Postives = 161/341 (47.21%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   ++   M  V R ++ A+  C   F++RRWNCS+ + LP  GK +  GT+E A V+A SSA + F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R+K     + +  +N HN EAG +  L + ++ CKCHGVSG C  + C+R         + + L++++  A  V+     S  A  P      + KP +  DL + E SPDFCE D  +G +GT GR C   N +  + + C  +CCGRG  T   +   +CGC       ++C  C   V+   C
Sbjct:   48 GLIQRQVQMCK--RNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRT----VHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVR----------------------ERSKGASSSRAL--MNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR--AVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVP---RNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTC---NKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTC 350          
BLAST of Wnt11-2 vs. UniProt/SwissProt
Match: sp|P49893|WN11B_XENLA (Protein Wnt-11b OS=Xenopus laevis OX=8355 GN=wnt11b PE=1 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 3.795e-39
Identity = 110/375 (29.33%), Postives = 166/375 (44.27%), Query Frame = 3
Query:  468 SIRWLGIS-RYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            +I+WLG++   +R    E E      CR   L  GL   Q++ C   ++   M  V+ A+K     C  T  D RWNCSS E  P    DL  GT+E A V+A +SA+L   IAR CA  ++  CSCG +      E+      + GC DN+  GL     F                        A  ++      +  + +N HN   G ++ +D+ +  CKCHGVSG C+ + C++     D   + N L+ +YL A  V      +     P    E   +P+ +++L +   SPD+C  +P  GS GT  R+C   N +   ++ C  MCCGRG+    E    +C C       + C  C   V+ + C
Sbjct:   22 AIQWLGLTVNGSRVAWNESE-----HCR---LLDGLVPDQSQLCK--RNLELMQSVVNAAKQTKLTCQMTLSDMRWNCSSVENAPSFTPDLSKGTRESAFVYALASATLSHTIARACASGELPTCSCGAT----PAEVPGTGFRWGGCGDNLHYGLNMGSAFVD----------------------APMKSSKSAGTQATKIMNLHNNAVGRQVLMDSLETKCKCHGVSGSCSVKTCWK--GLQDLPHIANELKSKYLGATKVIHRQTGTRRQLVP---RELDIRPVRESELVYLVSSPDYCTKNPKLGSYGTQDRLC---NKTSVGSDSCNLMCCGRGYNAYTETIVERCQCKYHWCCYVMCKKCERTVERYVC 352          
BLAST of Wnt11-2 vs. UniProt/SwissProt
Match: sp|B2GUT4|WNT11_XENTR (Protein Wnt-11 OS=Xenopus tropicalis OX=8364 GN=wnt11 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 6.026e-39
Identity = 118/405 (29.14%), Postives = 182/405 (44.94%), Query Frame = 3
Query:  423 IYFV--IILSFLMDENY--SIRWLGISRYTRPENQELERFSPLECRFNNLNH-----GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRL-NGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            IYF+  I L+FL+       I+WL +++            +PL    N   H     GL   Q + C S  +   M  ++ A+K     C+K F D RWNCSS E  P   +DLE GT+E A V+A S+A++   IAR C    +  CSC    P    E       + GC DN+  G+    KF+                        +   KM+K   +  +L + HN E G ++   + ++ CKCHGVSG C+ + C+R ++ L +  L      +YLSA         + V   P G  ++  PK     P+ +T++ + + SPD+C  +   GS GTH R C   N +   ++ C  MCCGRG+   +++   +C C       + C  C   V+ + C
Sbjct:    3 IYFLLGIFLTFLLHTRICQGIKWLALAK------------TPLSLALNQSQHCKQLEGLVSSQMQLCRS--NLELMQTIIHAAKEVKKTCIKAFTDMRWNCSSIELAPTFHQDLERGTRESAFVYALSAAAISHTIARACTTGDIPGCSCA---PIPG-ESPGPGYRWGGCADNLNYGILMGSKFS------------------------DAPMKMKKSGSQANKLMHLHNSEVGRQVLKASLEMKCKCHGVSGSCSIKTCWRGLQELREIALDLKT--KYLSA---------TKVVHRPMGTRKQLVPKDIDIRPVQETEMIYLQSSPDYCLKNEKMGSHGTHERQC---NKTSNGSDSCDLMCCGRGYNPYMDKVVERCHCKYHWCCYVTCKKCERTVERYVC 351          
BLAST of Wnt11-2 vs. TrEMBL
Match: C3U5B2 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 399/415 (96.14%), Postives = 400/415 (96.39%), Query Frame = 3
Query:  390 MIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESG--------------TQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            MIHFCKLSR+WIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESG              TQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDL FTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL
Sbjct:    1 MIHFCKLSRVWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGKKLIWFHGYIFQSGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 415          
BLAST of Wnt11-2 vs. TrEMBL
Match: T1E1C8 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 3.438e-165
Identity = 240/376 (63.83%), Postives = 297/376 (78.99%), Query Frame = 3
Query:  468 SIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKP-ISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            SI WLG+S+Y RPE+ EL  FS +EC F + NHGL++RQ KFCL+ QH +AMHG+LRASKAAV+YCMKTF DRRWNCSS ERLP IGKDL+ GTQEQAVVHAF+S+S+L+EI+RRCAQNK+AHCSCG S+   +Q  +Q +L+FAGCPDNV+IG++YV+KFTGYHKL                   +K   +  +  K++++NGHNYEAG++IQL+NQ+ HCKCHGVSG C QR+CYRQ+RRLDD+VLL  LRKQYL+AK+VDI S++ L  A+PFG  E  P   I+ TDLAF EHSPDFCEPDP+ GS+GTHGR CK +N S+T+TEHC+NMCCGR +R  LEQK+TKCGC ID+ FKI CDDC+ NVK FYCL
Sbjct:   41 SINWLGMSQYNRPESHELRGFSEVECHFISTNHGLKQRQAKFCLNRQHKFAMHGILRASKAAVYYCMKTFHDRRWNCSSTERLPNIGKDLQLGTQEQAVVHAFASSSVLYEISRRCAQNKIAHCSCGNSDQVQSQYNSQRRLMFAGCPDNVDIGIKYVKKFTGYHKL--------------GKKSKKKVKSLNDQTLKVKKINGHNYEAGIKIQLENQRTHCKCHGVSGSCAQRVCYRQLRRLDDEVLLTALRKQYLAAKFVDISSNNKLFIANPFGIQEGSPPIYIADTDLAFIEHSPDFCEPDPSVGSLGTHGRKCKIDNVSETATEHCSNMCCGREYRMSLEQKKTKCGCRIDENFKILCDDCFLNVKNFYCL 402          
BLAST of Wnt11-2 vs. TrEMBL
Match: D0VYP8 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 GN=Djwnt11-2 PE=2 SV=2)

HSP 1 Score: 478.404 bits (1230), Expect = 3.106e-164
Identity = 243/317 (76.66%), Postives = 279/317 (88.01%), Query Frame = 3
Query:  645 KAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXX-XXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            KAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQA+VHAFSSASLLFEI+RRCAQNKMAHCSCG S P  N++I QEKL+FAGCPDN+EIGLEY++KFTGYHKLGRKK K++   +E  ++YV +K+A MQKKLK I RLNGHNYEAGL+IQ++NQK HCKCHGVSG C QRICYRQ+RRLDD+ L  +LRKQYL+AKYV+I SDD+LVA DPFGGS+E  KP+S  DL F EHSPD+CEPD +TGS+GTHGR CK +N SKTSTEHCTNMCCGRG+R +LEQ RTKCGC +D+ FKI CDDC+SNVKT+YCL
Sbjct:    1 KAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAIVHAFSSASLLFEISRRCAQNKMAHCSCGPSGPNTNKDIIQEKLIFAGCPDNIEIGLEYIKKFTGYHKLGRKKLKKRKPNRENLNYYVVDKQAAMQKKLKTINRLNGHNYEAGLKIQMENQKQHCKCHGVSGACTQRICYRQIRRLDDEELHTILRKQYLAAKYVEIQSDDTLVAVDPFGGSDESAKPVSSKDLVFIEHSPDYCEPDTSTGSLGTHGRKCKMDNVSKTSTEHCTNMCCGRGYRMLLEQLRTKCGCRLDE-FKIYCDDCFSNVKTYYCL 316          
BLAST of Wnt11-2 vs. TrEMBL
Match: B0LMF9 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wnt11-1 PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.669e-112
Identity = 180/390 (46.15%), Postives = 255/390 (65.38%), Query Frame = 3
Query:  423 IYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEK--LLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 1583
            + FVI++++    N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL+ GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN     +     ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDLAF EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:   12 LMFVILINY----NSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMGMKSKDSDSKS-------ENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHV-TMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 389          
BLAST of Wnt11-2 vs. TrEMBL
Match: F8WQT0 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 GN=Djwnt11-1 PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.816e-107
Identity = 179/361 (49.58%), Postives = 239/361 (66.20%), Query Frame = 3
Query:  513 QELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEK--LLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFID-DKFKIQCDDCYS-NVKTF 1583
            QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP I  DL  GTQEQAVVHAFSSA+LLFEI+RRC+QNK+ HCSCG  NP  N     +     +  C DN+E+G+E+ + F G+HK+G+ KSK+   K   S    + +++M      IQRLNGHNYE GL I  ++ K  CKCHGVSG C+Q+ICYRQ+RRLDD+ LL  ++  YL AK+V I  ++ L     F     + +P+   +LAF EHS D+CEPDP+ GS GT GR C+T+N + + T HC+NMCCGRG+R V+E++  +C C +D   + ++C  C   N+K F
Sbjct:    4 QELDGFTRSECEYAKKIQVLRKRHYRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKISPDLRLGTQEQAVVHAFSSAALLFEISRRCSQNKLRHCSCGKENPDVNDLTNNQNYTYYYTNCLDNIEVGIEFTKTFLGFHKMGKTKSKDTEWKSDNSSLKEKNKSQM------IQRLNGHNYEVGLMIMKNSWKPKCKCHGVSGSCSQKICYRQLRRLDDEELLKTIKDYYLKAKHVTIGENNKLYPTQ-FTSQSYQNEPLKNNELAFIEHSSDYCEPDPSAGSFGTQGRQCETKNVTLSETNHCSNMCCGRGYREVVEKETVQCKCELDVGYYVVKCKTCSQINIKKF 357          
BLAST of Wnt11-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 140.584 bits (353), Expect = 4.881e-37
Identity = 94/324 (29.01%), Postives = 154/324 (47.53%), Query Frame = 3
Query:  621 MHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V+     +     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   35 MDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRN----VHGVSPDGFQWSGCSDNIAYGVAFSQSFVDI----------------------RERGKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 322          
BLAST of Wnt11-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 140.198 bits (352), Expect = 6.027e-37
Identity = 94/324 (29.01%), Postives = 154/324 (47.53%), Query Frame = 3
Query:  621 MHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V+     +     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   31 MDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRN----VHGVSPDGFQWSGCSDNIAYGVAFSQSFVDI----------------------RERGKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 318          
BLAST of Wnt11-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 140.969 bits (354), Expect = 6.973e-37
Identity = 94/324 (29.01%), Postives = 154/324 (47.53%), Query Frame = 3
Query:  621 MHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V+     +     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   61 MDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRN----VHGVSPDGFQWSGCSDNIAYGVAFSQSFVDIR----------------------ERGKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 348          
BLAST of Wnt11-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 140.198 bits (352), Expect = 7.567e-37
Identity = 94/324 (29.01%), Postives = 154/324 (47.53%), Query Frame = 3
Query:  621 MHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            M  V R ++ A+  C   F++RRWNCS+ E +P  GK +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ +   ++GC DN+  G+ + + F                          +R K Q   + +  +N HN EAG +  L++ ++ CKCHGVSG C  + C++         + NV+++++  A  V+     +     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C   V+   C
Sbjct:   38 MDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRN----VHGVSPDGFQWSGCSDNIAYGVAFSQSFVDIR----------------------ERGKGQSSNRAL--MNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVP---RNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYC---NKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 325          
BLAST of Wnt11-2 vs. Ensembl Cavefish
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:103026929])

HSP 1 Score: 140.198 bits (352), Expect = 1.409e-36
Identity = 97/344 (28.20%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPT-ANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAAD--PFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL  RQ   C S   +  + G    ++  +  C   F+  RWNCS+       G++L  G++E A  +A ++A +   +   C+Q  M+HC C        NQE   E   + GC  +++ G+E+ R+F    ++                         +K  +++  +N HN EAG +   +  K+ CKCHGVSG C  + C+          +  +L+ +Y  A +V+++    L          +    KP+ +TDL + E SP++CE D  TGSVGT GR+C   N +   T+ C  MCCGRG+ T    K  +C C       ++C+ C    + F C
Sbjct:   47 GLAPRQRAICQSRPDAIIVIG--EGAQLGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQE---EGWKWGGCSADIKYGIEFSRRFVDAREI-------------------------KKNARRL--MNLHNNEAGRKALEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYMLKDKYNKAVHVEVVRATRLRQPTFLKVKKTHGYQKPL-ETDLVYIERSPNYCEEDAKTGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTC 352          
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.151e-37
Identity = 110/370 (29.73%), Postives = 168/370 (45.41%), Query Frame = 3
Query:  480 LGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            L +S   RPE   L    PL C+   L+ G    Q K C  L   +  H +   ++ AV  C   F+ RRWNCS+ E     G+    G++E A  HA S+A +   ++R C + ++A  +CG S     +E+ Q   L+ GC DN+E G  + R+F    +  +   +++ ++++     A    +  + L     +N HN EAG R       + CKCHGVSG C+ + C+ Q       +       ++L  KY D  S            +  +  P S  DL + + SPD+C  + TTGS+GT GR C   N +    + C  MCCGRG+         +C C       ++C  C S V  F C
Sbjct:   30 LALSPMQRPEAYLLS-AQPL-CQLVGLSPG----QRKLC-HLYQDHVPH-IADGARLAVRECQHQFRTRRWNCSAGEGDSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELA--TCGCSRAPRPREL-QRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTL-----MNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQ-------LADFRKVGKFLKEKY-DSASAARAGRRAKLEPANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSC---NKTSEGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKCTSVVDRFVC 372          
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 131.724 bits (330), Expect = 3.230e-34
Identity = 102/343 (29.74%), Postives = 146/343 (42.57%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYI-GKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGT---SNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEE--RP-----KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC + Q    M  V    +  +  C   F+ RRWNC++    P I G  LE  T+E + VHA SSA + F + R CA      C C       P+   +       + GC ++ + G+   R+F                        A+ R   + +      +N HN EAG    LD  +  CKCHG+SG C  + C+                  +L  KY D  S+  +       G  E  RP     KP ++ DL + E SP+FCEP   TGS+GTHGR C   N +    + C  +CC RG+ T  E++R KC C       + C +C
Sbjct:   50 GLVPKQLRFCRNYQE--LMPSVAEGVRLGIQECQHQFRGRRWNCTTMTEGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGGWK-------WGGCSEDADFGVMVSREF------------------------ADAR---ENRPDARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCW-------WAQPSFRTVGDHLKDKY-DSASEMLVERHRESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPC---NLTSHGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.283e-19
Identity = 82/359 (22.84%), Postives = 136/359 (37.88%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRC--AQNKMAHCSC---GTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSE-ERP------------KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL  RQ   C S      + G    ++  +  C   F+  RWNC++       G++L+   +        S   L   I +RC    ++++ CS    G   P     +T     F     +  + + Y+                         +   + + + + ++K+     H+ +  L    +  K+ CKCHGVSG C  + C+                 ++    Y      +  V  +P  GS   RP            KP+  T+L FTE SP++CE DP TGS GT GR+C   N +    + C  +CCGRG+ T    +  +C C       ++C  C    + + C
Sbjct:   12 GLAPRQRALCQSRPDVIIVIG--EGAQLGISECQYQFRFGRWNCTALGERTVFGQELKVAIRSTHFTDIQSGGGLFERIHQRCRYGAHELSLCSQLTRGREGPHPWLRMTPLDEQFGQKTSSTFLKIVYI-------------------------HYNYRNSDLAQLMQKVPYRRFHSTDQVLE---EKMKLECKCHGVSGSCTTKTCW-------------TTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVKKSRSYRKPLD-TELVFTERSPNYCEEDPATGSAGTRGRLC---NRTSPHADGCDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTCSERTEEYTC 323          
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 77.7962 bits (190), Expect = 2.756e-16
Identity = 77/312 (24.68%), Postives = 116/312 (37.18%), Query Frame = 3
Query:  735 LESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSC-----GTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYV-------DILSDDS-------------LVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSV-GTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            L +G +E A +HA  SA+L   +AR C++  +A C+C     G   P            + GC DN+  G  + R+                          E+  +  + L     ++ HN EAG+R      +  CKCHG+SG C  + C+ ++             +++  A  V       +  S DS             L  ADP        KP    DL + + SP+FC  D    S  GT GRVC   +        C  +CCGRG  +   +   +C C       + C +C        CL
Sbjct:    1 LLAGCRETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGRGGPDWE---------WGGCSDNLPFGTRFARELA--------------------AGAGERGGRDARAL-----MDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLK--ERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPA------HKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVCVRGSPGLGG---CELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHECL 267          
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 72.7886 bits (177), Expect = 1.505e-15
Identity = 49/160 (30.63%), Postives = 76/160 (47.50%), Query Frame = 3
Query: 1110 LDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            + + ++ CKCHGVSG C  R C+R         + +VL++++  A  V++    +     P      + KP +  DL +   SPDFC+ DP  G  GT GR C   N +  + + C  MCCGRG  T   +   +C C       ++C  C  +V+   C
Sbjct:    4 VSHMRVECKCHGVSGSCEVRTCWR--ALPPFRKIGSVLKEKFDGATEVELRKIGTRRQLVP---RNAQFKPHTDEDLVYVAPSPDFCDADPKAGVAGTAGREC---NRTSRALDGCELMCCGRGFHTTRAELVERCYCKFHWCCFVKCRQCRKHVEMHTC 155          
BLAST of Wnt11-2 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 150.984 bits (380), Expect = 5.181e-41
Identity = 110/400 (27.50%), Postives = 173/400 (43.25%), Query Frame = 3
Query:  417 IWIYFVIILSFLMDE-NYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAE--RLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGS------EERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            I +  VI+   +M    YS +WL ++      N+ L + +  E     +   L  RQ + C   ++   M  V   +  A+F C   F+ R WNC++ +  R P  G  +  GT+E A VHA SSA + + + + C+  ++    CG    T  Q    +   +AGC D+++ G+ +  +F    + G                 +  R  M          N HN   G         + CKCHGVSG CN + C+R        +    +   Y+  K+       + V     GG         + KP +Q DL +   SPDFCEP+P TGS+GT GR+C   N +  + + C  MCCGRG+ +  E ++ +C C       ++C  C   V+  YC
Sbjct:    2 IALKIVILTQLVMASLVYSSQWLSLALTGSNPNRFLSKKNCDE-----IGQLLNHRQVQVCK--RNIQVMDSVKDGASVALFECQHQFRYRPWNCTTVQFSRSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQ-KCGCDRKTRGQA---DGFNWAGCSDDIDFGMTFATRFVDARERGSGIG-------------SPARVLM----------NLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWR-------ALPNFRIVGDYIKEKF----DGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRIC---NRTSQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYC 353          
BLAST of Wnt11-2 vs. Ensembl Nematostella
Match: EDO37901 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2])

HSP 1 Score: 146.747 bits (369), Expect = 2.050e-39
Identity = 110/393 (27.99%), Postives = 172/393 (43.77%), Query Frame = 3
Query:  423 IYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFG---GSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            ++ V+ LSF      +IRWLGI R+T     + +     +C   N  HG   +Q K C   ++  AM  V  A +     C   FQ++RWNCS+  + P    DL+ GT E A V+A S+A+L + I + C   ++  C CGT     N +       + GC DN+  G+ + + FT                      V  +R +  K +  +  +N HN   G +      + HC+CHGVSGGC  + C R++                L  +Y  I+  +S   +        S+   +  + +DL   + SP++C  +   G+ GTHGR+C  + T +     C  +CCGRGHRT       +C C       ++C  C   V+   CL
Sbjct:    7 LFVVLCLSFW-SPVVTIRWLGI-RHTSQHTWDKK-----DC---NRIHGFSGKQYKICR--RNLPAMLYVTAAVEMTREECQHQFQNKRWNCSTIVKAPQFLPDLKRGTPEAAFVYALSAAALTYSITQACGMKRLKPCKCGT-----NPKFKHPDGEWGGCHDNIARGMRFSKDFT--------------------DAVEAQRMRKHKSM-AVALMNLHNNGVGRKAVHSRLEFHCRCHGVSGGCTAKTCIRRLGDFRLVA-------DLLKNRYARIVYVESKTKSKRKARVLKSKRGRRRYTSSDLVALQGSPNYCHKNRKRGTAGTHGRLC--DPTKRRGEGSCAYLCCGRGHRTEEVVHEERCECKYIWCCYVKCQTCRKRVRESRCL 352          
BLAST of Wnt11-2 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 136.346 bits (342), Expect = 1.119e-35
Identity = 93/333 (27.93%), Postives = 150/333 (45.05%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYI-GKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL   Q + CL   +   M  + + +K  V  C   F+D+RWNCS+      + GK +   ++E A V+A SSA ++ E+ R C+  ++  CSC        +  +++   + GC DN++ GL + + F    ++                   EK A+          +N HN   G R+   N  + CKCHGVSG C+ R C++ +              Q+L  KY   +      +      +E   K  S+ DL + E SP++C  D  TGS+GT GR C    ++  +T  C+ +CCGRG  T+  ++  KC C       ++C  C
Sbjct:   47 GLISIQRQMCL--DNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSC-----RNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREV-------------------EKDARAL--------MNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVG-------QHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGREC--NGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTC 336          
BLAST of Wnt11-2 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 125.946 bits (315), Expect = 7.243e-32
Identity = 89/345 (25.80%), Postives = 157/345 (45.51%), Query Frame = 3
Query:  582 QTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVD------ILSDDSLVAADP--FGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            Q +  +S ++   +  +   ++ A+  C   F++R+WNCS+       GK L+   +E A  +A ++A +   IAR C + K++ CSC        + ++++   + GC DN+     + ++F    + GR                 + RA+          +N HN EAG     +N  + CKCHG+S  C  + C++++             +++ +A  V+        + +     DP  F  S+   +  +  DL + EHSP+FCE +P+ GS+GT GR C   NT+   T+ C  MCCGRG  T  +++   C C      +++C  C +      CL
Sbjct:   55 QKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSPENVFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQRY----RGVSKQGWQWGGCSDNIHFADNFSKRFVDAQEKGR-----------------DFRAQ----------INLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLK--RKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGREC---NTTSMGTDGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNCL 363          
BLAST of Wnt11-2 vs. Ensembl Nematostella
Match: EDO45607 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RSC1])

HSP 1 Score: 125.176 bits (313), Expect = 1.154e-31
Identity = 108/400 (27.00%), Postives = 156/400 (39.00%), Query Frame = 3
Query:  423 IYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKD--LESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKY---VDILSDDS------LVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            I   I+LS   D     R   +    RP     E  +    +F +L   ++  Q + CL       M  V R    A+  C   F D +WNCS         +   L++ T+E A V A +SA + F+I + C+      C C T      Q   +    + GC +NV  G ++ RKF                           R +++  L K      HN EAG +   DN    CKCHGVSG C  +IC+R +              Q L  K+     + ++D       +          ++ +  S  DL F E SP FC P+P  G +GT GRVC   + +      C  MCC RG+ T     + KC C      K+QCD C  +   + C
Sbjct:    8 ITLAILLSEQADGRRKFRDNPVIPSARPSLVTSEEVT----QFCSLMPWMKPHQKQKCL--LEPLVMPSVQRGVGMALEECPNHFSDHKWNCSGVNTAQVFQERGILKTNTKESAFVFALTSAGVSFQITKGCSLGNWEQCGCDTQVRGRVQTKDEASWEWGGCSENVGHGDDFSRKFMDPE---------------------PPRKELEYLLVK------HNNEAGRKALKDNMGKTCKCHGVSGSCTVKICWRTMPNFSVVA-------QLLRKKFDQATKVKANDKKTKLQRITRGKRGKKKRQKGRRPSAGDLVFAEKSPKFCIPNPELGILGTRGRVC---DANAKDNRGCKKMCCNRGYDTFKLSNQVKCNCEFIWCCKVQCDMCKKDWTEYRC 364          
BLAST of Wnt11-2 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 145.976 bits (367), Expect = 1.133e-38
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   +    M  V R ++ A+  C   F++RRWNCS+ E LP   K +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ E   ++GC DN+  G+ + + F                       V E+    Q   + +  +N HN EAG +  L N ++ CKCHGVSG C  + C++         + NV+++++  A  V+     S     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG +T   +   +C C       ++C  C   V+   C
Sbjct:   50 GLIQRQVQICK--RSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLETLPVFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHN----VHGVSPEGFQWSGCSDNIAYGVAFSQSFVD---------------------VRERSKGGQSSSQAL--MNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVP---RNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQC---NRTSKAIDGCELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQCRKIVEIHTC 354          
BLAST of Wnt11-2 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 145.591 bits (366), Expect = 1.396e-38
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDP-TTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL +RQ + C   +    M  V R ++ A+  C   F++RRWNCS+ E LP   K +  GT+E A V+A S+AS+ F + R C+  ++  C C  +       ++ E   ++GC DN+  G+ + + F                       V E+    Q   + +  +N HN EAG +  L N ++ CKCHGVSG C  + C++         + NV+++++  A  V+     S     P      + KP +  DL + + SPDFC+ DP T G +GT GR C   N +  + + C  MCCGRG +T   +   +C C       ++C  C   V+   C
Sbjct:   48 GLIQRQVQICK--RSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLETLPVFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHN----VHGVSPEGFQWSGCSDNIAYGVAFSQSFVD---------------------VRERSKGGQSSSQAL--MNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWK--AMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVP---RNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQC---NRTSKAIDGCELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQCRKIVEIHTC 352          
BLAST of Wnt11-2 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 140.584 bits (353), Expect = 7.613e-37
Identity = 98/346 (28.32%), Postives = 158/346 (45.66%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPT-ANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQR--LNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERP--KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            GL  RQ   C S   +  + G    ++  +  C   F+  RWNCS+       G++L  G++E A  +A ++A +   I   C+Q  ++ C C        NQE   E   + GC  +++ G+E+ R+F                                +++KK  R  +N HN EAG ++  +  K+ CKCHGVSG C  + C+          +  +L+++Y  A +V+++    L         + +   KP+ +TDL + E SP++CE D  TGSVGT GR+C   N +   T+ C  MCCGRG+ T    K  +C C       ++C+ C    + F C
Sbjct:   47 GLAPRQRAICQSRPDAIIVVG--EGAQMGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYNQE---EGWKWGGCSADIKYGIEFSRRFVD-----------------------------AREIKKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCW--TTLPKFREIGYILKEKYNEAVHVEVVRASRLRQPTHLKVKQTQGYRKPM-ETDLVYIERSPNYCEEDAATGSVGTQGRLC---NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTC 352          
BLAST of Wnt11-2 vs. Ensembl Medaka
Match: wnt11 (Wnt family member 11 [Source:NCBI gene;Acc:101155217])

HSP 1 Score: 140.584 bits (353), Expect = 8.097e-37
Identity = 120/407 (29.48%), Postives = 181/407 (44.47%), Query Frame = 3
Query:  411 SRIWIYFVIILSFLMDENY--SIRWLGISRYTRPENQ--ELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGK---DLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRL-NGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEER-PK-----PISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYC 1589
            SR  I  V +L+ L+       I+WL +S+ T   NQ    +R S           GL   Q + C S  +   M  +++A++     C KTF D RWNCSS E      K   DL+ GT+E A V+A S+A++   IAR C    +  C+CG        EI +    + GC DN+  GL    KF+                        +   KM++      +L + HN E G ++  ++  + CKCHGVSG C+ R C+R ++ L +  +      +YLSA         + V   P G  ++  PK     P+ + +L + + SPDFC  +   GSVGT  R C   N +   ++ C  MCCGRG+    E+   +C C       + C  C   V+ + C
Sbjct:    3 SRSHILPVGVLTALLLSQVCSGIKWLTLSQTTSHINQTQHCKRLS-----------GLVSSQVQLCRS--NLELMQTIVQAAREVKKTCQKTFADMRWNCSSIEIAADGQKYPPDLDRGTREAAFVYALSAATISHTIARACTSGDLRLCTCGP----IPAEIPEPGYRWGGCADNLHYGLMTGSKFS------------------------DAPMKMKRSGSHANKLMHLHNSEVGRQVLRESMVMKCKCHGVSGSCSIRTCWRGLQDLREIAMDLKT--KYLSA---------TKVIHRPMGTRKQLVPKDIDIRPVRENELVYLQSSPDFCSKNEKLGSVGTQDRQC---NKTSVGSDSCDLMCCGRGYNPYTEKLVERCHCKYHWCCYVTCKKCERIVERYVC 354          
BLAST of Wnt11-2 vs. Ensembl Medaka
Match: wnt3 (Wnt family member 3 [Source:NCBI gene;Acc:101174231])

HSP 1 Score: 140.584 bits (353), Expect = 8.512e-37
Identity = 102/340 (30.00%), Postives = 148/340 (43.53%), Query Frame = 3
Query:  567 GLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS-AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERP-------KPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            GL  +Q +FC +  +   M  V    K  +  C   F+ RRWNC++  + L   G  L+  T+E A VHA +SA + F + R CA+     C C +     ++    E   + GC ++ E G+   R+F                        A+ R   + +      +N HN EAG    LD+  + CKCHG+SG C  + C+              +   YL  KY D  S+  +       G  E         K  ++ DL + E SP+FCEP+P TGS GT  RVC   N S    E C  +CCGRGH T  E+++ KC C       + C +C
Sbjct:   50 GLVPKQLRFCRN--YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIKDNLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTMCGCDSH----HKGPPGEGWKWGGCSEDAEFGVLVSREF------------------------ADAR---ENRPDARSAMNRHNNEAGRTTILDHMHLRCKCHGLSGSCEVKTCW-------WAQPDFRMLGDYLKDKY-DSASEMVVEKHRESRGWVETLRVKYAFYKHPTERDLVYYEGSPNFCEPNPETGSFGTRDRVC---NVSSHGIEGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of Wnt11-2 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 410/411 (99.76%), Postives = 410/411 (99.76%), Query Frame = 3
Query:  360 MITFNLILNSMIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            MITFNLILNSMIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDL FTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL
Sbjct:    1 MITFNLILNSMIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 411          
BLAST of Wnt11-2 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 400/401 (99.75%), Postives = 400/401 (99.75%), Query Frame = 3
Query:  390 MIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            MIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDL FTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL
Sbjct:    1 MIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 401          
BLAST of Wnt11-2 vs. Planmine SMEST
Match: SMESG000074928.1 (SMESG000074928.1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 379/380 (99.74%), Postives = 379/380 (99.74%), Query Frame = 3
Query:  453 MDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 1592
            MDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDL FTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL
Sbjct:    1 MDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLVFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYSNVKTFYCL 380          
BLAST of Wnt11-2 vs. Planmine SMEST
Match: SMESG000005930.1 (SMESG000005930.1)

HSP 1 Score: 349.362 bits (895), Expect = 4.640e-116
Identity = 180/390 (46.15%), Postives = 255/390 (65.38%), Query Frame = 3
Query:  423 IYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEK--LLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDCYS-NVKTF 1583
            + FVI++++    N  I+WLG+++  R   QEL+ F+  EC +      L+KR  +FCL  +H +AMH VL ASKA V+YCMKTF DRRWNC S E+LP +  DL+ GTQEQAVVHAFSSA+L+FEI+RRC+QNK+ HCSCG     AN     +     ++ C DN++IG+E  R F G+H++G K      +          K+   Q K + I+RLNGHNYE G+ I +++ K  CKCHGVSG C  +IC+RQ+RRLDD+ LL +++  YL AK+V  + DD+ +    F  +  + +P+  TDLAF EHS D+CEPDP+ GS+GT GR C+T N + + T HC+NMCCGRG+R V+E++  +C C + D + ++C  C   N++ F
Sbjct:   12 LMFVILINY----NSGIKWLGLAKLNRSHKQELDGFTRSECEYARKIQVLRKRHFRFCLHHKHRFAMHAVLMASKATVYYCMKTFADRRWNCKSVEKLPKLPPDLKLGTQEQAVVHAFSSAALVFEISRRCSQNKLRHCSCGKDESDANVGSNNQNYTYYYSNCLDNIDIGIESTRNFLGFHQMGMKSKDSDSKS-------ENKKPNKQNKSQIIKRLNGHNYEVGIMIMMNSWKSKCKCHGVSGSCINKICFRQLRRLDDEELLKMIKDYYLRAKHV-TMEDDNKLYPTHFITTGLQKEPLKTTDLAFIEHSSDYCEPDPSAGSIGTQGRQCETVNVTLSKTNHCSNMCCGRGYREVMEKETVQCRCELVDVYIVKCKQCIQINIRKF 389          
BLAST of Wnt11-2 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.660e-28
Identity = 102/405 (25.19%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  414 RIWIYFVIILSFLMDENYSIRWLGISRYTRPENQELERFSPLECRFNNLN---HGLQKRQTKFCLSLQHSYAMHGVLRASKAAVFYCMKTFQDRRWNCSS---------------AERLPYIGKDLESGTQEQAVVHAFSSASLLFEIARRCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGYHKLGXXXXXXXXXXXXXXXYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQLDNQKIHCKCHGVSGGCNQRICYRQXXXXXXXXXXXXXXKQYLSAKYVDILSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHGRVCKTENTSKTSTE----HCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDDC 1562
            +I +  ++++  +  + Y     G+  +T  + QE  +F       NN N   + L K Q   CL  +H   +  V+      +  C   F +  WNC+                  R  Y+   +  G  E A + + +SA++  ++++ C+  +  +C C  +      E  ++   +AGC DNV  G  + ++F                       +     +  K+   +  +N HN  AG +I +DN  + CKCHGVSG C  + CYR    L D   +  + K+  S   +  ++D  LV   P    E R   I++ DL + + SP+FC  +P+ GS+GT GR+C   NT     E     C ++CC RG  T     + KC C       +QC  C
Sbjct:    4 KILVTVLLVIDIISIKVYVNSGRGMF-FTLMKLQESTKFD-----LNNTNIFCNQLMKLQRSICL--RHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI----YETPEDNFQWAGCSDNVHFGAAFSKRF-----------------------LDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYR---ALPDLRKVGDILKEKFSKAILVRMNDFKLV---PMHSGESR---ITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLC--NNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 362          
The following BLAST results are available for this feature:
BLAST of Wnt11-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT43.073e-3929.03Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT28.413e-3729.65Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT39.475e-3628.53Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT39.475e-3628.53Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT39.475e-3628.53Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-28.603e-3630.90pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
cwn-12.857e-3326.69pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
egl-205.188e-3024.57Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-22.559e-2526.01pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-22.559e-2526.01pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt21.512e-2125.63gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt64.550e-2126.45gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt64.550e-2126.45gene:FBgn0031902 transcript:FBtr0303251[more]
Wnt26.247e-2125.63gene:FBgn0004360 transcript:FBtr0339383[more]
wg3.489e-1724.08gene:FBgn0284084 transcript:FBtr0079432[more]
back to top
BLAST of Wnt11-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt41.170e-4029.53wingless-type MMTV integration site family, member... [more]
wnt7bb2.072e-3828.65wingless-type MMTV integration site family, member... [more]
wnt7bb2.400e-3828.65wingless-type MMTV integration site family, member... [more]
wnt111.817e-3630.15wingless-type MMTV integration site family, member... [more]
wnt32.338e-3629.71wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt11b-22.273e-4129.87wingless-type MMTV integration site family, member... [more]
rhbdl11.137e-3929.14rhomboid, veinlet-like 1 [Source:Xenbase;Acc:XB-GE... [more]
wnt43.415e-3828.74Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt41.059e-3728.74Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
rps6kb11.869e-3730.00ribosomal protein S6 kinase B1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt41.778e-4029.33wingless-type MMTV integration site family, member... [more]
Wnt114.363e-3629.02wingless-type MMTV integration site family, member... [more]
Wnt114.363e-3629.02wingless-type MMTV integration site family, member... [more]
Wnt3a6.239e-3629.41wingless-type MMTV integration site family, member... [more]
Wnt38.344e-3628.53wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt11-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28J82|W11B2_XENTR1.204e-4029.87Protein Wnt-11b-2 OS=Xenopus tropicalis OX=8364 GN... [more]
sp|P47793|WNT4A_DANRE8.836e-4029.53Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=... [more]
sp|P22724|WNT4_MOUSE1.244e-3929.33Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=... [more]
sp|P49893|WN11B_XENLA3.795e-3929.33Protein Wnt-11b OS=Xenopus laevis OX=8355 GN=wnt11... [more]
sp|B2GUT4|WNT11_XENTR6.026e-3929.14Protein Wnt-11 OS=Xenopus tropicalis OX=8364 GN=wn... [more]
back to top
BLAST of Wnt11-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3U5B20.000e+096.14Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
T1E1C83.438e-16563.83Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
D0VYP83.106e-16476.66Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
B0LMF91.669e-11246.15Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
F8WQT01.816e-10749.58Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt44.881e-3729.01wingless-type MMTV integration site family, member... [more]
wnt46.027e-3729.01wingless-type MMTV integration site family, member... [more]
wnt46.973e-3729.01wingless-type MMTV integration site family, member... [more]
wnt47.567e-3729.01wingless-type MMTV integration site family, member... [more]
wnt7bb1.409e-3628.20protein Wnt-7b [Source:NCBI gene;Acc:103026929][more]
back to top
BLAST of Wnt11-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010914.11.151e-3729.73pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt33.230e-3429.74wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.12.283e-1922.84pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt12.756e-1624.68wingless-type MMTV integration site family, member... [more]
wnt41.505e-1530.63wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt11-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Wnt11-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310005.181e-4127.50Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
EDO379012.050e-3927.99Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2][more]
WNT21.119e-3527.93Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO494317.243e-3225.80Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
EDO456071.154e-3127.00Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RSC1][more]
back to top
BLAST of Wnt11-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt41.133e-3829.82Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt41.396e-3829.82Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt7bb7.613e-3728.32protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt118.097e-3729.48Wnt family member 11 [Source:NCBI gene;Acc:1011552... [more]
wnt38.512e-3730.00Wnt family member 3 [Source:NCBI gene;Acc:10117423... [more]
back to top
BLAST of Wnt11-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074928.10.000e+099.76SMESG000074928.1[more]
SMESG000074928.10.000e+099.75SMESG000074928.1[more]
SMESG000074928.10.000e+099.74SMESG000074928.1[more]
SMESG000005930.14.640e-11646.15SMESG000005930.1[more]
SMESG000067888.11.660e-2825.19SMESG000067888.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010593
GenBankACJ64866.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010593 ID=SMED30010593|Name=Wnt11-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1651bp
CTCGCAACGAGTGTGAGCTATCATTAAAAGGAATGCAATAAATCATTTAT
CCACATACAGACACGAGCGGTGGTCATTAATTTGCAGGCTTCGACCAATT
ATTCATGCGAGTTTCTGTTTGGATTTCTGTGGCGAATTTCTCGCTCACTC
TAACTGGCTAGTAGTTGTATTTACAGTTCTCTACCTGTGCGCGATTACTG
GCCCACTTGTCTCTACAAACCATTGCAATAAAATTGTCCACATTTTTCAG
GCTGATATTTACCTTAACGATAGTCTTAATAGCAGGTTGATCTTTTGCAT
CCTCTCATATATAATCGAGTAATAATTCTTTGGTTCCCATTATCTTATTT
CATCAGGAAATGATTACCTTCAATTTGATTTTGAATTCTATGATACATTT
TTGCAAACTTTCAAGGATTTGGATATATTTTGTCATTATTCTCTCATTTC
TGATGGACGAAAACTATTCAATCAGATGGCTTGGGATATCACGATATACA
AGACCAGAAAATCAGGAATTAGAAAGATTTTCTCCATTAGAATGTCGATT
CAATAACCTTAACCATGGATTACAGAAAAGACAAACCAAATTCTGTTTAA
GTCTCCAACACAGCTATGCTATGCATGGTGTGTTGAGAGCTTCAAAAGCT
GCCGTTTTTTACTGCATGAAAACCTTCCAAGATCGCCGTTGGAATTGCTC
GTCAGCCGAACGATTGCCATATATTGGAAAAGACTTGGAATCAGGAACTC
AAGAACAAGCTGTTGTCCATGCATTTAGTAGTGCTTCATTATTGTTCGAA
ATCGCCAGGCGTTGCGCTCAAAACAAAATGGCCCACTGTTCATGTGGCAC
TTCGAATCCGACGGCTAATCAAGAAATTACTCAAGAAAAACTTTTATTTG
CTGGCTGTCCTGATAACGTTGAAATCGGACTTGAATACGTTAGAAAGTTT
ACCGGTTATCATAAACTTGGTAGAAAAAAATCCAAAGAAAAGCCTCGAAA
AGAAAAATTCAGTTTCTATGTTGCTGAAAAAAGAGCTAAAATGCAGAAAA
AGTTGAAAAAAATCCAGAGATTAAACGGCCACAATTATGAAGCTGGCTTG
AGAATACAACTTGACAATCAGAAAATTCATTGCAAATGCCATGGCGTAAG
CGGAGGATGTAATCAAAGGATTTGCTATAGACAAGTGAGACGGCTGGACG
ACGACGTTCTCCTCAACGTTTTGAGAAAACAATATCTGTCTGCAAAATAC
GTGGATATTTTATCAGATGATTCCCTTGTCGCTGCTGATCCTTTTGGTGG
GTCAGAGGAACGACCGAAACCAATATCACAAACGGATCTAGCATTTACTG
AACATTCTCCAGATTTTTGTGAACCAGATCCTACAACAGGATCAGTGGGA
ACTCATGGAAGAGTTTGCAAGACAGAAAATACCAGTAAAACATCGACTGA
GCACTGTACAAATATGTGTTGCGGTCGAGGACACCGTACAGTTTTGGAGC
AGAAACGGACAAAATGTGGGTGCTTCATTGACGACAAGTTTAAAATTCAA
TGTGATGACTGCTATTCAAATGTAAAGACATTTTATTGTTTGTAATTTTT
CATGCGATCAAATATCCAGATGAATTTATATTTCATTTAATACATTTATT
G
back to top

protein sequence of SMED30010593-orf-1

>SMED30010593-orf-1 ID=SMED30010593-orf-1|Name=SMED30010593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MITFNLILNSMIHFCKLSRIWIYFVIILSFLMDENYSIRWLGISRYTRPE
NQELERFSPLECRFNNLNHGLQKRQTKFCLSLQHSYAMHGVLRASKAAVF
YCMKTFQDRRWNCSSAERLPYIGKDLESGTQEQAVVHAFSSASLLFEIAR
RCAQNKMAHCSCGTSNPTANQEITQEKLLFAGCPDNVEIGLEYVRKFTGY
HKLGRKKSKEKPRKEKFSFYVAEKRAKMQKKLKKIQRLNGHNYEAGLRIQ
LDNQKIHCKCHGVSGGCNQRICYRQVRRLDDDVLLNVLRKQYLSAKYVDI
LSDDSLVAADPFGGSEERPKPISQTDLAFTEHSPDFCEPDPTTGSVGTHG
RVCKTENTSKTSTEHCTNMCCGRGHRTVLEQKRTKCGCFIDDKFKIQCDD
CYSNVKTFYCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000032dorsal midline
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR005817Wnt
IPR018161Wnt_CS
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 259..273
score: 58.91
coord: 178..190
score: 39.79
coord: 326..337
score: 59.63
coord: 150..163
score: 32.61
coord: 131..145
score: 37.54
IPR005817WntSMARTSM00097wnt1_3coord: 67..411
e-value: 5.0E-38
score: 142.3
IPR005817WntPFAMPF00110wntcoord: 69..410
e-value: 6.5E-65
score: 219.7
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 65..410
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 258..267
NoneNo IPR availableTMHMMTMhelixcoord: 21..43