SMED30010591

Overview
NameSMED30010591
Smed IDSMED30010591
Length (bp)1107
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30010591h1SMcG0011953 Contig26774newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010591h1SMcG0011953 Contig26774uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010591 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.011698:7539..8645 -5535
Homology
BLAST of SMED30010591 vs. UniProt/SwissProt
Match: sp|Q9M022|AIRP2_ARATH (E3 ubiquitin-protein ligase AIRP2 OS=Arabidopsis thaliana OX=3702 GN=AIRP2 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.367e-6
Identity = 48/185 (25.95%), Postives = 74/185 (40.00%), Query Frame = 1
Query:  448 IRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRP------------DCPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCI-ENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEGNKRID-----------ENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPF 930
            +R S ++ L +  A I+F   + S +P + +  ++   + Y P            DC ++  + L RI I            L E KT I E Y +   + L    GIT    R  K+I +  +    R D           E +C ICL++ NK     L  C H +C  C  ++     SCPF
Sbjct:    1 MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAAHLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNK---VVLPTCNHSMCINCYRNWRARSQSCPF 182          
BLAST of SMED30010591 vs. Planmine SMEST
Match: SMESG000075750.1 (SMESG000075750.1)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 353/355 (99.44%), Postives = 353/355 (99.44%), Query Frame = 1
Query:   22 MDFDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFTLNESRTLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPDCPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEGNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNGNNRGMSKLIQDFLEIDHFLD 1086
            MDFDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFTLNESRTLLWCQNQAFSNEELKIQDELE YWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPDCPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHE NKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNGNNRGMSKLIQDFLEIDHFLD
Sbjct:    1 MDFDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFTLNESRTLLWCQNQAFSNEELKIQDELESYWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPDCPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEVNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNGNNRGMSKLIQDFLEIDHFLD 355          
BLAST of SMED30010591 vs. Planmine SMEST
Match: SMESG000030485.1 (SMESG000030485.1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.633e-23
Identity = 81/329 (24.62%), Postives = 154/329 (46.81%), Query Frame = 1
Query:   46 CSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFT-----------LNESRTLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSLHFYIDTLEKVDLMLDT-------WISHAIPFDFYQINEFYNFINENLALIRNSL-EEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNII--FYRPDCPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEGNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFEN 969
            CS+CYDS+ + +  +   C H+ C  C + +VF++   C  D + I +V             + + ++L   +N+  S E   I +++   W        +++HF    L+K  ++L+        W++     D   +++F   I   +    +SL + D+     K ++ ++  +  P +  +PF+ NI+   Y  +    LI+ +F   ID       +QN L +    I  +     N   +L   T+S+  +N+++YE + + +++ID + CLICL  I     AKLS CQHKIC  C++ F + + SCPF    ++   +  +
Sbjct:   11 CSICYDSLKNCDSVVLPDCLHRFCRNCANEIVFKRVAKCQLDNRRINAVINCIIDTNGKNQLIIKVKSLKQYRNKILSMEPQSITEDIMNTWAE------RTMHFSC-VLDKTSVILNLLKNKFTLWMAEKTAIDSETVSQFNYAITHKMVNELDSLYKADIFKLTDKERYYRKYANRHPTKCISPFLINILNSVYIYE-TIDLIMPVFCCLID---SGIVKQNYLLKCVKAIGKHFEHLRNISNYLISFTLSFLNNNREVYEKLQKCHRQIDIDNCLICLCQIYFYPHAKLSNCQHKICHSCIDQFLITYASCPFHDATITQLTLVTD 328          
BLAST of SMED30010591 vs. Planmine SMEST
Match: SMESG000067204.1 (SMESG000067204.1)

HSP 1 Score: 100.523 bits (249), Expect = 6.556e-23
Identity = 103/385 (26.75%), Postives = 173/385 (44.94%), Query Frame = 1
Query:   28 FDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFTLNESR---------TLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPD---CPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEGNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNG----------------NNRGMSKLIQ--DF--LEIDHFLD 1086
            FD E  C +CYD    NN   F+ C H+IC  C   +VF+ + ICPFDRQ I   + ++E+          ++ + Q++A  ++   I + +E  W S++S +  SL   I+ +E + L L   I  A   D      F   + EN   + +   + L    A   + K + S    + +   IN +  ++      P  L  +L  +  ++ N    ++N+ +     IE  +I  S   L      I + + N  I++ I  G+ +   + CLIC+  I K K++K + C HKIC  C   F + HG CPFD  +LS   +F   ++ + + +S   + F                   NNR +  LI+  DF  L I++F+D
Sbjct:    4 FDNEKICLICYDE-GKNNFVSFKSCNHRICKNCSFEVVFQNQPICPFDRQEI--SYVIDETNLDIKNSQPLSIEYYQSRAVKSDPEIIINIIEATWSSFLSQLNDSLKTLIEIIESM-LKLHKEILKAKLIDLNNKLTF-ELLMENFNDVLDIFNQTLNCTKATEIYCKSLESDSYSELSLTQINIVNAHKVLINLSPLELNYHL--VLANMTNLGSIEKNIETMETDLIELKEISLSEKCLL-----IMFVKSNGQIFKSIFPGSDQHPIDSCLICVQPIKKLKYSKFNNCAHKICLACCYKFMISHGRCPFDGTELSELNVFVRMKNSDFDLKSKKTSVFILNRIEDLCFQLFKNIIEFNNRKIKTLIEKNDFFVLLINYFID 376          
BLAST of SMED30010591 vs. Planmine SMEST
Match: SMESG000067204.1 (SMESG000067204.1)

HSP 1 Score: 100.523 bits (249), Expect = 6.896e-23
Identity = 103/385 (26.75%), Postives = 173/385 (44.94%), Query Frame = 1
Query:   28 FDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDRQPIFSVFTLNESR---------TLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPD---CPWSLIVYLFRISIDLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYEGIHEGNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAF----------------FNGNNRGMSKLIQ--DF--LEIDHFLD 1086
            FD E  C +CYD    NN   F+ C H+IC  C   +VF+ + ICPFDRQ I   + ++E+          ++ + Q++A  ++   I + +E  W S++S +  SL   I+ +E + L L   I  A   D      F   + EN   + +   + L    A   + K + S    + +   IN +  ++      P  L  +L  +  ++ N    ++N+ +     IE  +I  S   L      I + + N  I++ I  G+ +   + CLIC+  I K K++K + C HKIC  C   F + HG CPFD  +LS   +F   ++ + + +S   + F                   NNR +  LI+  DF  L I++F+D
Sbjct:    2 FDNEKICLICYDE-GKNNFVSFKSCNHRICKNCSFEVVFQNQPICPFDRQEI--SYVIDETNLDIKNSQPLSIEYYQSRAVKSDPEIIINIIEATWSSFLSQLNDSLKTLIEIIESM-LKLHKEILKAKLIDLNNKLTF-ELLMENFNDVLDIFNQTLNCTKATEIYCKSLESDSYSELSLTQINIVNAHKVLINLSPLELNYHL--VLANMTNLGSIEKNIETMETDLIELKEISLSEKCLL-----IMFVKSNGQIFKSIFPGSDQHPIDSCLICVQPIKKLKYSKFNNCAHKICLACCYKFMISHGRCPFDGTELSELNVFVRMKNSDFDLKSKKTSVFILNRIEDLCFQLFKNIIEFNNRKIKTLIEKNDFFVLLINYFID 374          
BLAST of SMED30010591 vs. Planmine SMEST
Match: SMESG000067182.1 (SMESG000067182.1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.781e-22
Identity = 98/376 (26.06%), Postives = 159/376 (42.29%), Query Frame = 1
Query:   22 MDFDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFDR---QPIFSVFTLNES-------------RTLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSLHFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEEDLPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPDCPWSLIVYLFRISIDLKNKKE----TQQNLLSEAKTCIENYKIKSSNFLLF------LTGITISYFRDNKDIYEGIHEGNKRIDENQCLICLDLIN-KNKFAKLSECQHKICEKCVNDFGVLHGSCPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNGNNRGMSKLIQDFLE 1068
            MD++F+T C +CYD+++ +N+    +C H  C  C+  L+F +   CP DR   Q +   F L ++              TL   +   F  +  +I  E       Y+    Q+L+  I+ ++ V      W   +I     ++NE        L LI     E   S   K+ F K+  S F R     ++  +   +    +  ++ L ++ I L+N          N + +++  I+  ++       F         + ISY   N+D+Y  I    K  D N+CLIC   I  K K++K ++C HKIC  C  +F + H SCPFDSD L    I +   +     Q      + N  N+  SK IQD  E
Sbjct:    1 MDYEFDTTCVICYDNLETSNVVTLNKCPHVFCRSCVKELIFSEDPRCPLDRIEIQVVHDPFLLKQNLDFTEFKPISKYIETLFIFEADYFLTDIREIISE-------YLLKFNQNLNQIIEAMKDVQTFYRKW---SINRQTLKLNEIRTL----LTLIEIIRSEITKSDNIKLFFCKKS-SFFLR-----YLKGLTEEKIRLEYINLLNLDKLKIKLRNSTSHCICLTNNTIQQSEVLIKYMEVIDEELTEFQQISNYAKCLIISYVPKNRDLYSKIKPNIKENDTNKCLICETEIKLKGKYSKFNQCDHKICILCTENFMITHASCPFDSDDLIGLEICDQSENTLINSQEYLLRNYLNIGNKLFSK-IQDLNE 355          
The following BLAST results are available for this feature:
BLAST of SMED30010591 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9M022|AIRP2_ARATH2.367e-625.95E3 ubiquitin-protein ligase AIRP2 OS=Arabidopsis t... [more]
back to top
BLAST of SMED30010591 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010591 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075750.10.000e+099.44SMESG000075750.1[more]
SMESG000030485.14.633e-2324.62SMESG000030485.1[more]
SMESG000067204.16.556e-2326.75SMESG000067204.1[more]
SMESG000067204.16.896e-2326.75SMESG000067204.1[more]
SMESG000067182.17.781e-2226.06SMESG000067182.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010591 ID=SMED30010591|Name=SMED30010591|organism=Schmidtea mediterranea sexual|type=transcript|length=1107bp
TTTTAAAGTTTTTTAACAAAAATGGATTTCGACTTCGAAACTTGCTGCTC
TGTGTGCTATGATTCGATGGATGACAATAATATCGCAATTTTCCAACAGT
GTCGGCACAAAATTTGTATAATTTGTCTTCACCATTTGGTCTTTGAAAAG
AAATTCATTTGTCCATTTGATAGACAACCAATCTTTAGCGTTTTTACTTT
GAATGAATCACGAACGCTTTTGTGGTGTCAAAATCAAGCTTTTAGCAACG
AAGAATTAAAAATACAGGACGAATTGGAATGTTACTGGAAATCCTACGTC
TCCGTAATTATTCAATCTCTACATTTCTACATTGACACGTTGGAAAAAGT
CGATCTTATGTTAGATACGTGGATAAGTCACGCCATTCCATTTGATTTTT
ATCAAATTAATGAATTTTATAATTTTATAAATGAAAACTTAGCTTTAATT
CGTAATTCATTGGAGGAGGACCTTCCAAGCAAACCCGCAAAGATCAAATT
TATCAAGGAAGTTTTATCTCATTTTCCTCGGCAAAACAACACCCCGTTTA
TTAACAATATCATTTTTTACAGACCAGATTGTCCATGGTCACTGATAGTT
TACCTTTTTAGGATTTCAATTGATCTGAAAAATAAAAAAGAAACTCAACA
GAATTTATTGTCCGAAGCTAAAACTTGCATAGAAAATTATAAAATAAAAT
CAAGCAACTTTTTACTGTTTTTAACTGGAATTACCATCTCTTATTTTCGG
GACAACAAGGACATTTATGAGGGAATACATGAAGGAAATAAAAGGATTGA
TGAAAACCAATGCCTAATCTGTCTAGATTTAATAAATAAAAATAAATTCG
CAAAATTATCCGAATGTCAGCACAAAATCTGCGAAAAATGCGTCAACGAT
TTTGGCGTACTTCATGGAAGTTGCCCGTTTGACTCAGATCAATTGTCGAA
TTTTATCATTTTTGAAAATGATCGCTCCATTGAATCGGAATTTCAATCTA
CGTTTAATACAGCATTTTTCAATGGAAACAATCGAGGAATGTCTAAATTA
ATTCAAGACTTTTTGGAAATCGATCACTTTTTAGATTAAAATGTATTAAT
ACTTGCT
back to top

protein sequence of SMED30010591-orf-1

>SMED30010591-orf-1 ID=SMED30010591-orf-1|Name=SMED30010591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=356bp
MDFDFETCCSVCYDSMDDNNIAIFQQCRHKICIICLHHLVFEKKFICPFD
RQPIFSVFTLNESRTLLWCQNQAFSNEELKIQDELECYWKSYVSVIIQSL
HFYIDTLEKVDLMLDTWISHAIPFDFYQINEFYNFINENLALIRNSLEED
LPSKPAKIKFIKEVLSHFPRQNNTPFINNIIFYRPDCPWSLIVYLFRISI
DLKNKKETQQNLLSEAKTCIENYKIKSSNFLLFLTGITISYFRDNKDIYE
GIHEGNKRIDENQCLICLDLINKNKFAKLSECQHKICEKCVNDFGVLHGS
CPFDSDQLSNFIIFENDRSIESEFQSTFNTAFFNGNNRGMSKLIQDFLEI
DHFLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 9..50
e-value: 0.021
score: 24.0
coord: 264..304
e-value: 1.8E-4
score: 30.9
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 9..51
score: 10.63
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 264..305
score: 10.247
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 243..332
e-value: 2.7E-7
score: 31.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 3..64
e-value: 6.4E-7
score: 30.6
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 282..291
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 27..36
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 257..308
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 7..55