Bridging integrator 3

Overview
NameBridging integrator 3
Smed IDSMED30010586
Length (bp)1141
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bridging integrator 3 (SMED30010586) t-SNE clustered cells

Violin plots show distribution of expression levels for Bridging integrator 3 (SMED30010586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bridging integrator 3 (SMED30010586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bridging integrator 3 (SMED30010586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30010586h1SMcG0001090 Contig3561GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30010586h1SMcG0001090 Contig3561GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30010586h1SMcG0001090 dd_Smed_v4_6339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bridging integrator 3 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:NCBI gene;Acc:595053])

HSP 1 Score: 66.2402 bits (160), Expect = 8.320e-12
Identity = 61/226 (26.99%), Postives = 113/226 (50.00%), Query Frame = 3
Query:  324 QMEKDSKKLNDTFAKSIEAE----RHIVNELADYVNNQTTK-----VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLN-SQLHNLKSELSIVRSD 968
            Q+E   KKL     KSIEA+    +  V   +D + N   +     +++V  LD+  ++  + NQ  +  +   ++ P KR+S  FP+L    K+R+Q LQE   L++K++K+E K++TG  I K H+ ++E +    +    N  ++++     N    FF  + +SL+++ +  +  +++    V        D ++L     E  N ++L  L+S LSIV  D
Sbjct:   47 QLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDADFLQMVTALDTAMKRMDAFNQEKVNQVQKTVMDPLKRYSSVFPSLNMAVKRREQALQEYKRLQTKVEKYEEKDKTGAMIAKLHQAREELRPVREDFEAKNRQLLDEMPKFYNSRTDFFKPSFQSLIRAQVVYYTEMSR----VFGDLAQQVDEVQLSDAEREQENEARLAELRS-LSIVADD 267          
BLAST of Bridging integrator 3 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:NCBI gene;Acc:595053])

HSP 1 Score: 65.0846 bits (157), Expect = 1.916e-11
Identity = 61/226 (26.99%), Postives = 113/226 (50.00%), Query Frame = 3
Query:  324 QMEKDSKKLNDTFAKSIEAE----RHIVNELADYVNNQTTK-----VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLN-SQLHNLKSELSIVRSD 968
            Q+E   KKL     KSIEA+    +  V   +D + N   +     +++V  LD+  ++  + NQ  +  +   ++ P KR+S  FP+L    K+R+Q LQE   L++K++K+E K++TG  I K H+ ++E +    +    N  ++++     N    FF  + +SL+++ +  +  +++    V        D ++L     E  N ++L  L+S LSIV  D
Sbjct:   32 QLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDADFLQMVTALDTAMKRMDAFNQEKVNQVQKTVMDPLKRYSSVFPSLNMAVKRREQALQEYKRLQTKVEKYEEKDKTGAMIAKLHQAREELRPVREDFEAKNRQLLDEMPKFYNSRTDFFKPSFQSLIRAQVVYYTEMSR----VFGDLAQQVDEVQLSDAEREQENEARLAELRS-LSIVADD 252          
BLAST of Bridging integrator 3 vs. UniProt/SwissProt
Match: sp|Q5PPZ5|BIN3_XENLA (Bridging integrator 3 homolog OS=Xenopus laevis OX=8355 GN=bin3 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.596e-10
Identity = 61/226 (26.99%), Postives = 115/226 (50.88%), Query Frame = 3
Query:  324 QMEKDSKKLNDTFAKSIEAE----RHIVNELADYVNNQTTK-----VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLN-SQLHNLKSELSIVRSD 968
            Q+E   KKL     KSIEA+    +  V   +D + N   +     +++V  LD+  ++  + NQ  +  I   ++ P KR+S  FP+L    K+R+Q LQ+   L++K++K+E K++TG  I K H+ ++E +   ++    N+ ++++     N    FF  + +SL+++ +  +  +++    V        D ++L     E  N ++L  L+S LSIV  D
Sbjct:   32 QLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDVDFLQMVTALDTAMKRMDAFNQEKVNQIQKTVMDPLKRYSSVFPSLNMAVKRREQALQDYKRLQTKVEKYEEKDKTGAMIAKLHQAREELRPVRDDFEAKNHQLLDEMPKFYNSRTDFFKPSFQSLIRAQVVYYTEMSR----VFGDLAQQVDEVQLSDAEREQENEARLAELRS-LSIVADD 252          
BLAST of Bridging integrator 3 vs. TrEMBL
Match: A0A0L8HRB7 (BAR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008269mg PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.022e-9
Identity = 48/170 (28.24%), Postives = 92/170 (54.12%), Query Frame = 3
Query:  318 CCQMEKDSKKLNDTFAKSIEAERHIVNEL-ADYVNNQTTKV--KLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLA 818
            C ++ KDSKK ++T +   + ER I  +L A  +    +K+     +W +SI +    M +    I   L+ P K+FS  FP+L    KKR+Q L+E    E+K++K++ +ERTG NI+K ++ ++           ++  ++ED   + +L   ++   +++L++S +A
Sbjct:   38 CRKLYKDSKKCSETASSLSKCERRITQDLMASTLCKSESKLMHHCEEWDNSIVKLNLHMQEMNSNIQKTLVEPVKKFSSIFPSLHAAKKKREQALEEYKRCEAKVKKYQDRERTGNNIVKLNQSQKSLTPAKEEFYELHTILMEDMPKLYDLRISYYQPCIEALIKSQVA 207          
BLAST of Bridging integrator 3 vs. TrEMBL
Match: A0A0L8HR21 (BAR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008269mg PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.345e-9
Identity = 48/170 (28.24%), Postives = 92/170 (54.12%), Query Frame = 3
Query:  318 CCQMEKDSKKLNDTFAKSIEAERHIVNEL-ADYVNNQTTKV--KLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLA 818
            C ++ KDSKK ++T +   + ER I  +L A  +    +K+     +W +SI +    M +    I   L+ P K+FS  FP+L    KKR+Q L+E    E+K++K++ +ERTG NI+K ++ ++           ++  ++ED   + +L   ++   +++L++S +A
Sbjct:   47 CRKLYKDSKKCSETASSLSKCERRITQDLMASTLCKSESKLMHHCEEWDNSIVKLNLHMQEMNSNIQKTLVEPVKKFSSIFPSLHAAKKKREQALEEYKRCEAKVKKYQDRERTGNNIVKLNQSQKSLTPAKEEFYELHTILMEDMPKLYDLRISYYQPCIEALIKSQVA 216          
BLAST of Bridging integrator 3 vs. TrEMBL
Match: A0A210PPC7 (Bridging integrator 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17253 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.714e-9
Identity = 44/189 (23.28%), Postives = 103/189 (54.50%), Query Frame = 3
Query:  270 RKIETSISQIEKIKNGCCQMEKDSKKLNDTFAKSIEAERHIVNELADYVNNQTTKV------KLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLA 818
            R++E  + ++E+++    ++ KD+K+  ++    I +E  I   L   +++Q  ++      ++  W  S+ +++  M +    +   ++ P K+F+  FP++ T  KKR+Q LQE    +SK++K++ ++RTGQN++K    ++  Q   +     N+ + ED   +++    +F  +L++L++S + 
Sbjct:   24 RELEKEVKKVERLEETSRKLYKDTKRWVESNQGVIASEHKITQNL---LSSQLCQMEPQLGAQITDWDRSLDKQELYMKELNTTVQRAVLEPMKKFNSIFPSIQTAVKKREQSLQEYNKCQSKVEKYQGRDRTGQNVIKMESSRKSLQSAKDEFETQNSALTEDLPKMIDGRVDYFQPSLEALIKSQVT 209          
BLAST of Bridging integrator 3 vs. TrEMBL
Match: A0A1L8GRN6 (BAR domain-containing protein OS=Xenopus laevis OX=8355 GN=bin3 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.278e-9
Identity = 65/231 (28.14%), Postives = 116/231 (50.22%), Query Frame = 3
Query:  312 NG-CCQMEKDSKKLNDTFAKSIEAE----RHIVNELADYVNNQTTK-----VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLN-SQLHNLKSELSIVRSD 968
            NG   Q+E   KKL     KSIEA+    +  V   +D + N   +     +++V  LD+  ++  + NQ  +  I   ++ P KR+S  FP+L    K+R+Q LQE   L++K++K+E K++TG  I K H+ ++E +    +    N  ++++     N    FF+ + +SL+++ +  +  +++    V        D ++L     E  N S+L  L+S LSIV  D
Sbjct:   27 NGKLQQLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDVDFLQMVTALDTAMKRMDAFNQEKVNQIQKTVMDPLKRYSSVFPSLNMAVKRREQALQEYKRLQTKVEKYEEKDKTGTMIAKLHQAREELRPVREDFEAKNRQLLDEMPKFYNSRTDFFNPSFQSLIRAQVVYYTEMSR----VFGDLAQQVDEVQLSDAEREQENESRLAELRS-LSIVADD 252          
BLAST of Bridging integrator 3 vs. TrEMBL
Match: A0A5G3KDK9 (BAR domain-containing protein OS=Xenopus tropicalis OX=8364 GN=bin3 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.306e-8
Identity = 61/226 (26.99%), Postives = 113/226 (50.00%), Query Frame = 3
Query:  324 QMEKDSKKLNDTFAKSIEAE----RHIVNELADYVNNQTTK-----VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLN-SQLHNLKSELSIVRSD 968
            Q+E   KKL     KSIEA+    +  V   +D + N   +     +++V  LD+  ++  + NQ  +  +   ++ P KR+S  FP+L    K+R+Q LQE   L++K++K+E K++TG  I K H+ ++E +    +    N  ++++     N    FF  + +SL+++ +  +  +++    V        D ++L     E  N ++L  L+S LSIV  D
Sbjct:   47 QLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDADFLQMVTALDTAMKRMDAFNQEKVNQVQKTVMDPLKRYSSVFPSLNMAVKRREQALQEYKRLQTKVEKYEEKDKTGAMIAKLHQAREELRPVREDFEAKNRQLLDEMPKFYNSRTDFFKPSFQSLIRAQVVYYTEMSR----VFGDLAQQVDEVQLSDAEREQENEARLAELRS-LSIVADD 267          
BLAST of Bridging integrator 3 vs. Ensembl Sea Lamprey
Match: bin3 (bridging integrator 3 [Source:ZFIN;Acc:ZDB-GENE-030131-2696])

HSP 1 Score: 54.299 bits (129), Expect = 2.464e-9
Identity = 30/102 (29.41%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  534 RFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNK 839
            RFS  FP+L    K+R+Q LQE   L++K++K+E +E+TG NI K H+ ++E +         N  ++E+   +      +F  + ++L++S +  +  ++K
Sbjct:    5 RFSSVFPSLNVAVKRREQALQECKKLQAKLEKYEEREKTGPNIAKTHQSREEMKPVREEFEQRNKALLEEMPQLYTSRADYFQPSFEALVRSQVNYYAEVSK 106          
BLAST of Bridging integrator 3 vs. Ensembl Medaka
Match: bin3 (bridging integrator 3 [Source:NCBI gene;Acc:101168469])

HSP 1 Score: 60.077 bits (144), Expect = 6.376e-10
Identity = 43/145 (29.66%), Postives = 82/145 (56.55%), Query Frame = 3
Query:  264 ISRKIETSISQIEKIKNGCCQMEKDSKKLNDT-FAKSIEAERHIVNELADYVNNQTTK-VKLVKWLDSISEKQKSMNQS-IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQE 689
            + R  E    +++K+++   ++ KD KK  +   A S  A +  V+ L++ +  Q    ++ +  LD+  ++  S NQ  +  I   +I P K++S  FP+L    K+R+Q LQ+   L+SK++K+E K++TG  ++K H+ K+E
Sbjct:   18 VERDFEREYDKLQKLEDQTKKLHKDMKKSTEADLAMSKAAVKISVDLLSNPLCEQDQAFLEAMSALDTAMKRMDSFNQEKVTQIQKTVIEPLKKYSGVFPSLNMAVKRREQALQDYKRLQSKVEKYEEKDKTGPVMVKLHQAKEE 162          
BLAST of Bridging integrator 3 vs. Planmine SMEST
Match: SMESG000029355.1 (SMESG000029355.1)

HSP 1 Score: 464.537 bits (1194), Expect = 5.804e-166
Identity = 250/264 (94.70%), Postives = 250/264 (94.70%), Query Frame = 3
Query:  195 MNNEKDFKVMYCINKFIKIRIQEISRKIETSISQIEKIKNGCCQMEKDSKKLNDTFAKSIEAERHIVNELADYVNNQTTKVKLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVXXXXXXXXXXXEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLNSQLHNLKSELSIVRSDNAVGDD 986
            MNNEKDFK              EISRKIETSISQIEKIKNGCCQMEKDSKKLNDTFAKSIEAERHIVNELADYVNNQTTKVKLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVNNLLLINNTIIEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLNSQLHNLKSELSIVRSDNAVGDD
Sbjct:    1 MNNEKDFK--------------EISRKIETSISQIEKIKNGCCQMEKDSKKLNDTFAKSIEAERHIVNELADYVNNQTTKVKLVKWLDSISEKQKSMNQSIKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKERTGQNILKAHEFKQEYQKGVNNLLLINNTIIEDGDLILNLAHPFFSITLKSLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLNSQLHNLKSELSIVRSDNAVGDD 250          
The following BLAST results are available for this feature:
BLAST of Bridging integrator 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bin38.320e-1226.99bridging integrator 3 [Source:NCBI gene;Acc:595053... [more]
bin31.916e-1126.99bridging integrator 3 [Source:NCBI gene;Acc:595053... [more]
back to top
BLAST of Bridging integrator 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5PPZ5|BIN3_XENLA2.596e-1026.99Bridging integrator 3 homolog OS=Xenopus laevis OX... [more]
back to top
BLAST of Bridging integrator 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8HRB71.022e-928.24BAR domain-containing protein OS=Octopus bimaculoi... [more]
A0A0L8HR211.345e-928.24BAR domain-containing protein OS=Octopus bimaculoi... [more]
A0A210PPC76.714e-923.28Bridging integrator 3 OS=Mizuhopecten yessoensis O... [more]
A0A1L8GRN69.278e-928.14BAR domain-containing protein OS=Xenopus laevis OX... [more]
A0A5G3KDK91.306e-826.99BAR domain-containing protein OS=Xenopus tropicali... [more]
back to top
BLAST of Bridging integrator 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bin32.464e-929.41bridging integrator 3 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Bridging integrator 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bridging integrator 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bin36.376e-1029.66bridging integrator 3 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of Bridging integrator 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029355.15.804e-16694.70SMESG000029355.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010586 ID=SMED30010586|Name=Bridging integrator 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1141bp
AATCTTTTGAATTAGGAATTATCAAAAATTCTATATTATTTATTAAATTA
CTTATTTTTTGTTTTTAAATATTATTATAGCGTAACACCTCACAAGATTT
TATCATTATTTTTTGTTGTTCTGAATTATTTTGTAAAGTTTTAAGACATA
AATTTTAGTTATTATTACTAATATATTAATTACAATTTTCACCAATGAAT
AACGAAAAGGATTTCAAGGTTATGTATTGTATAAATAAATTTATTAAAAT
AAGAATACAGGAAATTTCAAGAAAAATAGAAACTTCAATTAGTCAAATTG
AAAAAATCAAGAATGGATGTTGTCAAATGGAGAAAGATAGTAAAAAGCTT
AACGATACGTTTGCTAAATCTATAGAAGCTGAAAGACATATAGTTAACGA
ATTAGCCGATTACGTTAATAACCAAACAACAAAGGTGAAACTAGTAAAAT
GGTTAGATTCTATCTCGGAGAAACAGAAATCTATGAACCAGAGCATTAAA
ATTATTAATGACTTTCTGATCACCCCGGGAAAACGATTTTCTGAATTTTT
CCCAGCTCTCGTGACACTGAATAAGAAGCGAGATCAGCTACTGCAGGAAA
ATACAGCACTGGAATCAAAAATTCAGAAATTTGAATCAAAAGAAAGAACT
GGCCAGAATATTTTGAAGGCCCACGAATTTAAACAAGAATATCAAAAAGG
AGTCAACAATTTATTATTGATAAATAATACTATTATTGAAGATGGAGACT
TAATTCTCAATTTAGCCCATCCCTTTTTCAGCATTACTTTAAAGAGTCTA
ATGCAAAGCAATTTGGCATTGTTTGAAAGCCTAAACAAAGAAAGTCTTTT
GGTGTCTGAACTTTTTAACAATGATCCCGATCTTCTCAAACTTGGTTCCA
CTCCTGAAGAGCATCTGAACAGTCAGTTACATAATTTAAAATCCGAATTG
TCCATTGTCCGCAGTGACAACGCGGTTGGTGATGATTGATAATGAATTTT
TTTCTATTTATTTGCTTTGAATTGGATCTTTTGCCCGATAATGAAATTAT
TCTGATATAATAAAGATAGATTATATTTTTTTATTGCAAAATTTTTTCTT
GTAAATGCTTTTTTAGAATAAAAATATTTGCCGTAAAAAAA
back to top

protein sequence of SMED30010586-orf-1

>SMED30010586-orf-1 ID=SMED30010586-orf-1|Name=SMED30010586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=265bp
MNNEKDFKVMYCINKFIKIRIQEISRKIETSISQIEKIKNGCCQMEKDSK
KLNDTFAKSIEAERHIVNELADYVNNQTTKVKLVKWLDSISEKQKSMNQS
IKIINDFLITPGKRFSEFFPALVTLNKKRDQLLQENTALESKIQKFESKE
RTGQNILKAHEFKQEYQKGVNNLLLINNTIIEDGDLILNLAHPFFSITLK
SLMQSNLALFESLNKESLLVSELFNNDPDLLKLGSTPEEHLNSQLHNLKS
ELSIVRSDNAVGDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 78..105
NoneNo IPR availablePANTHERPTHR47174:SF3BRIDGING INTEGRATOR 3coord: 2..211
NoneNo IPR availablePANTHERPTHR47174FAMILY NOT NAMEDcoord: 2..211
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 1..181
e-value: 1.3E-11
score: 46.5
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 2..171