FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30010573
Length (bp)531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30010573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30010573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010573

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010573h1SMcG0007014 SmedASXL_010478SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010573h1SMcG0007014 dd_Smed_v6_20268_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30010573h1SMcG0007014 dd_Smed_v4_20268_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: delm-1 (DEgenerin Linked to Mechanosensation [Source:UniProtKB/TrEMBL;Acc:O45402])

HSP 1 Score: 55.4546 bits (132), Expect = 3.222e-9
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 1
Query:   46 TIS-KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCY----QYLEYNVIHPPRIL-SDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDP 351
            TIS K E   FCE TT+ G  RI K ++   +  WL    ++ +G +  +I+ C+     YL   ++     L  ++   FPS+TVCN+ P++++ +E M +     P
Sbjct:   63 TISVKRETQHFCETTTMHGPKRIFKGKRIFTKLFWL----IMVLGSLGLLIYQCWILSASYLSKPIVSQVSFLIPEDGMEFPSVTVCNFTPIRKSYIEAMNRTGDVSP 166          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: delm-2 (DEgenerin Linked to Mechanosensation [Source:UniProtKB/TrEMBL;Acc:P91103])

HSP 1 Score: 46.9802 bits (110), Expect = 2.024e-6
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = 1
Query:   43 KTISKE-EFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLF----IGFMVC-IIFLCYQYLEYNVIHPPRILSDNKA-PFPSLTVCNYRPMKRNILEIMKKRNIKDP 351
            +T+S E E   FCE TT+ G  RI + ++      W T F L+     IG ++  +  L   YL   V+     L + +   FP +T+CN+ P+++  +  M K     P
Sbjct:   57 ETVSVERETQHFCETTTMHGPKRIFQGKR------WATLFWLIMVCTSIGLLITQVCILASNYLSKPVVSDVSFLINEEGIQFPQITICNFTPIRKTFVNEMNKTGQISP 160          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 45.8246 bits (107), Expect = 5.901e-6
Identity = 31/115 (26.96%), Postives = 54/115 (46.96%), Query Frame = 1
Query:   16 LDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREF 360
            L S+ I    T  K  +  FC  T+  G+P +  S     R++W   F+ + + F++   +   +YL+Y  I   + L    A FP+ TVCN    K +  E+ +   IK+  ++
Sbjct:   48 LRSQKIDYHTTTIKSLWFDFCARTSSHGIPYVATS-SFFGRYVWAALFMCMLMAFLLQTYWTMSEYLQYRTIIEMQ-LQFEAAAFPAATVCNLNAFKYS--ELTQYEEIKEGFDY 158          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: acd-1 (pep chromosome:WBcel235:I:4103713:4108045:1 gene:WBGene00016064.1 transcript:C24G7.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acd-1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.974e-6
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFI----GFMVCIIF-LCYQYLEYNVIHPPRIL-SDNKAPFPSLTVCNYRPMKRN-ILEIMKKRNIKDP 351
            K E   FCE TT+ G  RI + ++      W T F L+ +    G ++  +F L  +YL    +     L +++   FP +T+CN  P+++  + EI K   +  P
Sbjct:   77 KRETQHFCETTTMHGPKRIFQGKR------WATLFWLIMVSCSLGLLITQVFILASEYLSKPTVSDVSFLINEDGMDFPLITICNLNPIRKTYVNEINKTGEVSPP 176          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 45.8246 bits (107), Expect = 6.413e-6
Identity = 31/115 (26.96%), Postives = 54/115 (46.96%), Query Frame = 1
Query:   16 LDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREF 360
            L S+ I    T  K  +  FC  T+  G+P +  S     R++W   F+ + + F++   +   +YL+Y  I   + L    A FP+ TVCN    K +  E+ +   IK+  ++
Sbjct:   88 LRSQKIDYHTTTIKSLWFDFCARTSSHGIPYVATS-SFFGRYVWAALFMCMLMAFLLQTYWTMSEYLQYRTIIEMQ-LQFEAAAFPAATVCNLNAFKYS--ELTQYEEIKEGFDY 198          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cldn16 (claudin 16 [Source:Xenbase;Acc:XB-GENE-971823])

HSP 1 Score: 55.0694 bits (131), Expect = 1.051e-8
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR + ++   WL  F+  F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:    8 EKEPLIEFFSSYRELFEFFCSNTTIHGAIRLVCSRSNRMKTAFWLVLFLATF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cldn16 (claudin 16 [Source:Xenbase;Acc:XB-GENE-971823])

HSP 1 Score: 52.7582 bits (125), Expect = 5.507e-8
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR + ++   WL  F+  F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:   12 EKEPLIEFFSSYRELFEFFCSNTTIHGAIRLVCSRSNRMKTAFWLVLFLATF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 112          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cldn16 (claudin 16 [Source:Xenbase;Acc:XB-GENE-971823])

HSP 1 Score: 52.7582 bits (125), Expect = 5.899e-8
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR + ++   WL  F+  F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:    8 EKEPLIEFFSSYRELFEFFCSNTTIHGAIRLVCSRSNRMKTAFWLVLFLATF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cldn16 (claudin 16 [Source:Xenbase;Acc:XB-GENE-971823])

HSP 1 Score: 52.373 bits (124), Expect = 6.765e-8
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR + ++   WL  F+  F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:    8 EKEPLIEFFSSYRELFEFFCSNTTIHGAIRLVCSRSNRMKTAFWLVLFLATF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cldn16 (claudin 16 [Source:Xenbase;Acc:XB-GENE-971823])

HSP 1 Score: 52.373 bits (124), Expect = 6.842e-8
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR + ++   WL  F+  F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:    8 EKEPLIEFFSSYRELFEFFCSNTTIHGAIRLVCSRSNRMKTAFWLVLFLATF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 45.8246 bits (107), Expect = 2.606e-6
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:    4 EPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRH-----LWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMK 306
            +P+E + E +I F    +E F  FC NTT+ G  R+V S+ + ++      LWL  F +++  F +    L  +Y  Y V     + SD K  FP++TVC   P +
Sbjct:   24 QPTE-EEEALIEFHRSYRELFQFFCNNTTIHGAIRLVCSKHNRMKTAFWAVLWLCTFGMMYWQFAL----LFEEYFSYPVSLNINLNSD-KLVFPAVTVCTLNPYR 123          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51167|SCNNA_XENLA (Amiloride-sensitive sodium channel subunit alpha OS=Xenopus laevis OX=8355 GN=scnn1a PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.663e-8
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 1
Query:   19 DSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCY-QYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + E +I F +  +E F  FC NTT+ G  R+V SR++ ++   WL  F++ F G M     L + QY  Y V     + SD K PFP++TVC   P +   ++
Sbjct:    8 EKEALIEFFSSYRELFEFFCSNTTIHGAIRLVCSRRNRMKTAFWLVLFLVTF-GLMYWQFGLLFGQYFSYPVSINLNVNSD-KLPFPAVTVCTLNPYRYKAIQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O97741|SCNNA_RABIT (Amiloride-sensitive sodium channel subunit alpha OS=Oryctolagus cuniculus OX=9986 GN=SCNN1A PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 8.955e-6
Identity = 35/106 (33.02%), Postives = 54/106 (50.94%), Query Frame = 1
Query:    4 EPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRH-----LWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMK 306
            +P+E D E +I F    +E F  FC NTT+ G  R+V S+ + ++      LWL  F +++  F +    L  +Y  Y V     + SD K  FP++TVC   P +
Sbjct:   20 QPTE-DEEALIEFHRSYRELFQFFCNNTTIHGAIRLVCSKHNRMKTAFWAVLWLCTFGMMYWQFGL----LFGEYFSYPVNLNINLNSD-KLVFPAVTVCTLNPYR 119          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A448WUF1 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS13975 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.324e-44
Identity = 78/158 (49.37%), Postives = 108/158 (68.35%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            + E L+FC+NTT+RGVPRIVK+R   ++ LW+ F +LLF G  VC+ FL  QYL Y+VIHPPR+L D+ +PFPS+T+CN RP+    +E +  + +K PR FA  +N  A  +YY +NL + YQ  +S ++MG YLES+P    + LGH   D IIYC
Sbjct:   15 RYELLQFCQNTTIRGVPRIVKARNKTLQTLWIVFEVLLFFGCFVCMFFLARQYLAYDVIHPPRVLRDSPSPFPSITICNLRPISSKGIENLSMQRLKVPRTFAEDVNAAAAYFYYHRNLKEKYQYVTSALSMGGYLESLPEGVASTLGHSLNDTIIYC 172          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A448WAD7 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS383 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 9.963e-43
Identity = 78/167 (46.71%), Postives = 111/167 (66.47%), Query Frame = 1
Query:   31 IINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQ 531
            ++ F    + EF  FCENTT+RGVPRI K++   I  LWLTF +LLF+G  VC+ FL  QYLEY+VIHPPR+L D  +PFP+LT CN RP+K      +++   +DPR+F+  +N+YA +  +K N   +YQR S  ++MG+YL S+  + + E+GH   + II CQ
Sbjct:  159 LLRFCARVRREFRVFCENTTIRGVPRIAKAKSKPILSLWLTFVLLLFVGLFVCMFFLARQYLEYDVIHPPRVLRDANSPFPALTFCNLRPLKPAAKTFIQRSGWRDPRQFSQRLNEYAGELLFKANRKPDYQRMSVAISMGSYLASLGEQYYQEMGHTLNESIIQCQ 325          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3X1H7 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7043 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.155e-42
Identity = 75/158 (47.47%), Postives = 108/158 (68.35%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            K+EFLRFC+ TT+RGV RIV S    IR LWLTF I L+IG   C+I L  QY +Y+VIHPPR+L D  +PFPSLT+CN RP+    ++ +++   +DPR+FA ++N++A   Y+ +N   +Y+  SS ++MG YLES+P  +   LGH + + +I C
Sbjct:   14 KQEFLRFCQTTTIRGVSRIVNSPNKGIRSLWLTFVISLYIGLFTCMIILASQYFDYDVIHPPRVLRDTPSPFPSLTLCNLRPLSPPGIKRIRQLQFRDPRDFAKNLNEFAAGLYFYRNRSHDYELVSSAISMGGYLESLPKGSSYSLGHLQNETVIQC 171          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: W6UN59 (FMRFamide-activated amiloride-sensitive sodium channel OS=Echinococcus granulosus OX=6210 GN=EGR_05521 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 7.601e-42
Identity = 76/158 (48.10%), Postives = 109/158 (68.99%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            K+EFLRFC+ TT+RGV RIV SR   IR LWLTF I L+IG   C+I L  QY +Y+VIHPPR+L D  +PFPSLT+CN RP+    ++ +++   +DPR+FA ++N++A   Y+ +N   +Y+  SS ++MG YLES+P  +   LGH + + +I C
Sbjct:   14 KQEFLRFCQTTTIRGVSRIVNSRNKGIRSLWLTFVICLYIGLFTCMILLASQYFDYDVIHPPRVLRDTPSPFPSLTLCNLRPLSPPGMKRIRQLQFRDPRDFAKNLNEFAAGLYFYRNRSHDYELVSSAISMGGYLESLPKGSSYSLGHLQNETVIQC 171          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183VLR9 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS1425 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 9.003e-42
Identity = 74/158 (46.84%), Postives = 104/158 (65.82%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            K+E L FC+ TT+RGV R+V +R   ++ LW+   IL F G  VC+  L  QYLEYNVIHPP++L D  +PFPSLT+CN RP+      I++K  +K PR+FA  +N +A K YY  N   +YQ+ +S ++MG YLES+P     +LGH+  D +I+C
Sbjct:   21 KKELLYFCQTTTIRGVTRVVNARNQTLQSLWIGSVILFFGGLFVCMFILTRQYLEYNVIHPPQVLRDTLSPFPSLTLCNLRPLSSEAKSILEKYKLKSPRQFATDVNNFAAKAYYYNNEEHSYQQVTSAISMGGYLESLPKSVVPKLGHNLSDTVIHC 178          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 46.9802 bits (110), Expect = 7.473e-7
Identity = 26/98 (26.53%), Postives = 49/98 (50.00%), Query Frame = 1
Query:   31 IINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIR-HLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILE 321
            + +F     E F  FC+NTT+ G  R+V S+++ ++   W   F +  I F      +  QY  Y V     ++   ++ FP++TVC+  P +  +++
Sbjct:   12 VTDFYDSYDEMFEFFCDNTTIHGTIRLVCSKRNKLKTAFWSLLFTVTVILFYYTSALVFLQYYSYTVAVTMGLMF-QQSTFPAITVCSLNPYRYEVVQ 108          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 325.094 bits (832), Expect = 1.494e-109
Identity = 177/177 (100.00%), Postives = 177/177 (100.00%), Query Frame = 1
Query:    1 MEPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQ 531
            MEPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSINKYAIKYYYKKNLGKNYQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQ
Sbjct:    1 MEPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSINKYAIKYYYKKNLGKNYQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQ 177          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000028687.1 (SMESG000028687.1)

HSP 1 Score: 192.971 bits (489), Expect = 1.395e-58
Identity = 101/163 (61.96%), Postives = 128/163 (78.53%), Query Frame = 1
Query:   43 KTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYCQ 531
            + + KEEFLRFCENTT+RGVP+I+KS+   +R++W+T FILL  GF VC IFL  QY  Y+VIHPPRIL++++APFPS TVCN RP+ RNI  I K +N+K PREFA ++N YAIKY+Y KN    Y  ASSIM MG YLESVPN+++ ELGH +QDLII+C+
Sbjct:   39 RQVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYVELGHKKQDLIIHCR 201          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000078360.1 (SMESG000078360.1)

HSP 1 Score: 152.14 bits (383), Expect = 4.458e-43
Identity = 74/159 (46.54%), Postives = 113/159 (71.07%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXX-XXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            K E + FC+NTT+RG+PRI+K++  ++R LW+TF ++LFIG ++ ++FL  QYLEYNVIHPP IL D + PFPS+++CN RP+ R  LE +KK N ++PREF +++N Y     YY ++    Y + ++ ++M  YLESVP    ++LGH   +L+I+C
Sbjct:   77 KHELIAFCQNTTMRGIPRIIKAQSRNLRILWITFVVILFIGLLLSMLFLTKQYLEYNVIHPPVILPDQEPPFPSISLCNLRPLSRFGLEFLKKNNWRNPREFGNNLNVYVANKWYYNQSTKHYYTQFTTAISMNGYLESVPFDVLDKLGHSLDELVIHC 235          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000069611.1 (SMESG000069611.1)

HSP 1 Score: 151.369 bits (381), Expect = 4.970e-43
Identity = 77/176 (43.75%), Postives = 113/176 (64.20%), Query Frame = 1
Query:   10 SELDSEIIIN---FKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRTFNELGHDEQDLIIYC 528
            +++  E I+N   FK + K E L FC+NTT+RGVPRIV +     + LW++FFI L  G  +C+ FL  Q++EY+VIHPPR+L ++ +PFPS TVCN+RP+  NI     +RN+++PREFA + N  + KY + +    +Y   +S  ++  YLES+P    N LGHD  D +I C
Sbjct:   34 NQIQEEAILNSPTFKKLLKNELLHFCKNTTIRGVPRIVNTTNKSSKILWISFFIFLCAGLTICLTFLIRQFIEYSVIHPPRVLQNSPSPFPSFTVCNHRPLSYNISSFFNQRNMRNPREFAIAANYVSKKYLFDRGDKGHYSLITSSFSLSGYLESIPLEYHNMLGHDYYDFVIDC 209          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000037525.1 (SMESG000037525.1)

HSP 1 Score: 145.976 bits (367), Expect = 3.779e-41
Identity = 82/160 (51.25%), Postives = 116/160 (72.50%), Query Frame = 1
Query:   55 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSXXXXXXXXXXXXXXXXXXQRASSIMNMGAYLESVPNRT-FNELGHDEQDLIIYCQ 531
            K+EFL FC+NTT+RGV RIVKS    I  LWL FFI+L IG +VC+I L  QYL+YNVIHPPR+LS+ ++PFPS T+CN RP+  ++   +    +++PREFA  +N+YA+  Y KKN   +Y  +++I +MG YLES+PN + F ELGH   +++I+C+
Sbjct:   71 KKEFLLFCQNTTIRGVSRIVKSTDKKIFFLWLGFFIILCIGLLVCMILLLLQYLDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCK 230          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
delm-13.222e-930.56DEgenerin Linked to Mechanosensation [Source:UniP... [more]
delm-22.024e-629.09DEgenerin Linked to Mechanosensation [Source:UniP... [more]
unc-85.901e-626.96Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
acd-15.974e-628.30pep chromosome:WBcel235:I:4103713:4108045:1 gene:W... [more]
unc-86.413e-626.96Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn161.051e-834.95claudin 16 [Source:Xenbase;Acc:XB-GENE-971823][more]
cldn165.507e-834.95claudin 16 [Source:Xenbase;Acc:XB-GENE-971823][more]
cldn165.899e-834.95claudin 16 [Source:Xenbase;Acc:XB-GENE-971823][more]
cldn166.765e-834.95claudin 16 [Source:Xenbase;Acc:XB-GENE-971823][more]
cldn166.842e-834.95claudin 16 [Source:Xenbase;Acc:XB-GENE-971823][more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scnn1a2.606e-632.08sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P51167|SCNNA_XENLA3.663e-834.95Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|O97741|SCNNA_RABIT8.955e-633.02Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WUF12.324e-4449.37Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A448WAD79.963e-4346.71Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A0R3X1H74.155e-4247.47Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
W6UN597.601e-4248.10FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A183VLR99.003e-4246.84Uncharacterized protein OS=Trichobilharzia regenti... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCNN1A7.473e-726.53sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044381.11.494e-109100.00SMESG000044381.1[more]
SMESG000028687.11.395e-5861.96SMESG000028687.1[more]
SMESG000078360.14.458e-4346.54SMESG000078360.1[more]
SMESG000069611.14.970e-4343.75SMESG000069611.1[more]
SMESG000037525.13.779e-4151.25SMESG000037525.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010573 ID=SMED30010573|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=531bp
ATGGAACCGTCGGAATTGGATTCAGAAATAATAATTAATTTTAAAACCAT
ATCAAAAGAGGAATTTCTGAGATTCTGTGAAAACACAACTTTGCGTGGCG
TGCCACGAATTGTTAAATCCCGTAAATCTCACATTCGTCATTTGTGGTTA
ACCTTTTTCATCCTTCTGTTCATTGGGTTTATGGTTTGCATAATTTTCCT
CTGTTATCAATATTTGGAATACAATGTCATTCATCCGCCTAGAATTCTCA
GTGACAATAAGGCTCCGTTTCCTTCTTTGACTGTCTGCAATTATCGACCC
ATGAAAAGAAATATTTTAGAAATTATGAAGAAACGAAATATAAAAGACCC
GAGAGAATTTGCTCACAGTATAAATAAATATGCAATAAAGTATTATTATA
AGAAAAATTTGGGAAAGAACTATCAAAGAGCTTCTAGCATAATGAATATG
GGAGCTTACTTGGAGAGTGTACCAAATAGAACGTTTAATGAGCTAGGACA
CGATGAACAGGATTTGATAATATATTGCCAG
back to top

protein sequence of SMED30010573-orf-1

>SMED30010573-orf-1 ID=SMED30010573-orf-1|Name=SMED30010573-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MEPSELDSEIIINFKTISKEEFLRFCENTTLRGVPRIVKSRKSHIRHLWL
TFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRP
MKRNILEIMKKRNIKDPREFAHSINKYAIKYYYKKNLGKNYQRASSIMNM
GAYLESVPNRTFNELGHDEQDLIIYCQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 99..167
e-value: 4.3E-13
score: 51.0
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 76..177
e-value: 4.3E-13
score: 51.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 46..75
e-value: 4.3E-13
score: 51.0
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 18..125
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 25..177
e-value: 2.4E-21
score: 76.2
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 18..125