SMED30010561

Overview
NameSMED30010561
Smed IDSMED30010561
Length (bp)18148
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010561 (SMED30010561) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010561 (SMED30010561) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010561 (SMED30010561) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010561 (SMED30010561) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010561

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30010561SMESG000066271.1 SmedASXL_010407SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SmedASXL_007592SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SmedASXL_007591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SmedASXL_002117SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SmedASXL_017609SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SmedASXL_008725SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
secretory cellSMED30010561SMESG000076582.1 AY068370.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal cellSMED30010561SMESG000076582.1 AY068370.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010561SMESG000076582.1 Contig16817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010561SMESG000076582.1 Contig16817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010561SMESG000076582.1 Contig32975uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010561SMESG000076582.1 Contig32975newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v6_2649_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010561SMESG000076582.1 SMESG000066271.1 OX_Smed_1.0.10176ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010561SMESG000076582.1 OX_Smed_1.0.19671ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
parapharyngeal cellSMED30010561SMESG000076582.1 SMESG000066271.1 dd_Smed_v4_2649_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30010561 vs. Ensembl Human
Match: FBN1 (fibrillin 1 [Source:HGNC Symbol;Acc:HGNC:3603])

HSP 1 Score: 499.59 bits (1285), Expect = 1.002e-140
Identity = 702/2410 (29.13%), Postives = 976/2410 (40.50%), Query Frame = -1
Query: 1337 NAFCKNTIGSFSCSCKEGFEGN-GVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQ--GDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTV------------QCTKP-----------------------------NEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCD--ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD--GSVCSE----------ID-ECLLGLHNCSRSHQFCFNVNGGFECRCL---------SGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYI--GSGRNCDPQEGLEEC------GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQ-IENYCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS-CRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-------ETNNVCNCGSHGICGPNYICQCKSGYEINPS-GMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFED--KCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI----VNVESSIYECQCHTEF-----------------------SGD-GITSCI--------KNNLCFVNGKSSCHENAICEQVNAT-YRCICP--DGFQGDGYN-FCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGT------TCGDEDECKKPKGSPGAPECDENA-VCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGN-TCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSC---AMGLDNCDRKVEDCISSKDSSYTCQCIEGF-QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT-GDGIYSC--IETDSCPAR-DDVKCPTGSYCNMIGNFIYCNCTN-GYEDSNQM------ECIGDVCY----------KKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGK-CENINECEEKSDNCSINSV-CQDKADGFSCQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHGFSL----------QGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANG------------------ARQLPNGDCELINECLENIDRCQVLNGA--DSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYEN---SGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGIC 7921
            N  C  T GS+ C C +GF+ +    C +++EC   +PC  A  EC +    Y C+C+ G+    T   C D +EC   G +C+  +  C NT GS+ C C  GF  +  D   C D++EC++ + C      C N  GS+ C C  G+Q   DGR C DI+EC +  +C   +  CVN  GSY C C  G   G DG    +T             QC KP                             N   Y   C    G      T+   DI+EC    + C      C NL G+Y+C C  GY + S  K C +INEC+ N   C +N +C +T G + C C  GF    D   C DIDEC  S          C+NS GSF C C+   + D   ++C E          ID  C + ++  +   Q C ++   +   C           GY       C D +EC  F   C  N  C+NT GSF C C +G     +GR C     LE C       +   P+        C C  G    T +C   +EC  + + +    C    G          I +G   FK   D + C+ I + CT G C + I    C C SGF                                      L S+   C DIDEC  + D C     C N  G ++CKC   Y   F   K CM +   Q +     G  C+N  GS  C      Q   + +     N       +CP N  C   +  Y C C PGY     +  C DIDEC   I N      C+N+EGS+ CSC+ G++       C       +  N+C+ G        Y C C  G+  +     C DVNEC       +   C NT GS+ C C   + G        D  +C+  A  C    VC  +  GS   K SC+   I    +C  +++     + C  HA CK   G   C C  GY GDG  C D+DECS     C N   C N  G + C C++GF    +     +C DIDEC L   C   G C N  G F+CEC+ G+  D     R    C     C +  +CI    VN   S Y C C  +F                        GD G T+C         K + C   GK+      +C  VN + Y+ +CP  +GF+ +       DIDEC            KC+N+ G + C C  G    +D  +C D++EC   +T        C N  G Y+C C   +     G  C D+       + C  N    N+       C    L N T      +        KP      P  DE A +C ++ PG+  +  +G       C      ++P  C+ N  C   N      CEC   F   +    C    EC+N    C R  + C+     ++C+CKPG+       C D+NEC    P+      + S G C++T GSF C C+   + N++ + C  I+ C   A G   C   +         S+ C+C  GF    N  C+DVDECA    +   N  C N +GS+ C+C +  ++    + C D NEC   P  C     C N DGSY C C  GY      CEDIDEC  +   C  L  CSN  GS KC C  GF+       C  +    C A+ +  KC +    N       C     G+ D  ++      E    +C               D+DEC  ++    K  +C N DG+Y C CP      G   C D +EC++     N             NV+  F+C C  G+   P    C + NEC    +N  +    C++T GSYEC+C  G+      + C++ +ECEE   +C+   + C++    + C C PG++   +    C D +EC T P  C    +  C+N  GS+ C C  GF+           + GYC    E ++ N C   S   N V+   C C  G                   +  P+G   + N    +ID C+V++    +  C +    Y C+C  G+  D +    C + NEC      C   N  C +T GS++C C  G+    DG  C D DEC  ++Q N +F     C+NT GGFTC CP GF  ++  CID +EC+ D       N     G C NT G F C C RGF + +  + C D+DEC+  + C  G C N+ G + C C  GY       +C D NEC + + ICG      C N  GS++C C  G++    SGG     CQ +NEC       P +  C +   GY C C  GY     G C
Sbjct:  462 NGRCIPTPGSYRCECNKGFQLDLRGECIDVDECEK-NPC--AGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICN--NGRCINTDGSFHCVCNAGFHVT-RDGKNCEDMDECSIRNMCLN--GMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICM--NGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGM-----TSAGSDINECALDPDICP--NGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESS----PCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCK-NGLCVNTRGSFKCQCPSGMTLDATGRICLDIR-LETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEEC---EECPMRNTPEYEELCPRGPGFAT-----KEITNGKPFFK---DINECKMIPSLCTHGKCRNTIGSFKCRCDSGFA-------------------------------------LDSEERNCTDIDECRISPDLCGRGQ-CVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCP-NGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDEC--SIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCT-NTAGSF--KCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQ-CLNAPGGYRCECDMGFVPSADG---KACEDIDECSLPNICVF-GTCHNLPGLFRCECEIGYELD-----RSGGNCTDVNECLDPTTCISGNCVNTPGS-YICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDEC--QELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNEC---ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRR-----SLCYRNYYADNQ------TCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECR-----EIPGVCE-NGVCI--NMVGSFRCECPVGFFYNDKLLVCEDIDECQNGP-VCQR-NAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEI-PN------ICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTI--------GSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAP-GTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICA-LGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDEC--KEPDVCKHGQCINTDGSYRCECPFGYILAGNE-CVDTDECSVGNPCGN---------GTCKNVIGGFECTCEEGFEPGP-MMTCEDINEC---AQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGE-GCVDENECQTKPGICE---NGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYC--FTE-VLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG--ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPD-ITGTSCVDLNECNQAPKPC---NFICKNTEGSYQCSCPKGYILQEDGRSCKDLDEC-ATKQHNCQF----LCVNTIGGFTCKCPPGFTQHHTSCIDNNECTSDI------NLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLS-AHICG---GASCHNTLGSYKCMCPAGFQYEQFSGG-----CQDINECGSAQA--PCSYGCSNTEGGYLCGCPPGYFRIGQGHC 2686          

HSP 2 Score: 412.149 bits (1058), Expect = 5.121e-114
Identity = 648/2310 (28.05%), Postives = 922/2310 (39.91%), Query Frame = -1
Query: 2153 YGCHCKNGFMGDGIM--CKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAK-----------------CTNT---------------PGSYYCTCDSGYQGDGRNCTDIDECSSNK-VCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTVQCTKPNEICYLGQ---------CFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXX-----------XNLHQCGENAECIDTDGGYY------CQ----CKTGFTG-HCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD--GSVCSEI-----------DECLLGLHNCSRSHQFCFNVNGG----------------FECRCLSG----YKSDTNGSCV--DENECRFFDNGCDDNADCINTDGSFLCICRAGYI--GSGRNCDPQEGLEEC--GKLLCPLNALCVNST----CLCKSGYENS---TNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGY-IGDGINCFKKDTDTDACQIENY-CTDGDCYDGI----CHCPSGFVFKSNKCF----DE------RCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGS----CSCLMGLNSQ------TD----DDGNLNCSKNSA----------SCLPG-------------------ICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCE------TNNVCNCGS-HGICGPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDP---------QNKCFED----------KCKTKALQCQAGEVCKLSL---YGSVCE----------KISCNSSEILINN----------ECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYY--GDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECL-----LSESCATNGE-----------CQNTIGS----------------FKCEC---KDGFIGDGKYDCRID-SKCEKYGGCHEDASCIVNVESSIYECQCHTE-FSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCH-----DIDECKFGVANCSENALCINKPGTFACECQAG--TLGNGTTCGDEDEC--KKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN---------MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDIDECAIKTHPCHD-LARCSNVPGSCKCKCQPGFT----GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDS-NQMECI-------------------------------------------------GDVCYKKC-----------SDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGD-GKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGF--SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGAR-QLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVN 8014
            Y C C+ G+        C+DIDEC  N  +C+ N  C NT GSF C C  GF    +G  C +++EC   + C N    C ++   ++C C+ GF   +    C D NEC +T  +C  ++  C NT GSYRC+C  G     +D  VC D    ++   C   Y +                 C +T                  Y   C SG  G     +DI+EC+ +  +C  P+  C NL G+Y+C C  G      G N  +  +C   + +C  GQ         C C  GF        CEDIDEC+++   C      C N  GS+ CEC     +     IC    +              N++     ++C  + G  +      CQ    C  G++     +C DIDEC      C +    C N+ GSF C+C  G + D  G +C +I           +EC L +    R    C +V                   +E  C  G     K  TNG     D NEC+   + C  +  C NT GSF C C +G+      RNC     ++EC     LC     CVN+     C C  GYE+       C++ DEC+          C +T GS+ C C  G+ +   I+      D + C++  + C +G C + I    C C  G+    ++ F    DE       CE  C  +       GS  CSC  G +L  D   C DIDEC +N + C +   C N  G Y C C   ++   +D K C+ V     N +      C N      C C MG + +      TD    + G  NC K++           SC PG                   +C  +A+C+  +  Y C CK GY G G  +C D+DEC   +N C  N  C N  G + C C  G+  ++    CE        N+C  G+ H + G  + C+C+ GYE++ SG  C DVNEC   + C I   C+NTPGSY C CP +F  +P            C+ D           C  +     +   C  SL   +G+ CE          KI C   E    N          EC  +  +CQ   C N        G   C C +GYY   D  +C DV+EC    +  P    C N  G++ C C   + ++      ++C D+   L      +++   +GE           C   IG                 F   C   + GF+ D      +D  +C +  G  E+  CI  V S  + C+C    F  D +  C   + C       C  NA C     +YRC C  G++      CND +EC      N  S  +C+++ G + C+C  G    DD  +C+DI+EC  +       N  C+N  G+++C+C  GF    +L H     D+DEC  G  N   N  CIN  G+F C+C  G     +G TC D +EC  +  K +PG         C+N D  Y C C  GY      C     C + P  C A  TC  SN      C C   F L +        C+      D   S C     G KC      N         + G    D  E  PT PD A ++    G G +            +    +   CK  D C  G          CI++ D SY C+C  G+      CVD DEC+  + +   N TC N+IG + C C +  +       C D NEC +NP++C    +C+NT GSYEC+C  GY  + +   C+D DEC    H C +    C N+ G+  C C PG+     G+G   C++ + C  +  + C  G   N  G++  C C +G+  S NQ EC+                                                 G V +KK            +DIDEC      C    EC N+ G+Y C C +  T D   T+C D NEC      CN     C+N + +      +QC C  GY+     + C + +EC     N      +C++T G + C+C  GF Q  +  C + NEC    + C    +CQ+    F+C+C+ GF   D+T  +CED+DEC     C       C N  G + C CP G+    Q   C D NECL  + CG  S C NT+  + C C  G + +  +G C+ INEC      C         C +   GY C CP G+  
Sbjct:  511 YTCQCRAGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGM--CINEDGSFKCICKPGFQLASDGRYCKDINEC-ETPGIC--MNGRCVNTDGSYRCECFPGLAVG-LDGRVCVDT---HMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSG-PGMTSAGSDINECALDPDIC--PNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSP--CI--NGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKN--GLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLC-THGKCRNTIGSFKCRCDSGFALDSEERNC---TDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC---IDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSE------GSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFM-ASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGF-TCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL-FRCECEIGYELDRSGGNCTDVNECLDPTTC-ISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTF------GSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGT--CYNTVGNYTCICPPDYMQVNGG---NNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGS--FRCECPVGFFYNDKLLVCEDIDEC--QNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNEC--QEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDAC----GNGTCRNTIGSFNCRCNHGF----ILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPG--------TCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEIC-ALGTC--SNTEGSFKCLCPEGFSLSSS----GRRCQ------DLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGII---------VGPDDSAVDMDECKEPDVCKHG---------QCINT-DGSYRCECPFGYILAGNECVDTDECS--VGNPCGNGTCKNVIGGFECTCEEGFEPG-PMMTCEDINECAQNPLLCA--FRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEG---CVDENECQTKPGI-CENGRCLNTRGSYT-CECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRN-GECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNF---ICKNTEGS------YQCSCPKGYILQEDGRSCKDLDECATKQHNC---QFLCVNTIGGFTCKCPPGFTQHHT-SCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSL-DQTGSSCEDVDECEGNHRC----QHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGAS-CHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSY------GCSNTEGGYLCGCPPGYFR 2680          

HSP 3 Score: 385.571 bits (989), Expect = 6.014e-106
Identity = 506/1754 (28.85%), Postives = 712/1754 (40.59%), Query Frame = -1
Query: 1238 YICKCKPGYEGVGIKS-CRDIDEC--GGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVC---NCGSHGIC---GPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQC-PENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCE-KISCNSSEILINNECLPVNQVCQNINCGNHAFCKIEN-GRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNV---ESSIYECQCHTEFSGDGI-TSCIK-----------NNLCFVNGKSSCHENAICEQVNATYRCICP----DGFQGDGYNF-----CNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVY--VDDICVDI-----------DEC------------------SSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL-----LCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNG--TTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPS---NENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT--CQDKNECDPTSPDFAAQKCLASGG---GCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRIN--GSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCP-SYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTN-PTSCSSMPHSICMNNPGSFECVCPHGFSL--QGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNG----------------------DCELINECLENIDRCQ--VLNGADSVCYDLPIG----YACVCPD---GFVND------------EVFPQVCEN----------QNECEI------------NIHSCQ-----ASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECE---------------------------ISEQSNM---------KFCNNGKCINTAGGFTCDCPEGFIY-NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENS-------------------GGKSYNPCQSVNE-----CVKLN--------ITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGY 5803
            Y C+C+ GY+    ++ CRDIDEC   G+I N   N  C NT+GSF C C  G+        CE  + C   N   +G+C     ++ C CK G+++   G  C+D+NEC+T   C +  +C+NT GSY+C+C P    G     C +   ++          C   L+G+V + +  C S+E      C P               C  +N       C SG  G      D++EC+     CPN   C+N  G++ C CN G+   E      +C DI+EC+L+     NG+C+NT GSF C C  GFI   K D +    CE    C E + CI  V       + C+C +E + D   T CI+           +  C +N   +  ++  C  + A +   C     D   G GY+      C DIDEC        + L  CVN+ G + C C  G        IC+DI           +EC                  ++  T +C    +    E    C    GF    +        DI+ECK   + C+ +  C N  G+F C C +G   +     C D DEC+       +P+      C N    + C+C  GY+ +G+  +K    D+    +    C      N      CEC P  +L  +   CI   ECE     C      CV L   ++C C PG++   +   C D +EC            + +GG    C N++GS+ C+C     +  +  SC  ID C    + CD       ++    Y C C +GF       +CVDV+EC    + C +  TC N  GS++C C         K  CTD NEC+     CG  + C NT GS++C C  G+  +G  C D+DEC+  TH C   A C N  GS +C C+ G+TGDG ++C + D C              N+ GN    N   GY     M  +     K C DIDEC +  + C  F  C N  G + C C   Y        C D NEC L+  TC           N VN    + C C       P  ++   +  C++    +C  +       G   C  + G     +  C ++   +     C +            C    GF+ +  T +  EDIDEC   P  C       C+N  GSF+C CP G+ L      C+D+NEC  P  CG  + C NTV  + C C     Q+  G                      D EL+    + +  C   +    +  C   PI     +A +C     GFV D               P VCEN          + EC +            +I  CQ       N+EC++T GS++C CKPG+   S G C D +EC+                            ++   M           C NG C NT G F C C  GFI  +N DCIDVDEC+    S   + C   NG CINTVG FQC CN G+ +  +   CVDI+EC   P  C  G C NL GS+ C+C  GY L N KC DI+EC    +IC   A G C N  GSF+C C  G+  S                   GGK  +P +S N      C  L           CP+     D +    C    G          +++EC+  D C +   C++TDGSY+C C +GY
Sbjct:  511 YTCQCRAGYQSTLTRTECRDIDECLQNGRICN---NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGIC-MNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQP---------------CPAQNSAEYQALCSSGP-GMTSAGSDINECALDPDICPN-GICENLRGTYKCICNSGY---EVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIY--KPDLKT---CEDIDEC-ESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGL--CVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCT-HGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRI------SPDLCGRGQCVNTPGDFECKCDEGYE-SGFMMMKNCM-DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLC--PNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECS-----------IMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQ---CTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLS-GTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDG-FTCTDLDECSEN----------LNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDEC-SLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNEC-LDPTTCISG--------NCVNTPGSYICDC------PPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLG--KAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVI-LEDIDECQELPGLCQG---GKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGT-CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECA----SGNGNLCR--NGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEIC---ALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSP-KSRNHSKQECCCALKGEGWGDPCELCPTEP---DEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKH-GQCINTDGSYRCECPFGY 2157          

HSP 4 Score: 353.599 bits (906), Expect = 3.238e-96
Identity = 463/1592 (29.08%), Postives = 645/1592 (40.52%), Query Frame = -1
Query: 3590 GETGQLECTNIT--------CSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYP-LSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSN-KVCQRP-----DATCVNLPG----SYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGF--TGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCR--CNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEEC-GKLLCPLNALCVNST----CLCKSGYE-NSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFG-YICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNV--------------------------CNCGSHGICGP------------NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN--CGNHAFCKIE----NGRADCFCDSGYY--GDGELCVDVDECSNGDVSCPNNSF-CQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICE-QVNATYRCICPD--GFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI----CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQT--PCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGF--NMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRI-NGSCV 8089
            G+ G+  CT+I         C   A C      + C C  G++GDGI C D+DECSN T +C  +A CKNT+GS+ C CKEG+ G+G TCT+++EC   L+ C N   +C +   GY C C  GF+ +     C+D +EC+   N+C  V   C+N  G +RC+C+ G+         CTDVNEC     C      C NTPGSY C C   ++ +      +D  S N  +  RP     D  C N  G       C C  G         C  V  ++   +C  G+     GF+ N  T I EDIDEC      C G   KC N  GS++C C  GY ++   ++C+++NEC      CG    C +T G Y C C   +      + C D+   +    N  +D  TC+  +     +  C   Y+   +     ++C   + +       C +   GF     +G         VD +ECR     C +N  CIN  GSF C C  G+  + +     E ++EC    +C  NA C+N+     C CK GY   ST QC + +EC+   +   +  CIDT GSF C C+ G        FK + D   C   N C    C +G C    G        F+ RC +                        + S ++ CID+DEC     +   N  C N  GS+ C+C   Y +V  DG+ C+ +                     CL+                    C PG C       + L G Y C C PGY  +  + C DIDEC  +   C +   CSNTEGSF C C  G+S +SS   C+   +                          C     G   P              IC   SG  + P     D++EC+    C    QCINT GSY+C+CP   Y    N+C +        +C  G  C      +V     C   E     E  P+   C++IN    N   C        G  +C C  GY    D  +C D DEC  G   C      C+N  G++ C C  G+QR  +    + C D +EC        NG C NT GS+ CEC DGF      D  +D++         +  C   V  ++  CQ              K+  C   G+       IC  Q    ++ +CP   GF  +G     DIDEC     H+     +CVN  G Y+C+C  G  Y  DI    CVD++EC  NQ  K   N IC+N EG+Y C C +G+    DG  C D+DEC     NC    LC+N  G F C+C  G   + T+C D +EC     +     C    +C+N    +TCECQ G      F + QT   C+  + C+ N  C    +N +                                         G++C C  G+  +   N C D+NEC       +A  C   G  C NT GS+ C C    Q  + +  C+ I+ C      C        S+ +  Y C C  G+ RI  G CV
Sbjct: 1313 GKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNG--QCLNAPGGYRCECDMGFVPSADGKACEDIDECS-LPNIC--VFGTCHNLPGLFRCECEIGYELD-RSGGNCTDVNECLDPTTCIS--GNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGE-----GFRPNPITVILEDIDECQELPGLCQG--GKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETP-GICGPGT-CYNTVGNYTCICPPDYMQVNGGNNCMDMRR-SLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCP--IPSTDEFATLCGSQRPGFVIDIYTGLP-------VDIDECREIPGVC-ENGVCINMVGSFRCECPVGFFYNDKLL-VCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTG--------FKTNDDQTMCLDINECERDACGNGTCRNTIGS-------FNCRCNH----------------------GFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGY-EVAPDGRTCVDIN-------------------ECLL----------------EPRKCAPGTC-------QNLDGSYRCICPPGYS-LQNEKCEDIDECVEEPEICALGT-CSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCK-HGQCINTDGSYRCECPFG-YILAGNECVDTD------ECSVGNPCGNGTCKNVIGGFECTCEEGF---EPGPM-MTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDG---EGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNR---------EGYCFTEVLQNM--CQ----IGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGA----DIDECK--VIHDVCRNGECVNDRGSYHCICKTG--YTPDITGTSCVDLNEC--NQAPK-PCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC--QFLCVNTIGGFTCKCPPGFTQHHTSCIDNNEC-----TSDINLCGSKGICQNTPGSFTCECQRG------FSLDQTGSSCEDVDECEGNHRCQHGCQNIIG----------------------------------------GYRCSCPQGYLQHYQWNQCVDENEC------LSAHIC--GGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYGC----SNTEGGYLCGCPPGYFRIGQGHCV 2687          

HSP 5 Score: 315.079 bits (806), Expect = 1.583e-84
Identity = 472/1710 (27.60%), Postives = 668/1710 (39.06%), Query Frame = -1
Query: 3326 ECTNITCSNDAFCDFKDDDYGCHCKNGF--MGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEG--NGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNEC-NLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSN-KVCQRPDATCVNLPGSYECRCLDG-TPGCDGDNPCNTVQCTKPNEICYLGQCF---------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL--HQCGENAE--CIDTDGGYY------CQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD--GSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCICRAGY--IGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANC----IDTHGSFICYCNEGYIGDGINCFKK-DTDTDAC-QIENYCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFK----DGKVCMAVPLSQCNQSCPTGQYCNN-GSCSCLMGLNSQTDDDGNL-----NCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP--------NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKI------ENGRADCFCDSG-YYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI---VNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAI-CEQVNATYRCICPDGFQ----GDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG--AVYVDDICVDIDE--------------CSSNQTNKCSSNAICQNKEG----------------TYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGN--GTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGY--KGTGWFCIKQTPCDVPNACKANQTCTPSNENSLA--ICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPG-FKCECKPGFNM--VGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQ-----EQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTD---RNECQENPMICGDL-SKCLNTDGSYECQCVTGYKWNGTNCEDIDE 8071
            EC+ +    + FC   +  Y C C+ GF  M D   C DIDEC +N ++CD    C N  G + C C +GF    +  TC ++NEC  L+P    +  C +    + C C  G+        C D NEC    + C + +  C NT GS++C C  G+     D   CTD++EC N  H C + +A C NT GSY C C  GY GDG  CTD+DECS N  +C   +  C+N PG Y C C  G  P  DG    +  +C+ PN IC  G C          C+ G++ + +   C D++EC       +G    C N  GSY C+C   + ++     C +       L     G+N +  C +  G         C     +   C+ C  ++   + +                  C   EG+  +    +  +IDEC  L GL    +    C N  G F+CRC +GY  + +   C D NEC     G      C NT G++ CIC   Y  +  G NC          + LC  N    N TC  +  +  +   C     C        N  C    I +   F   C     G  I+ +     D D C +I   C +G C + +    C CP GF +                                           C DIDEC +N   CQ N+ C N  GSY C C P Y         D   C  +P       C  GQ  +  GS  CL     +T+DD  +      C +++          N  C   +  + C+C  G+       C D+DEC     N   N  C NT GSF C C  GY        C   N C       C P        +Y C C  GY +  +  C+D++EC  +     L  C NT GS+KC CPE F      +    +C+   +       C     G  C   S   S      EC      C     G    C++      E  R  C   SG   G  +  VD+DEC   DV    +  C N DGS+ C C  G+      L  + C D DEC +   C  NG C+N IG F+C C++GF       C   ++C +         C    VN   S YEC+C   +         K+      GK  C E  + C+ +  TY CIC  G+Q    G+G   C D +EC            +C+N+ G Y C C DG  A    D C+D  E               SSN+     S   C    G                   C    GF  +G    DIDECK  + +   N  C+N  G++ C C+ G   +  GT+C D +EC +      AP+   N +CKN +  Y C C  GY  +  G  C      D+         C     N++    C+C P F   + +CI   EC +  + C   +    Q  PG F CEC+ GF++   G++C+D +EC+         +C     GC N  G + C+C Q      Q N+     + + +   G  +C   +         SY C C  GFQ  + +G C D++EC      C  +  C+N  G Y+C CP      + +  C            P + G++    L+ +  YEC+ + GY   G      +E
Sbjct: 1200 ECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQ-CTNIPGEYRCLCYDGFMASEDMKTCVDVNEC-DLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAV-CTNTAGSFKCSCSPGWIG---DGIKCTDLDECSNGTHMCSQ-HADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCG--NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPN-ICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG---NCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKI-----------------LCPGGEGFRPNPITVILEDIDECQELPGLCQGGK----CINTFGSFQCRCPTGYYLNEDTRVCDDVNECE--TPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMR------RSLCYRNYYADNQTCDGELLFNMTKKMCC----CSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLV-------------------------------------CEDIDEC-QNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIP-----NICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACG--------NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRK-CAPGTCQNLDGSYRCICPPGYSLQ-NEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGR----RCQDLRMS-----YCYAKFEGGKC---SSPKSRNHSKQEC-----CCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVC--KHGQCINTDGSYRCECPFGY-----ILAGNECVDTDECSVGNPCG-NGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQ-----NPLLCAFRCVNTYGS-YECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEG---CVDENEC--QTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGA---DIDECKV-IHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQ------APK-PCNFICKNTEGSYQCSCPKGYILQEDGRSCK-----DLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTSCIDNNECTSDINLCG--SKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECE------GNHRCQH---GCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTL--------GSYKCMCPAGFQYEQFSGGCQDINECGSAQAPC--SYGCSNTEGGYLCGCPPGY-FRIGQGHCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECK-INGYPKRGRKRRSTNE 2735          

HSP 6 Score: 144.05 bits (362), Expect = 8.777e-33
Identity = 170/605 (28.10%), Postives = 244/605 (40.33%), Query Frame = -1
Query: 1238 LAPFQCH-CFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFK-QLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDID------ECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTV--------------------SGFNCSCANGARQLPNGDCELINECLEN--------IDRCQVLNGA--DSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGF-SKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGF--IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDL-VNGK-CTDINECSNNSQICGPQAAGICINAAGSFQCK---CNVGYENSGGKSYNPCQS----------------------VNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGI-CRNINECQIEDSCHYLADCLDTDGSYKCTCKYGY 2845
            + P Q H C  G++    T  C + +EC   +   C +   CI+T GS+EC+C +G K    S KCE+I+EC      C     C +    + C+C PGF ++      C D+         TN    + +P SI        +C C  G     G       C I  +   N +C+  +                                 +P    E +    E          D CQ++     +  C   P  Y C C  GF  D      C + +ECE N      +  EC++  GS+ C C+ G+ S  +  +C D DEC      N + CNNG+CINT G F C C  GF    +  +C D+DECS+  +         +NG CIN  G F+C C  GF +  +   C DI+EC+ P  C++G C N  GS+ C C  G  + ++G+ C D +     S   G    G CI        K   C    E + G+   PC +                      +NEC      CP N  C +    Y+CIC  GY+ D  G  C +INEC +         C +T GS+ CTC  G+
Sbjct:  223 MCPAQPHPCRRGFIPNIRTGACQDVDEC-QAIPGLC-QGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICE-GGECTNTVSSYFCKCPPGF-YTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSI-----TKMQCCCDAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGFQLD--LRGECIDVDECEKN----PCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDEC----LQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMC--------LNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHM---RSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICP-NGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGF 796          

HSP 7 Score: 124.79 bits (312), Expect = 6.253e-27
Identity = 171/570 (30.00%), Postives = 238/570 (41.75%), Query Frame = -1
Query: 6719 GQCVES-----CICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCK-----GETGQLECTNITCSNDAFCDFK----DDDYGCHCKNGFM--GDGIMCKDIDECSNNTSVCDSNAF-CKNTIGSFSCSCKEGFE--GNGVTCTNINECY-PLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNE----CADTGNLCDRVSTNCNNTFGSYRC-DCKYGFRPS----PIDSFVC---------------TDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGD--GRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTV-QCTKPNEICYL--------GQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGH--CDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD--GSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCV 8251
            GQC+ +     C C  GY+L    C   + C    S G    NG  + N     +C C+     G     E  N    N   C F+       Y C C  G++   D  MCKD DEC      C      CKN IG++ C C  G++   +G  C + NEC      C+N    C +    Y C C  GF  +     C D  E         N+C   S+N N    S  C D   G+ P     P    V                 D++EC ++H+  +N  +C N  GSY+C C +GY  D  G +C D++EC  N+  +  +  C N  GSY+C C  G    +    C  + +C      C            C C  GF  + T+  C D +EC +  N C G K  C N  GS+ CEC  G+ +      CE+++EC  N H+C     C +  GGY C C  G+  H   ++C D +EC  S + C    A+C N++GS+ C C  G+  +     C +I+EC      CS     C N  GG+ C C  GY     G CV
Sbjct: 2140 GQCINTDGSYRCECPFGYILAGNECVDTDEC----SVGNPCGNGTCK-NVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENG--RCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRN-GECVNDRGSYHCICKTGYTPDITGTSCVDLNEC--NQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTS--CIDNNECTSDINLC-GSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGN-HRCQHG--CQNIIGGYRCSCPQGYLQHYQWNQCVDENEC-LSAHICGG--ASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG---CSNTEGGYLCGCPPGYFRIGQGHCV 2687          

HSP 8 Score: 92.4337 bits (228), Expect = 3.308e-17
Identity = 58/160 (36.25%), Postives = 84/160 (52.50%), Query Frame = -1
Query: 15740 QCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16213
            +C CYDG   + A  D+           C   N    +PN+     G C N+   G   C C  GY G+     CTDI+EC  G++ C  +  C N  G++ C C  G++G+G+ CTD +EC + T  CS +A C NT GSY+C+C+ GY G+G  C+ +
Sbjct: 1262 RCLCYDG---FMASEDM---------KTCVDVNECDLNPNI--CLSGTCENT--KGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDL 1405          

HSP 9 Score: 76.6406 bits (187), Expect = 2.014e-12
Identity = 62/184 (33.70%), Postives = 87/184 (47.28%), Query Frame = -1
Query: 15599 KNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGL 16138
            +  C+  +    +PN+   + G+C N    GE  C C  G+    D   C D++EC     +C  +G C N  G++ C C  G+ G      CTD NECE    NC  +A C NT GS+KC C  G+ G+G  C+ +       D+ +   H    C Q A C +   GS+ C C EG  GDG 
Sbjct: 1233 QRSCTDIDECEDNPNI--CDGGQCTN--IPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICL-SGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDL-------DECSNGTHM---CSQHADCKNTM-GSYRCLCKEGYTGDGF 1400          

HSP 10 Score: 75.8702 bits (185), Expect = 3.386e-12
Identity = 46/147 (31.29%), Postives = 67/147 (45.58%), Query Frame = -1
Query: 15767 CHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNEC----------------------------------------ESKTANCSAYATCYNTFGSYKCICQNGYE 16087
            C ++  C N+  +G  +C C  G+ G    CTD+DECS G+++CS + DC N +G+Y CLCK G+ G+G  CTD +EC                                        E    N   + TC+N  G ++C C+ GYE
Sbjct: 1333 CGKHAVCTNT--AGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYE 1477          

HSP 11 Score: 74.7146 bits (182), Expect = 7.826e-12
Identity = 60/163 (36.81%), Postives = 75/163 (46.01%), Query Frame = -1
Query: 15596 ECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVG--NGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQ 16072
            E F + + G  EC C+ G+    D  +CTDIDEC     +C D G C N  G Y CLC  GF+   +   C D NEC+     C +  TC NT GS+ C C  GY G         I        NC  H        A C + A GSF C C+ G  GDG++
Sbjct: 1209 ETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLS-GTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKH--------AVCTNTA-GSFKCSCSPGWIGDGIK 1360          

HSP 12 Score: 73.559 bits (179), Expect = 1.855e-11
Identity = 50/129 (38.76%), Postives = 65/129 (50.39%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D NEC  N + C L   C N    F C C  G+ G  G         C D +EC +    C   + CTNT GSF C+C  G++      C D++ECS  + +C  +ADC NT GSY C CK G+ G G
Sbjct: 1279 VDVNECDLNPNIC-LSGTCENTKGSFICHCDMGYSGKKGKT------GCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDG 1399          

HSP 13 Score: 72.4034 bits (176), Expect = 3.447e-11
Identity = 48/125 (38.40%), Postives = 60/125 (48.00%), Query Frame = -1
Query: 9266 SKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9640
            S +D +EC     D   H  C N D  +RC+C  G+  L GNE       C+D DEC++        C N  G F C C  GF       C DINEC+ N  +C     C+NTYGSY C C  G+
Sbjct: 2124 SAVDMDECKE--PDVCKHGQCINTDGSYRCECPFGYI-LAGNE-------CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR--CVNTYGSYECKCPVGY 2236          

HSP 14 Score: 70.4774 bits (171), Expect = 1.557e-10
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = -1
Query: 9263 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFR 9631
            D +ECS N + C  +  C N   G+RC+C  G+         ++G++C D DEC+L        C N PG F C C +G+ +  +   C D+NEC L+ + C  + +C+NT GSYIC+C P F 
Sbjct: 1404 DLDECSENLNLCG-NGQCLNAPGGYRCECDMGFV------PSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNEC-LDPTTC-ISGNCVNTPGSYICDCPPDFE 1518          

HSP 15 Score: 70.0922 bits (170), Expect = 1.736e-10
Identity = 55/156 (35.26%), Postives = 72/156 (46.15%), Query Frame = -1
Query: 15617 GECFNSTASGESECRCKKGYEGRADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16075
            G C N+   G   CRC  G+    +N C D+DEC+ G+     NG C+N +G++ C C  G+    +G  C D NEC  +   C A  TC N  GSY+CIC  GY      C  I      P+              L TC  + +GSF C C EG
Sbjct: 1903 GTCRNTI--GSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKC-APGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEIC-----------ALGTC-SNTEGSFKCLCPEG 2043          

HSP 16 Score: 69.3218 bits (168), Expect = 3.480e-10
Identity = 50/141 (35.46%), Postives = 69/141 (48.94%), Query Frame = -1
Query: 9221 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9643
            +S +D NEC+     C+    C N +  ++C C KG+       +  +GRSC D DECA  +      C NT G F C C  GF +   T C D NEC+ + ++C +   C NT GS+ C C+ GF        CE V  C
Sbjct: 2440 TSCVDLNECNQAPKPCNFI--CKNTEGSYQCSCPKGYI------LQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHH-TSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDEC 2571          

HSP 17 Score: 65.0846 bits (157), Expect = 5.523e-9
Identity = 49/142 (34.51%), Postives = 68/142 (47.89%), Query Frame = -1
Query: 9221 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9643
            S+ ID NEC  + H C  +  C NL   ++C C  G+          +   C+D DEC+++     + CTN+ GS+ C+C  GF +      C DI+EC  N +ICD    C N  G Y C C  GF  S +   C  V  C
Sbjct: 1151 SACIDINECELSAHLCP-NGRCVNLIGKYQCACNPGYHST------PDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDG-GQCTNIPGEYRCLCYDGFMASEDMKTCVDVNEC 1284          

HSP 18 Score: 65.0846 bits (157), Expect = 5.955e-9
Identity = 50/142 (35.21%), Postives = 70/142 (49.30%), Query Frame = -1
Query: 9221 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSD---CTNTPGSFICNCHVGFVKAAPT-VCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9634
            +D +ECS     C+    CTN +  + C C  G+       +  + RSC D DEC     P+  D   CTN PG + C C+ GF+ +     C D+NEC LN +IC  +  C NT GS+IC+C  G+ G      C  +  C
Sbjct: 1196 VDIDECSIMNGGCETF--CTNSEGSYECSCQPGFA------LMPDQRSCTDIDECE--DNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNIC-LSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC 1326          

HSP 19 Score: 63.929 bits (154), Expect = 1.353e-8
Identity = 53/137 (38.69%), Postives = 66/137 (48.18%), Query Frame = -1
Query: 15617 EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGN--GLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--EGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16015
             G   N  DIDEC     VC  NG+CVN  G+Y+C+CKTG+  +  G +C D NEC      C+    C NT GSY+C C  GY  + +G  C  +   A    Q NC F           CV+   G FTC C  G
Sbjct: 2394 RGFMTNGADIDECKVIHDVCR-NGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCN--FICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATK--QHNCQF----------LCVNTI-GGFTCKCPPG 2514          

HSP 20 Score: 63.5438 bits (153), Expect = 1.940e-8
Identity = 48/126 (38.10%), Postives = 67/126 (53.17%), Query Frame = -1
Query: 9278 SSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFV-KAAPTVCNDINECSLNSSICDANADCINTYGSYICNC 9646
            +S+  D NEC+ +   C  +  C NL   ++C C  G+      E+ S G++C+D +EC L  L C     C NTPGSF+C C  GF+ K     C DI+EC  +  I   N  C N+ GS+IC C
Sbjct:  718 TSAGSDINECALDPDICP-NGICENLRGTYKCICNSGY------EVDSTGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCI---NGVCKNSPGSFICEC 832          

HSP 21 Score: 62.7734 bits (151), Expect = 3.128e-8
Identity = 75/237 (31.65%), Postives = 97/237 (40.93%), Query Frame = -1
Query: 15440 GECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNC-SFHQDASC---DQLATCVDHADGSFT-----CDCTEGSFGDGLQGANQTGCTYYPCP-QNSTAFEGYCYTFPP-NSANQAKNE----------EICNNLGGHLATFTN 16075
            G C N+   G   C C  G+    D  NC D+DECS  +     NG C+N+ G++ C+CK GF    +G  C D NECE  T        C NT GSY+C C              P +AV  D   C   H  ++C    +   C+    G+ T     C  TE +FG+  Q          PCP QNS  ++  C + P   SA    NE           IC NL G      N
Sbjct:  544 GRCINT--DGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMC--LNGMCINEDGSFKCICKPGFQLASDGRYCKDINECE--TPGICMNGRCVNTDGSYRCEC-------------FPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQ----------PCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICN 751          

HSP 22 Score: 62.7734 bits (151), Expect = 3.517e-8
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = -1
Query: 15770 KDPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16105
            K+P+V   ++G+C N+   G   C C  GY    + C D DECS G+     NG C N +G + C C+ GF  G  + C D NEC      C+    C NT+GSY+C C  GY
Sbjct: 2132 KEPDV--CKHGQCINT--DGSYRCECPFGYILAGNECVDTDECSVGNPC--GNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA--FRCVNTYGSYECKCPVGY 2236          

HSP 23 Score: 62.3882 bits (150), Expect = 3.921e-8
Identity = 55/159 (34.59%), Postives = 70/159 (44.03%), Query Frame = -1
Query: 15617 EYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTG--FVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQL--ATCVDHADGSFTCDCTEG 16081
            E G C N   S   EC     Y  +   C DIDEC  G  VC  N +C+N  G+Y C CK G  F   G  C D NEC+ +  N  ++  C +T GS+ C+C  G++              N DQT C    +   D     TC +   GSF C C  G
Sbjct: 1778 ENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGP-VCQRNAECINTAGSYRCDCKPGYRFTSTG-QCNDRNECQ-EIPNICSHGQCIDTVGSFYCLCHTGFK-------------TNDDQTMCLDINECERDACGNGTCRNTI-GSFNCRCNHG 1919          

HSP 24 Score: 62.003 bits (149), Expect = 6.113e-8
Identity = 58/203 (28.57%), Postives = 84/203 (41.38%), Query Frame = -1
Query: 15770 CDDPHAVDSCHLRDTSG---CVCNDGFLRSGTTCTPKEQCGCYDGDNNYKAVGDIWFTDFCST---KNRCSGTNSVVKDPNVQCHEYGECFNS---------TASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNG-DCVNQLGTYNCLCKTGFVG--NGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16318
            C +P         +T G   C C  G++ +G  C   ++C          +VG+      C        C+        P + C +  EC  +            G  EC+C  GY  R D   C D DEC  G + C++   +C N +GTY C+C  G+    +G  C D NEC++K   C     C NT GSY C C +G+
Sbjct: 2131 CKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDEC----------SVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICEN-GRCLNTRGSYTCECNDGF 2322          

HSP 25 Score: 61.2326 bits (147), Expect = 8.404e-8
Identity = 47/123 (38.21%), Postives = 59/123 (47.97%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAP-TVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC  N   C+ +  C N D  F C C  G+       +  +G++C D DEC++        C N  GSF C C  GF  A+    C DINEC     IC  N  C+NT GSY C C PG 
Sbjct:  530 DIDECLQNGRICN-NGRCINTDGSFHCVCNAGFH------VTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECE-TPGIC-MNGRCVNTDGSYRCECFPGL 643          

HSP 26 Score: 60.4622 bits (145), Expect = 1.615e-7
Identity = 41/109 (37.61%), Postives = 54/109 (49.54%), Query Frame = -1
Query: 15770 CHEYGECFNSTASGESECRCKKGYE-GRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16087
            C    EC N+  +G   C CK GY       C D +EC     +CS +G C++ +G++ CLC TGF  N     C D NECE          TC NT GS+ C C +G+
Sbjct: 1818 CQRNAECINT--AGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDAC---GNGTCRNTIGSFNCRCNHGF 1920          

HSP 27 Score: 60.4622 bits (145), Expect = 1.742e-7
Identity = 40/107 (37.38%), Postives = 55/107 (51.40%), Query Frame = -1
Query: 15740 GESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--EGNGSICSQI 16048
            G  +C C KGY  + D  +C D+DEC+   + C     CVN +G + C C  GF  +  +C D NEC S    C +   C NT GS+ C CQ G+  +  GS C  +
Sbjct: 2464 GSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFL--CVNTIGGFTCKCPPGFTQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDV 2568          

HSP 28 Score: 60.077 bits (144), Expect = 1.975e-7
Identity = 38/79 (48.10%), Postives = 46/79 (58.23%), Query Frame = -1
Query: 9263 IDDDECALLKCPSTSD---CTNTPGSFICNCHVGFV-KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFR 9487
            +D DEC  +  P   +   C N  GSF C C VGF       VC DI+EC  N  +C  NA+CINT GSY C+CKPG+R
Sbjct: 1765 VDIDECREI--PGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQ-NGPVCQRNAECINTAGSYRCDCKPGYR 1840          

HSP 29 Score: 60.077 bits (144), Expect = 2.008e-7
Identity = 60/188 (31.91%), Postives = 83/188 (44.15%), Query Frame = -1
Query: 9173 IKSFILKLPPNADPVNSLVIGSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDEC-ALLKCPSTSDCTNTPGSFICNCHVGFVKAAP-TVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWGDP---HCLSFDGNWL 9721
            I  F  K PP          G     +S ID NEC+++ + C     C N    F C+C +G+       +   G SC D DEC    +C     C N  G + C+C  G+++      C D NEC L++ IC   A C NT GSY C C  GF+     G C+ +  CG    P    C + +G +L
Sbjct: 2504 IGGFTCKCPP----------GFTQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFS------LDQTGSSCEDVDECEGNHRC--QHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENEC-LSAHIC-GGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYGCSNTEGGYL 2671          

HSP 30 Score: 60.077 bits (144), Expect = 2.042e-7
Identity = 43/120 (35.83%), Postives = 62/120 (51.67%), Query Frame = -1
Query: 15734 YGECFNSTASGESECRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPI 16078
            +G+C N+   G  +CRC  G+  +    NCTDIDEC     +C   G CVN  G + C C  G+    +   NC D +EC+     C     C+NT GSY+C C  G++ + +I + I I
Sbjct: 1041 HGKCRNTI--GSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-GVCHNTEGSYRCECPPGHQLSPNISACIDI 1156          

HSP 31 Score: 59.3066 bits (142), Expect = 3.184e-7
Identity = 46/125 (36.80%), Postives = 61/125 (48.80%), Query Frame = -1
Query: 9221 HANCTNLDSGFRCDCIKGWQ-GLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKA-APTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9589
            +  C      +RC+C KG+Q  L G         CID DEC    C +  +C N  GS+ C C  G+      T C DI+EC  N  IC+ N  CINT GS+ C C  GF  + +  +CE +  C
Sbjct:  462 NGRCIPTPGSYRCECNKGFQLDLRG--------ECIDVDECEKNPC-AGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDEC 576          

HSP 32 Score: 58.9214 bits (141), Expect = 4.304e-7
Identity = 67/254 (26.38%), Postives = 98/254 (38.58%), Query Frame = -1
Query: 8915 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWGDPH---CLSFDGNWLHYQGRCKYTLVRDECRNGLPIESSTANFEVIMKNWDQNTGTNSMVSWAKEITV-------KIMNYTIMMKIGFELVVDGQKTSIPFIPKNEDG 9643
            SS  D +EC  N H C     C N+  G+RC C +G+        +     C+D++EC        + C NT GS+ C C  GF  +     C DINEC    + C     C NT G Y+C C PG+   G  G C +    G  G+P        D N L  +  C    +    + G    S+       +++  +     S+ SW  E T         + N   ++++   L              NEDG
Sbjct: 2563 SSCEDVDECEGN-HRC--QHGCQNIIGGYRCSCPQGYL------QHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG--CSNTEGGYLCGCPPGYFRIGQ-GHCVSGMGMG-RGNPEPPVSGEMDDNSLSPEA-CYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDG 2802          

HSP 33 Score: 58.5362 bits (140), Expect = 6.653e-7
Identity = 48/140 (34.29%), Postives = 60/140 (42.86%), Query Frame = -1
Query: 9221 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9631
            D NEC      C  H  C N    F+C C  G+       + S  R+C D DEC +         C NTPG F C C  G+      +  C DI+EC  +  +C     C NT GSY C C PG + S N   C  +  C
Sbjct: 1028 DINECKMIPSLC-THGKCRNTIGSFKCRCDSGFA------LDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGV-CHNTEGSYRCECPPGHQLSPNISACIDINEC 1159          

HSP 34 Score: 57.3806 bits (137), Expect = 1.499e-6
Identity = 42/127 (33.07%), Postives = 58/127 (45.67%), Query Frame = -1
Query: 15701 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCS 16075
            G C N+  S   EC            C DI+EC   +++C  NG CVN +G Y C C  G+    + L C D +EC      C  +  C N+ GSY+C CQ G+             A+ PDQ +C+
Sbjct: 1127 GVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCP-NGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETF--CTNSEGSYECSCQPGF-------------ALMPDQRSCT 1237          

HSP 35 Score: 56.9954 bits (136), Expect = 1.686e-6
Identity = 46/135 (34.07%), Postives = 61/135 (45.19%), Query Frame = -1
Query: 9239 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTS---DCTNTPGSFICNCHVGFVKAAPTV-CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDC 9631
            D NEC+ N   C     C N    + C C  G+       +  + R C D+DEC   K   T    +C N  G+++C C  G+ +      C D NEC     IC+ N  C+NT GSY C C  GF  S N  +C
Sbjct: 2206 DINECAQNPLLCAFR--CVNTYGSYECKCPVGYV------LREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICE-NGRCLNTRGSYTCECNDGFTASPNQDEC 2331          

HSP 36 Score: 56.9954 bits (136), Expect = 1.993e-6
Identity = 43/126 (34.13%), Postives = 64/126 (50.79%), Query Frame = -1
Query: 9263 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGR-SCIDDDECA-LLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFR 9634
            +D +EC      C+ +  C N+   FRC+C  G+        Y++    C D DEC     C   ++C NT GS+ C+C  G+   +   CND NEC    +IC ++  CI+T GS+ C C  GF+
Sbjct: 1765 VDIDECREIPGVCE-NGVCINMVGSFRCECPVGF-------FYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFK 1881          

HSP 37 Score: 56.225 bits (134), Expect = 3.351e-6
Identity = 37/92 (40.22%), Postives = 50/92 (54.35%), Query Frame = -1
Query: 3332 GSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDI 3601
            G+C DVDEC      C+    C N +GS+ CKCP   KL+   + C D +EC   P IC +  +C NT  SY C+C  G+    +GT C D+
Sbjct:  242 GACQDVDECQAIPGLCQG-GNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGIC-EGGECTNTVSSYFCKCPPGFYTSPDGTRCIDV 331          

HSP 38 Score: 55.4546 bits (132), Expect = 4.530e-6
Identity = 75/254 (29.53%), Postives = 101/254 (39.76%), Query Frame = -1
Query: 1466 CVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAG---GFTCD--------CPEGFIYN--NYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQ-FPNSCLDGLCNNLPGSFECLCNIG-YDLVNG-KCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNP 2179
            C+C  G++       VCE+     +N   C A N  C  TYG     C+  +        +    C+   Q +   C    C  T G   G  C+        C  GFI N     C DVDEC    +  L        G+CINTVG F+C C  G  + E S KC DIDEC   P  C  G C N   S+ C C  G Y   +G +C D+      + +   + +     +    QC C+ G   S G +  P
Sbjct:  134 CLCQKGYIGTHCGQPVCESGC---LNGGRCVAPN-RCACTYGFTGPQCERDYRTGPCFTVISNQMCQ--GQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQ--AIPGLCQG-----GNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICEGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGRCWSPGVTVAP 374          

HSP 39 Score: 55.0694 bits (131), Expect = 6.772e-6
Identity = 42/114 (36.84%), Postives = 61/114 (53.51%), Query Frame = -1
Query: 6965 PNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDID 7306
            P E+C      C+ GF  N+ T  C+D+DEC      C G    C N  GS+EC+C  G++++ +++ CE+I+EC      C E  EC +T   Y+C+C  GF    D  R ID
Sbjct:  220 PCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGLCQG--GNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGIC-EGGECTNTVSSYFCKCPPGFYTSPDGTRCID 330          

HSP 40 Score: 54.6842 bits (130), Expect = 9.388e-6
Identity = 46/144 (31.94%), Postives = 70/144 (48.61%), Query Frame = -1
Query: 13895 QCHCKVGF-KGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKLFCLGDADCAKSGKCFQNL----CSCNLGFE-GDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDGTHDC 14308
            +C C VGF   D L  C +I+EC N    C  N  C +T GSY C+CK  +   + G C ++  C    +    G+C   +    C C+ GF+  D + +C      +N    +   + TC + IGS+ C+CN+GF     +DC
Sbjct: 1790 RCECPVGFFYNDKLLVCEDIDECQNGP-VCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMC----LDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDC 1928          
BLAST of SMED30010561 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 489.96 bits (1260), Expect = 1.131e-137
Identity = 671/2306 (29.10%), Postives = 948/2306 (41.11%), Query Frame = -1
Query: 1226 AKCTNTPGSYYCTCDSGYQGDGR-NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFT--GHCDECRDIDEC---AFSLNNCDSDRATCENSIGSFTCRCNEGYS--GDGSVCSEI---DECLLGLHN----------CSRSHQFCFNVNGG---------------FECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYI--GSGRNCDPQEGLEEC--GKLLCPLNALCVNS----TCLCKSGY--ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFD---------ERCE--NVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSC-------PTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN-----CGSHGIC---GPNYICQCKSGYEINPSGM--CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNK-CFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNE--CLPVNQVCQNINCGNHAFCKIENGRADCFCDSGY--YGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGF-IGDGKYDCRIDSKCE-KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGD--GLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDED----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENS-LAICECKPDFKLENDTCIPK--TECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT--CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNC-DRKVEDCISSKDSSYTCQCIEGFQRINGSC---VDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG--TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDE-----------CTNPTS---------CSSMPH-------SIC-MNNPGSFECVCPHGFSLQGGYCN---DINECL------------------------------------------IPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNN--YDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIEN----------------------STKCVDIDECQ-FPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYE-NSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDS-CHYLADCLDTDGSYKCTCKYGYKGDG 7531
             +C  T  SY C C+ GY+ D   +C D+DEC+SN      +  CVN PGSY C+C                                  GFQ   T   C DIDEC    N    +  +C N DGS++C C  G+ +++  K C + +EC    + C  N  CI+ DG + C CK GF    +   C D+DEC      +N        C NS GSF C C  G +   DG VC +      C  G+             ++S   C N + G               F   C SG     +G   D NEC    + C  N  C N  GS+ C C +GY    SGRNC     ++EC   +LLC  N LC N+    +C C  GY     T  C + +ECES     VN  C +  GSF C C+ G           D+    C +     D  C   I    +G   KS  C           ERCE    CP+                           C D++EC      C  N  C N  GS+ C+CP   L +   G+VC+ + + QC           P        +C C +G    T+ +    C K        +CP  A    R  G +   +P Y        +DI+EC      CT  + C NT GSF C C  G++ +     C   + C      CGS GIC     ++ C+C  GYE     M  C D++EC+          C+NT GS++C CP      P  + C + ++C      C+ G+   +++ G+   + SCN       +   C  +++ C  +N G    C    G  +C C  GY    DG  C D+DEC N    C +   C N  G + C C  GF     ++   +C D++EC L+ +    GEC+NT GSF C C+ G+ +  G   C    +CE     C   ASC+ N+  S ++C C   + G+GI  CI  + C  NG   C  NA C     +YRC C +GF GDG+  C+D+DECA +N + C +  +C+N  G Y C C  G     D   C DIDECS    N C     C N  G + C C +G+  D  G  C DIDEC   + NC  N LC+N PG + C C      N T  G  D     C    G  G      N          +C C     G  W      PC         +TC P N      +C     F+    T I +   EC+     C  +  NC+     F+CEC  G+ +  +T  C+D +EC        A   +   G C NT G++ C C  E M  N            G  NC D +   C  S + + TC+    F      C    +V +  +K   C+   T        +C        D+      D +EC+E P IC +   C+N  GS+ C+C TG+ +N     CEDIDEC+   + C   A C N PGS +C+C  GF      +C++ + C    +V C  G   ++ G++  C C NG++ S             C D+DEC   +  C     C N  G+Y C C           C D +EC+      +     C N     N +  F+C C  GY   P  + C++ NEC+  +   C     C + EGS+ C C  G+ ++ S  C +INEC+E  + C   S C +   GF C C PGF  SD     C D  +           C+ P +         CS MP         +C  ++  +F+ +CP+G        +   D+NECL                                          I N CG N  C N +  F C+C  G    P  +CE INEC +N   C         C +    Y C CP G+   E   ++C++ +EC   +H C++    C +  G+F C+C PG ++  DG+ CVD +EC    ++    C NG+C+N  G + C+C EGF  ++   +C+D  +  L     L   C Q+     N V   +C C+ G                            +T   DIDEC+  PN C +G C N  GSF C C +GY  D+    C D++ECS + + C      IC N  GS+QC C  GY     GK+   C+ ++EC      C     CV+   G+ C C  G+ +     C + NEC  + S C     C +T GS+ C C+ G+  D 
Sbjct:  508 GRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPC---TNGDCVNTPGSYYCKC--------------------------------HAGFQRTPTKQACIDIDEC--IQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMC-LNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMN------GHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR--DINECALDPDIC-ANGICENLRGSYRCNCNSGYEPDASGRNCI---DIDECLVNRLLCD-NGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPC--VNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLN--IQDSRCEVNI----NGATLKSECCATLGAAWGSPCERCELDTACPRGLARI------------------KGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHCECPEG-LTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGAGFANR--GDVLTGRPFY--------KDINECKAFPGMCTYGK-CRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGS-GICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKC--VNMIGTY--QCSCNPGYQATPDRQGCTDIDE-CMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMA---SMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCL-NIPGS-FKCSCREGWIGNGI-KCIDLDEC-SNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT-CSDVDECA-ENINLCEN-GQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ--NICVF-GTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPI-NCV-NGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCS---LGKAW----GNPC---------ETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC--QGGNCINTFGSFQCECPQGYYLSEDTRICEDIDEC-------FAHPGVCGPGTCYNTLGNYTCICPPEYMQVN------------GGHNCMDMRKSFCYRSYNGT-TCENELPFNVTKRMCCCTYNVGKAWNK--PCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICAN-GVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV-CSHGLCVDLQGSY-QCICHNGFKASQDQ--------TMCMDVDEC--ERHPCGN-GTCKNTVGSYNCLCYPGFELTHNNDCLDIDECS------SFFGQVCRN-GRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECV-ALPGSCSP-GTCQNLEGSFRCICPPGY-EVKSENCIDINECDEDPNICLFGS-CTNTPGGFQCLCPPGFVLSD-NGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR------CMNTFGSYECTCPIGYALRED-QKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENEC----RTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQ-GLCFAEVLQTIC-QMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNY----ICKNTEGSYQCSCPRGYVLQEDGKT---CKDLDECQTKQHNC--QFLCVNTLGGFTCKCPPGFTQHHTA-CIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDA 2607          

HSP 2 Score: 480.715 bits (1236), Expect = 6.837e-135
Identity = 682/2437 (27.99%), Postives = 983/2437 (40.34%), Query Frame = -1
Query: 1193 FMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF--EGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTVQCTKPNEICYLG--QCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH-QCGENAECIDTDGGYYCQCKTGFTGHCD--ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--SGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCI--CRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQI---ENYC---TDGDCYDGICHCPSGFVFKSN-----KCFDERCENVCPKNAXXXXXXXXXXXXXXX------------------XXSLSSDSSQC-----IDIDECN-ENVDDCQ------ENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNG----SCSCLMG--LNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIK-SCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGL------CETN-NVCNCGSHGICGPNYICQCKSGYEINPS-GMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENF-YGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI----VNVESSIYECQCHTEFS-----------------------GDGITSC--------IKNNLCFVNGKSSCHENAICEQVNAT-YRCICP--DGFQGDGYN-FCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDEC----KFGVANCSENALCINKPGTF-ACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEN--DTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGN-TCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC-NQEQMNENNSSCKPIDSCAM---GLDNCDRKVEDCISSKDSSYTCQCIEGFQRI-NGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ--GGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLEN------IDRCQVLNGADSVCYDLPIGYACVCPDG-----------FVNDEVFPQVC----------ENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDEC-QFPNSC-LDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQI-GICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPN 7990
              G  I+ + ID C ++ ++C  N  C  T+ S+ C C  G+  + NG  C +++EC   +PC N   +C +    Y C+C  GF +  T   C D +EC   G LC   +  C NT GS++C C  GF  +  D   C D +EC   + C      C N  GS+ C C  G+    +GR CTD+DEC +  +C   +  C+N  GS+ C C  G   G DG         T     CY G  +  C   F   VT + C         AN   G    C         E  +G   S +    +  +     L      N  C +  G Y C C +G+        C DIDEC  +   CD+    C N+ GS++C C  GY    +   C +I+EC     +    +  C N  G F C C  G K  + G  C+D  +   + N  D   + +N +G+ L    C       G  C+  E    C + L  +  +                  C + +ECE       N  C+++ GSF C C EG   DG      D   + C +   E+ C     G      C C  G  + +      K   +  E +CP+ A  +                                ++ S   +C     +D++E N  ++D+C+       + IC N  GS++C+C   Y   F   K CM +   + N     G  C N      C C +G  L+   +D  ++N CS +   C       N  C   +  Y C C PGY+    +  C DIDEC   I N   +  C+N+EGS+ CSC  GY+             CE N ++C+ G        Y C C  G+  +     C DVNEC   S   +  +C NT GS+ C C   +        C + D+C+  A  C     C L++ GS   K SC    I    +C+ +++     + C  +A C    G   C C  G+ GDG  C DVDEC+     C N   C N  G++ C C +GF    +   + SC DIDEC     C   G C N  G F C C DG+  D     R    C     C +  +C+    VN     YEC C  +F                        GDG  SC         +++ C   GK+  +    C  VN+T Y  +CP  +GF+ +       DIDEC             C+N+ G + C C  G    +D  IC DIDEC ++          C N  G Y+C C   +     G  C D+ +      +    C EN L  N       C    G   N           +P  +PG    D   +C N  PG+T +  +G        +    C ++P  C AN  C   N+     CEC   F   +    C    EC N  + C R  ++C+     ++CEC  GF +  N  C D+NEC    P+      + S G C++ +GS+ C C N  + +++ + C  +D C     G   C   V         SY C C  GF+   N  C+D+DEC+        N  C N IGS+ C C +  +L    K C D NEC   P  C     C N +GS+ C C  GY+    NC DI+EC    + C     C+N PG  +C C PGF   D    C +T              S+C        C+    +  +    C   +  +   D  E   +         C    G    T PS        T ED NEC      C  +   C N D +      F+C C  GY        C++ +EC   + N C  N  C +  GS+EC C  GF+  P   CE+INEC +    C+    C +    + C C  G+   ++  + C+D+DEC            +C N  G+F C+CP G + +  G  C D NEC       +N  C N +  + C C  G +   +G      ECL+N       +  Q +    S   +L     C C  G                 + ++C           + +EC++  + C  +N +C++T GSF+C CK G++ +  G  C+D DEC  S     K CN   C NT G + C CP G++   +   C D+DEC   Q      NC  +   C+NT+GGF C C  GF   ++ T C+D +EC   P+ C   G+C N PGSF C C  G+  D     C D++EC  N      +    C N  G ++C C  GY       +N C   NEC   N     +A C +    Y+C C  G+  DQ    C ++NEC   ++ C+Y   C +T+G Y C C  GY   G   C +  G N
Sbjct:  485 ITGLTILNQTIDICKHHANLC-LNGRCIPTVSSYRCECNMGYKQDANG-DCIDVDECTS-NPCTNG--DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCK--NGRCVNTDGSFQCICNAGFELT-TDGKNCVDHDECTTTNMCLN--GMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDG----RVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSEC-------CCANPDYGFGEPCQPCPAKNSAE-FHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDN--GLCRNTPGSYSCTCPPGYVFRTETETCEDINEC----ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCE-VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGV-----------------TCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLC------RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDEC--MIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASC-LNIPGSF--KCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQ-CLNVPGAYRCECEMGFTPASD---SRSCQDIDECSFQNICVF-GTCNNLPGMFHCICDDGYELD-----RTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDEC--QELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHP--GVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTC-ENELPFNVTKRMCCCTYNVGKAWNKPC--------EPCPTPGTA--DFKTICGNI-PGFTFDIHTGKA------VDIDECKEIPGIC-ANGVCI--NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQR-NADCINSPGSYRCECAAGFKLSPNGACVDRNECLEI-PN------VCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTV--------GSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICL-FGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ------------SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHG----TVPSL-----HDTREDVNECLESPGIC--SNGQCINTDGS------FRCECPMGYNLDYTGVRCVDTDEC--SIGNPC-GNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPIGYALREDQKM-CKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSG-----TECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLC--TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSP----KPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQ-----HNCQFL---CVNTLGGFTCKCPPGFT--QHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNH-----RCQHGCQNILGGYRCGCPQGYIQH--YQWNQCVDENECSNPNAC--GSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNY--GCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFN 2740          

HSP 3 Score: 451.055 bits (1159), Expect = 7.346e-126
Identity = 644/2276 (28.30%), Postives = 921/2276 (40.47%), Query Frame = -1
Query: 1997 ECTNITCSNDAFCDFKDDDYGCHCKNGFM--GDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNIN---ECYP-------LSPCDNATEE----CFDKVPGYECRCQKGFMKNTT------------TGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPC-------------------NTVQCTKPNEICY-LGQCF------------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYY------CQCKTGFTGHCDEC-------------------------------RDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV--CSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD--TNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTNQ--CINTDECESQTSCDVNANCIDTHGSFICYCNEGY--IGDGINCFKKDTDTDACQ-IENYCTDGDCY----DGICHCPSGFV---------------FKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCET------NNVCNCGSHGICGPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDK---CKTKALQCQAGEV-CKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCV--DVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIG-DGKYDCRIDSKC---EKYGGCHEDASCIVNVESSIYECQ-------------CHTEFSGDGITSCIKNNLCFV----NGKS----SCHE------NAICEQVNATYRCICPDGFQ-GDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGT--GWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMV--GNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVC--------------TCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSK-----------DSSYTCQCIEGFQR--INGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDIDECAIKTHPCHDLA-RCSNVPGSCKCKCQPGFT----GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYE---------DSNQMECIGDVCYKKC---SDIDECVTRKSAC--------HKFAECTNNDGA-YVCTCPSYLTGDGKTT-CEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGK-CENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ--GGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSV-CYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCV 8071
            ECT      +  C  +D  + C CK GF+   +G  C D+DEC     +C  N  C N+ GSF C C  G     +G  C + +    CY        + P   A  +    C +   G+   CQ    KN+             T +  D NECA   ++C   +  C N  GSYRC+C  G+ P       C D++EC LV+    +   C NTPGSY CTC  GY  + +   C DI+EC SN      +  C N  GS+ C C  G+        C                   N    T  +E C  LG  +            C  G    +    CED++EC+     C     +C N  GS+ CEC  G  +    ++C +I      L    +  ECI    G +      C     +   C+EC                               +DI+EC      C   +  C N+IGSF CRCN G++ D     C++IDEC +    C      C N  G FEC C  GY+S      +C+D +EC      C     C+NT+GSF C C  G+  S    D  + + EC     LC  N  CVN      C C  GY+ + ++  C + DEC        +  C ++ GS+ C C+EGY  + DG +C     D D C+   + C  G C     +  C C  GF+                 SN C    CEN            GS +C C +G S+   ++ C D+DEC     +C  ++ C N  GS+ C C   ++    +G  C+ +              C+NG+                              C +NA C      Y C C  G+ G G  +C D+DEC   IN C  N  C N  G++ C C+ G++  S S  C+        N+C  G+       + C C  GYE++ +G  C D++EC     C +   C+NTPG Y+C CP +F  +P    C +++   C  K      G + C   +   V     C S      N C    + C  +N   +           C    G+  +    +  D+DEC      C   + C N  GSF C C  G+   E+  +   C DIDEC         G C NT+G++ C C   ++  +G ++C    K      Y G   +     NV   +  C              C T  + D  T C  N   F      GK+     C E      N +C     ++RC CP GF   D    C DIDEC+N +   C     C+NS G Y C C  G  +  +  CVD +EC   +     S+ +C + +G+Y C C  GF    D  +C D+DEC+        N  C N  G++ C C  G  L +   C D DEC    G     +   N  C N+   + C C  GY+ T  G  CI    C  +P +C      T  N      C C P ++++++ CI   EC+   + C     +C     GF+C C PGF +   G  C D  +      +F   KC        NT  +  C               C ++        C         L +    V +C+ S            D S+ C+C  G+        CVD DEC+  I +   N TC N+IGS+ C C +  +       C D NEC +NP++C    +C+NT GSYEC C  GY  + +   C+D+DECA   H C      C N+ G+  C C PG      G+G   C++ + C  +  + C  G   N+IG++  C C  G++         D+ Q  C  +V    C   S     VT+   C        H+   C     A Y   CP    G G TT   D +EC +  + C             +N +  F+C C  GY        C++ +EC +     C  N IC +TEGSY+C C  G+     GK C++++EC+ K  NC    +C +   GF+C+C PGF    + +  C D +EC + P+ C +    IC N PGSF C C  GFSL   G  C D++EC   + C     C N + G+ C C  G  Q         N+C++  + C   N   S  CY+    Y C CP GF  D+ F   C + NEC  + + C   N  C +T G + C C PG+ +   G CV
Sbjct:  620 ECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQT-PGIC-MNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDIC--ANGICENLRGSYRCNCNSGYEPD-ASGRNCIDIDEC-LVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCV---NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLA-RIKGVTCEDVNECEVFPGVCP--NGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKW--DEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGK--CRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSG--ICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLC-RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNG-GCDTQCTNSEGSYECSCSEGYALMPDGRSC----ADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENT----------KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWI---GNGIKCIDL------------DECSNGTHQ----------------------------CSINAQCVNTPGSYRCACSEGFTGDGF-TCSDVDECAENINLCE-NGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINC-VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPC----ETCPPVNSTEY--------YTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGN-CINTFGSFQCECPQGYYLSEDTRI---CEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTIC-GNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL-CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECL--EIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCG---NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFG-----QVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPG---TCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNIC--LFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ-SFCFTNFENGKCSVPKA--FNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS--IGNPCGNGTCTNVIGSFECNCNEGFEPG-PMMNCEDINECAQNPLLCA--FRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEG---CVDENECRTKPGI-CENGRCVNIIGSY-RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPH---GPGYTTDGRDIDECKVMPNLCTNG--------QCINTMGSFRCFCKVGYTTDISGTSCIDLDEC-SQSPKPC--NYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQF--LCVNTLGGFTCKCPPGFT---QHHTACIDNNECGSQPSLCGA--KGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHG--CQNILGGYRCGCPQGYIQH-----YQWNQCVDE-NECSNPNACGSASCYNTLGSYKCACPSGFSFDQ-FSSACHDVNECSSSKNPC---NYGCSNTEGGYLCGCPPGYYRVGQGHCV 2734          

HSP 4 Score: 90.5077 bits (223), Expect = 1.195e-16
Identity = 49/121 (40.50%), Postives = 70/121 (57.85%), Query Frame = -1
Query: 15722 YGECFNSTASGESECRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVN 16078
            +GEC N+   G   C C+ GY  +     CTD+DEC  G++ C  +  C+N  G++ C C+ G++GNG+ C D +EC + T  CS  A C NT GSY+C C  G+ G+G  CS +   A N
Sbjct: 1338 FGECENT--KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAEN 1456          

HSP 5 Score: 75.485 bits (184), Expect = 5.071e-12
Identity = 49/128 (38.28%), Postives = 73/128 (57.03%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL-LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N   CD    CTN+   +RC C  G+  +   +M    ++CID +EC L        +C NT GSFIC+C +G+ VK   T C D++EC + +  CD +A C+N  GS+ C+C+ G+ G+G
Sbjct: 1283 DIDECENNPDICD-GGQCTNIPGEYRCLCYDGF--MASMDM----KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNG 1403          

HSP 6 Score: 72.4034 bits (176), Expect = 4.258e-11
Identity = 47/125 (37.60%), Postives = 63/125 (50.40%), Query Frame = -1
Query: 9266 SKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9640
            ++ D NEC  +   C  +  C N D  FRC+C  G+       +   G  C+D DEC++        CTN  GSF CNC+ GF       C DINEC+ N  +C     C+NT+GSY C C  G+
Sbjct: 2168 TREDVNECLESPGICS-NGQCINTDGSFRCECPMGYN------LDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPIGY 2283          

HSP 7 Score: 70.0922 bits (170), Expect = 2.181e-10
Identity = 49/129 (37.98%), Postives = 61/129 (47.29%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            ID NEC  N + C +   C N    F C C  G+    G         C D DEC +    C   + C N PGSF C+C  G++      C D++ECS  +  C  NA C+NT GSY C C  GF G G
Sbjct: 1324 IDVNECDLNSNIC-MFGECENTKGSFICHCQLGYSVKKGTT------GCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNG-IKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDG 1444          

HSP 8 Score: 69.3218 bits (168), Expect = 3.574e-10
Identity = 45/147 (30.61%), Postives = 60/147 (40.82%), Query Frame = -1
Query: 15767 CHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNEC----------------------------------------ESKTANCSAYATCYNTFGSYKCICQNGYE 16087
            C  +  C N    G  +C C++G+ G    C D+DECS G++ CS N  CVN  G+Y C C  GF G+G  C+D +EC                                        E    N   + TC N  G + CIC +GYE
Sbjct: 1378 CDMHASCLN--IPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYE 1522          

HSP 9 Score: 67.3958 bits (163), Expect = 1.204e-9
Identity = 49/126 (38.89%), Postives = 67/126 (53.17%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSD---CTNTPGSFICNCHVGFVKAAPT-VCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC      CD    CTN +  + C C +G+       +  +GRSC D DEC     P   D   CTN PG + C C+ GF+ +     C D+NEC LNS+IC    +C NT GS+IC+C+ G+
Sbjct: 1242 DIDECMIMNGGCDTQ--CTNSEGSYECSCSEGYA------LMPDGRSCADIDECE--NNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNIC-MFGECENTKGSFICHCQLGY 1356          

HSP 10 Score: 67.3958 bits (163), Expect = 1.214e-9
Identity = 49/141 (34.75%), Postives = 68/141 (48.23%), Query Frame = -1
Query: 9221 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9643
            +S ID +ECS +   C+    C N +  ++C C +G+       +  +G++C D DEC   +      C NT G F C C  GF +   T C D NEC    S+C A   C NT GS+ C C+ GF       +CE V  C
Sbjct: 2487 TSCIDLDECSQSPKPCNYI--CKNTEGSYQCSCPRGYV------LQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHH-TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDEC 2618          

HSP 11 Score: 66.6254 bits (161), Expect = 2.314e-9
Identity = 57/145 (39.31%), Postives = 71/145 (48.97%), Query Frame = -1
Query: 9212 DFNECSTNFHDCDLHAN--CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPT-VCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCW 9631
            D NEC+    D D+ AN  C NL   +RC+C  G+      E  ++GR+CID DEC +  L C     C NTPGS+ C C  G+V    T  C DINEC  N  +   N  C N  GS+ C C PG + S     C       CW
Sbjct:  768 DINECAL---DPDICANGICENLRGSYRCNCNSGY------EPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCV---NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCW 899          

HSP 12 Score: 66.6254 bits (161), Expect = 2.454e-9
Identity = 53/156 (33.97%), Postives = 68/156 (43.59%), Query Frame = -1
Query: 15611 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSF 16075
            G C N   S   EC     Y      C DIDECS G  +C  N DC+N  G+Y C C  GF +     C D NEC  +  N  ++  C +  GSY+CIC NG++              + DQT C          +  C  H  G+ TC  T GS+
Sbjct: 1822 GVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNEC-LEIPNVCSHGLCVDLQGSYQCICHNGFK-------------ASQDQTMCM--------DVDECERHPCGNGTCKNTVGSY 1955          

HSP 13 Score: 65.855 bits (159), Expect = 3.858e-9
Identity = 47/124 (37.90%), Postives = 62/124 (50.00%), Query Frame = -1
Query: 9266 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9634
            ID +EC  N   C  +  C N D  F+C C  G+      E+ ++G++C+D DEC          C N  GSF C C  GFV A     C D++EC     IC  N  CIN+ GS+ C+C PG 
Sbjct:  574 IDIDECIQNGVLCK-NGRCVNTDGSFQCICNAGF------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQ-TPGIC-MNGHCINSEGSFRCDCPPGL 688          

HSP 14 Score: 65.4698 bits (158), Expect = 4.919e-9
Identity = 47/115 (40.87%), Postives = 60/115 (52.17%), Query Frame = -1
Query: 15740 GECFNSTASGESECRCKKGYEGRADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16075
            G C N+   G   C C  G+E   +N C DIDECS        NG C N++G++ CLC  G+    +G NC D NEC +   +CS   TC N  GS++CIC  GYE     C  I
Sbjct: 1946 GTCKNTV--GSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDI 2057          

HSP 15 Score: 63.1586 bits (152), Expect = 2.203e-8
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = -1
Query: 9221 VIGSLMC---SSSKIDFNECS-TNFHDCDLHAN------CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9667
             IGS  C   S   +D  E + T+  +C +  +      C N    F C+C +G++   G  M  N   C+D DEC    L C   + C NT GSF C+C +G  +  +   C DINECSL+ ++C  N  C+N  G+Y C+C PG++ + +   C  +  C
Sbjct: 1092 TIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYES--GFMMMKN---CMDIDECERNPLLCRGGT-CVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLC-RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDEC 1246          

HSP 16 Score: 62.3882 bits (150), Expect = 3.611e-8
Identity = 50/159 (31.45%), Postives = 64/159 (40.25%), Query Frame = -1
Query: 9263 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLG----------------------------------GNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFR 9634
            ID +ECS   H C ++A C N    +RC C +G+ G G                                  G    S+ RSC D DEC+         C N PG F C C  G+ +      C DI+EC+    I   N  C+NT G Y CNC P F+
Sbjct: 1407 IDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA--DPINCVNGLCVNTPGRYECNCPPDFQ 1563          

HSP 17 Score: 62.3882 bits (150), Expect = 4.342e-8
Identity = 44/127 (34.65%), Postives = 64/127 (50.39%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N H C     C N+  G+RC C +G+        +     C+D++EC+      ++ C NT GS+ C C  GF      + C+D+NECS + + C  N  C NT G Y+C C PG+   G
Sbjct: 2614 DVDECDGN-HRC--QHGCQNILGGYRCGCPQGYI------QHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPC--NYGCSNTEGGYLCGCPPGYYRVG 2729          

HSP 18 Score: 61.6178 bits (148), Expect = 6.883e-8
Identity = 38/95 (40.00%), Postives = 49/95 (51.58%), Query Frame = -1
Query: 15770 GESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16048
            G  +C C +GY  + D   C D+DEC    + C     CVN LG + C C  GF  +   C D NEC S+ + C A   C NT GS+ C CQ G+
Sbjct: 2511 GSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFL--CVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGF 2603          

HSP 19 Score: 61.2326 bits (147), Expect = 9.950e-8
Identity = 47/131 (35.88%), Postives = 68/131 (51.91%), Query Frame = -1
Query: 9251 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCP---STSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9631
            D +ECS   + C  +A+C N    +RC+C  G++      +  NG +C+D +EC  L+ P   S   C +  GS+ C CH GF  +   T+C D++EC  +      N  C NT GSY C C PGF  + N
Sbjct: 1850 DIDECSNGDNLCQRNADCINSPGSYRCECAAGFK------LSPNG-ACVDRNEC--LEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPC---GNGTCKNTVGSYNCLCYPGFELTHN 1968          

HSP 20 Score: 60.8474 bits (146), Expect = 1.055e-7
Identity = 60/193 (31.09%), Postives = 83/193 (43.01%), Query Frame = -1
Query: 15617 YGECFNSTASGESECRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE---------------------GNGSI--------CSQIPIIAVNPDQTNCS-----FHQDASCDQLATCVDHADGSFTCDCTEG 16078
            YG+C N+   G  +CRC  G+  +    NCTDIDEC     +C  +G CVN  G++ C C  G+    +   NC D +ECE     C    TC NT GS++C C  G+E                      NG          CS  P     PD+  C+        +  CD   T   +++GS+ C C+EG
Sbjct: 1086 YGKCRNTI--GSFKCRCNSGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT---NSEGSYECSCSEG 1271          

HSP 21 Score: 60.4622 bits (145), Expect = 1.631e-7
Identity = 93/313 (29.71%), Postives = 120/313 (38.34%), Query Frame = -1
Query: 1625 DECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIP---NSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKC---INTAGGFTCD--------CPEGFIYN--NYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQ-FPNSCLDGLCNNLPGSFECLCNIGY 2512
            D    P  C S  HS C          CP   +L GG     N+C++P   NSCG        +    C+C++G      G         ++I +C V       C D      C C  G++       VCEN  +   N   C   N  C   YG     C+  +        V+   C+   Q     C    C   I  A G  C+        C  GFI N     C DVDEC      ++   C    G+CINTVG F+C C  G    E + KC DIDEC   P  C  G C+N  GS+ C+C  GY
Sbjct:   81 DVLRGPNVCGSRFHSYC----------CPGWKTLPGG-----NQCIVPICRNSCGDGFCSRPNM----CTCSSGQISSTCGS--------KSIQQCSVRCMNGGTCAD----DHCQCQKGYIGTYCGQPVCENGCQ---NGGRCIGPN-RCACVYGFTGPQCERDYRTGPCFTQVNNQMCQ--GQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQ-----AIPGICQ--GGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGY 349          

HSP 22 Score: 60.077 bits (144), Expect = 1.994e-7
Identity = 51/159 (32.08%), Postives = 67/159 (42.14%), Query Frame = -1
Query: 15617 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDAS-----CDQLATCVDHADGSFTCDCTEG 16075
            G+C N+  S   EC      +     C D DECS G+     NG C N +G++ C C  GF  G  +NC D NEC      C+    C NTFGSY+C C  GY             A+  DQ  C    + +     C+       +  G+F C C  G
Sbjct: 2185 GQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPC--GNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAF--RCMNTFGSYECTCPIGY-------------ALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPG 2326          

HSP 23 Score: 58.151 bits (139), Expect = 7.617e-7
Identity = 75/275 (27.27%), Postives = 102/275 (37.09%), Query Frame = -1
Query: 8954 LHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPT--VCNDINECSLNSSICD----------------------------------------ANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWG---DPHCLSFDGNW---------LHYQGR-CKYTLVRDECRNGL-------PIESSTANFEVIMKNWDQNTGTNSMVSWAKEITVKIMNYTIMMKIGFELVVDGQ 9592
            L+  C    S +RC+C  G++        +NG  CID DEC    C +  DC NTPGS+ C CH GF +  PT   C DI+EC  N  +C                                          N  CIN  GS+ C CKPGF  + N   C  V  C   G   + HC++ +G++         +   GR C  T +R  C  G+       P   +    E    N D   G       AK        +  +   G  + VDG+
Sbjct:  506 LNGRCIPTVSSYRCECNMGYK------QDANG-DCIDVDECTSNPC-TNGDCVNTPGSYYCKCHAGFQRT-PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSA----EFHGLCSSGVGITVDGR 767          

HSP 24 Score: 57.7658 bits (138), Expect = 1.038e-6
Identity = 43/123 (34.96%), Postives = 57/123 (46.34%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFV-KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC    + C  +  C N    FRC C  G+          +G SCID DEC+    P    C NT GS+ C+C  G+V +     C D++EC      C     C+NT G + C C PGF
Sbjct: 2449 DIDECKVMPNLC-TNGQCINTMGSFRCFCKVGYT------TDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC--QFLCVNTLGGFTCKCPPGF 2562          

HSP 25 Score: 56.6102 bits (135), Expect = 2.134e-6
Identity = 63/195 (32.31%), Postives = 85/195 (43.59%), Query Frame = -1
Query: 15527 GECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNC-SFHQDASC---DQLATCVDHADGSFT---CDCTEGSFGDGLQGANQTGCTYYPCP-QNSTAFEGYC 16075
            G C N+   G  +C C  G+E   D  NC D DEC+  +     NG C+N+ G++ C+CK GFV   NG  CTD +EC+  T        C N+ GS++C C              P +AV  D   C   H  ++C    +   CV    G+ T   C C    +G G            PCP +NS  F G C
Sbjct:  589 GRCVNT--DGSFQCICNAGFELTTDGKNCVDHDECTTTNMC--LNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQ--TPGICMNGHCINSEGSFRCDCP-------------PGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGE--------PCQPCPAKNSAEFHGLC 756          

HSP 26 Score: 56.6102 bits (135), Expect = 2.566e-6
Identity = 42/110 (38.18%), Postives = 57/110 (51.82%), Query Frame = -1
Query: 15770 CHEYGECFNSTASGESECRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL--NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16087
            C   G C N+   G   C C++G+  +    NC D+DEC  G++ C     C N LG Y C C  G++ +     C D NEC +  A     A+CYNT GSYKC C +G+
Sbjct: 2582 CGAKGICQNT--PGSFSCECQRGFSLDATGLNCEDVDECD-GNHRCQHG--CQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNA--CGSASCYNTLGSYKCACPSGF 2684          

HSP 27 Score: 56.6102 bits (135), Expect = 2.609e-6
Identity = 43/116 (37.07%), Postives = 58/116 (50.00%), Query Frame = -1
Query: 6962 KPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDE 7309
             P E+C      C+ GF  N+ T  C+D+DEC      C G    C N  GS+EC C  G++ S   + CE+I+EC      C E  EC +T G Y+C C  G+    D  R ID+
Sbjct:  249 HPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQG--GNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGIC-ETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQ 361          

HSP 28 Score: 55.8398 bits (133), Expect = 4.349e-6
Identity = 36/81 (44.44%), Postives = 44/81 (54.32%), Query Frame = -1
Query: 9251 IDDDECALLKCP-STSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9487
            +D DEC  +    +   C N  GSF C C  GF       VC DI+ECS   ++C  NADCIN+ GSY C C  GF+ S N
Sbjct: 1807 VDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPN 1887          

HSP 29 Score: 54.6842 bits (130), Expect = 9.399e-6
Identity = 44/149 (29.53%), Postives = 59/149 (39.60%), Query Frame = -1
Query: 15767 CHEYGECFNSTAS---------------------------------------GESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16087
            C    +C NS  S                                       G  +C C  G++   D   C D+DEC R  + C  NG C N +G+YNCLC  GF + +  +C D +EC S          C+N  GS+KC+C  GYE
Sbjct: 1861 CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECER--HPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYE 2006          
BLAST of SMED30010561 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 489.96 bits (1260), Expect = 1.131e-137
Identity = 671/2306 (29.10%), Postives = 948/2306 (41.11%), Query Frame = -1
Query: 1226 AKCTNTPGSYYCTCDSGYQGDGR-NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFT--GHCDECRDIDEC---AFSLNNCDSDRATCENSIGSFTCRCNEGYS--GDGSVCSEI---DECLLGLHN----------CSRSHQFCFNVNGG---------------FECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYI--GSGRNCDPQEGLEEC--GKLLCPLNALCVNS----TCLCKSGY--ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFD---------ERCE--NVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSC-------PTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN-----CGSHGIC---GPNYICQCKSGYEINPSGM--CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNK-CFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNE--CLPVNQVCQNINCGNHAFCKIENGRADCFCDSGY--YGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGF-IGDGKYDCRIDSKCE-KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGD--GLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDED----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENS-LAICECKPDFKLENDTCIPK--TECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT--CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNC-DRKVEDCISSKDSSYTCQCIEGFQRINGSC---VDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG--TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDE-----------CTNPTS---------CSSMPH-------SIC-MNNPGSFECVCPHGFSLQGGYCN---DINECL------------------------------------------IPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNN--YDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIEN----------------------STKCVDIDECQ-FPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYE-NSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDS-CHYLADCLDTDGSYKCTCKYGYKGDG 7531
             +C  T  SY C C+ GY+ D   +C D+DEC+SN      +  CVN PGSY C+C                                  GFQ   T   C DIDEC    N    +  +C N DGS++C C  G+ +++  K C + +EC    + C  N  CI+ DG + C CK GF    +   C D+DEC      +N        C NS GSF C C  G +   DG VC +      C  G+             ++S   C N + G               F   C SG     +G   D NEC    + C  N  C N  GS+ C C +GY    SGRNC     ++EC   +LLC  N LC N+    +C C  GY     T  C + +ECES     VN  C +  GSF C C+ G           D+    C +     D  C   I    +G   KS  C           ERCE    CP+                           C D++EC      C  N  C N  GS+ C+CP   L +   G+VC+ + + QC           P        +C C +G    T+ +    C K        +CP  A    R  G +   +P Y        +DI+EC      CT  + C NT GSF C C  G++ +     C   + C      CGS GIC     ++ C+C  GYE     M  C D++EC+          C+NT GS++C CP      P  + C + ++C      C+ G+   +++ G+   + SCN       +   C  +++ C  +N G    C    G  +C C  GY    DG  C D+DEC N    C +   C N  G + C C  GF     ++   +C D++EC L+ +    GEC+NT GSF C C+ G+ +  G   C    +CE     C   ASC+ N+  S ++C C   + G+GI  CI  + C  NG   C  NA C     +YRC C +GF GDG+  C+D+DECA +N + C +  +C+N  G Y C C  G     D   C DIDECS    N C     C N  G + C C +G+  D  G  C DIDEC   + NC  N LC+N PG + C C      N T  G  D     C    G  G      N          +C C     G  W      PC         +TC P N      +C     F+    T I +   EC+     C  +  NC+     F+CEC  G+ +  +T  C+D +EC        A   +   G C NT G++ C C  E M  N            G  NC D +   C  S + + TC+    F      C    +V +  +K   C+   T        +C        D+      D +EC+E P IC +   C+N  GS+ C+C TG+ +N     CEDIDEC+   + C   A C N PGS +C+C  GF      +C++ + C    +V C  G   ++ G++  C C NG++ S             C D+DEC   +  C     C N  G+Y C C           C D +EC+      +     C N     N +  F+C C  GY   P  + C++ NEC+  +   C     C + EGS+ C C  G+ ++ S  C +INEC+E  + C   S C +   GF C C PGF  SD     C D  +           C+ P +         CS MP         +C  ++  +F+ +CP+G        +   D+NECL                                          I N CG N  C N +  F C+C  G    P  +CE INEC +N   C         C +    Y C CP G+   E   ++C++ +EC   +H C++    C +  G+F C+C PG ++  DG+ CVD +EC    ++    C NG+C+N  G + C+C EGF  ++   +C+D  +  L     L   C Q+     N V   +C C+ G                            +T   DIDEC+  PN C +G C N  GSF C C +GY  D+    C D++ECS + + C      IC N  GS+QC C  GY     GK+   C+ ++EC      C     CV+   G+ C C  G+ +     C + NEC  + S C     C +T GS+ C C+ G+  D 
Sbjct:  508 GRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPC---TNGDCVNTPGSYYCKC--------------------------------HAGFQRTPTKQACIDIDEC--IQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMC-LNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMN------GHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR--DINECALDPDIC-ANGICENLRGSYRCNCNSGYEPDASGRNCI---DIDECLVNRLLCD-NGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPC--VNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLN--IQDSRCEVNI----NGATLKSECCATLGAAWGSPCERCELDTACPRGLARI------------------KGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHCECPEG-LTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGAGFANR--GDVLTGRPFY--------KDINECKAFPGMCTYGK-CRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGS-GICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKC--VNMIGTY--QCSCNPGYQATPDRQGCTDIDE-CMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMA---SMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCL-NIPGS-FKCSCREGWIGNGI-KCIDLDEC-SNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT-CSDVDECA-ENINLCEN-GQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ--NICVF-GTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPI-NCV-NGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCS---LGKAW----GNPC---------ETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC--QGGNCINTFGSFQCECPQGYYLSEDTRICEDIDEC-------FAHPGVCGPGTCYNTLGNYTCICPPEYMQVN------------GGHNCMDMRKSFCYRSYNGT-TCENELPFNVTKRMCCCTYNVGKAWNK--PCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICAN-GVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV-CSHGLCVDLQGSY-QCICHNGFKASQDQ--------TMCMDVDEC--ERHPCGN-GTCKNTVGSYNCLCYPGFELTHNNDCLDIDECS------SFFGQVCRN-GRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECV-ALPGSCSP-GTCQNLEGSFRCICPPGY-EVKSENCIDINECDEDPNICLFGS-CTNTPGGFQCLCPPGFVLSD-NGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR------CMNTFGSYECTCPIGYALRED-QKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENEC----RTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQ-GLCFAEVLQTIC-QMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNY----ICKNTEGSYQCSCPRGYVLQEDGKT---CKDLDECQTKQHNC--QFLCVNTLGGFTCKCPPGFTQHHTA-CIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDA 2607          

HSP 2 Score: 480.715 bits (1236), Expect = 6.837e-135
Identity = 682/2437 (27.99%), Postives = 983/2437 (40.34%), Query Frame = -1
Query: 1193 FMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF--EGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTVQCTKPNEICYLG--QCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH-QCGENAECIDTDGGYYCQCKTGFTGHCD--ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--SGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCI--CRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQI---ENYC---TDGDCYDGICHCPSGFVFKSN-----KCFDERCENVCPKNAXXXXXXXXXXXXXXX------------------XXSLSSDSSQC-----IDIDECN-ENVDDCQ------ENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNG----SCSCLMG--LNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIK-SCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGL------CETN-NVCNCGSHGICGPNYICQCKSGYEINPS-GMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENF-YGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI----VNVESSIYECQCHTEFS-----------------------GDGITSC--------IKNNLCFVNGKSSCHENAICEQVNAT-YRCICP--DGFQGDGYN-FCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDEC----KFGVANCSENALCINKPGTF-ACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEN--DTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGN-TCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC-NQEQMNENNSSCKPIDSCAM---GLDNCDRKVEDCISSKDSSYTCQCIEGFQRI-NGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ--GGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLEN------IDRCQVLNGADSVCYDLPIGYACVCPDG-----------FVNDEVFPQVC----------ENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDEC-QFPNSC-LDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQI-GICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPN 7990
              G  I+ + ID C ++ ++C  N  C  T+ S+ C C  G+  + NG  C +++EC   +PC N   +C +    Y C+C  GF +  T   C D +EC   G LC   +  C NT GS++C C  GF  +  D   C D +EC   + C      C N  GS+ C C  G+    +GR CTD+DEC +  +C   +  C+N  GS+ C C  G   G DG         T     CY G  +  C   F   VT + C         AN   G    C         E  +G   S +    +  +     L      N  C +  G Y C C +G+        C DIDEC  +   CD+    C N+ GS++C C  GY    +   C +I+EC     +    +  C N  G F C C  G K  + G  C+D  +   + N  D   + +N +G+ L    C       G  C+  E    C + L  +  +                  C + +ECE       N  C+++ GSF C C EG   DG      D   + C +   E+ C     G      C C  G  + +      K   +  E +CP+ A  +                                ++ S   +C     +D++E N  ++D+C+       + IC N  GS++C+C   Y   F   K CM +   + N     G  C N      C C +G  L+   +D  ++N CS +   C       N  C   +  Y C C PGY+    +  C DIDEC   I N   +  C+N+EGS+ CSC  GY+             CE N ++C+ G        Y C C  G+  +     C DVNEC   S   +  +C NT GS+ C C   +        C + D+C+  A  C     C L++ GS   K SC    I    +C+ +++     + C  +A C    G   C C  G+ GDG  C DVDEC+     C N   C N  G++ C C +GF    +   + SC DIDEC     C   G C N  G F C C DG+  D     R    C     C +  +C+    VN     YEC C  +F                        GDG  SC         +++ C   GK+  +    C  VN+T Y  +CP  +GF+ +       DIDEC             C+N+ G + C C  G    +D  IC DIDEC ++          C N  G Y+C C   +     G  C D+ +      +    C EN L  N       C    G   N           +P  +PG    D   +C N  PG+T +  +G        +    C ++P  C AN  C   N+     CEC   F   +    C    EC N  + C R  ++C+     ++CEC  GF +  N  C D+NEC    P+      + S G C++ +GS+ C C N  + +++ + C  +D C     G   C   V         SY C C  GF+   N  C+D+DEC+        N  C N IGS+ C C +  +L    K C D NEC   P  C     C N +GS+ C C  GY+    NC DI+EC    + C     C+N PG  +C C PGF   D    C +T              S+C        C+    +  +    C   +  +   D  E   +         C    G    T PS        T ED NEC      C  +   C N D +      F+C C  GY        C++ +EC   + N C  N  C +  GS+EC C  GF+  P   CE+INEC +    C+    C +    + C C  G+   ++  + C+D+DEC            +C N  G+F C+CP G + +  G  C D NEC       +N  C N +  + C C  G +   +G      ECL+N       +  Q +    S   +L     C C  G                 + ++C           + +EC++  + C  +N +C++T GSF+C CK G++ +  G  C+D DEC  S     K CN   C NT G + C CP G++   +   C D+DEC   Q      NC  +   C+NT+GGF C C  GF   ++ T C+D +EC   P+ C   G+C N PGSF C C  G+  D     C D++EC  N      +    C N  G ++C C  GY       +N C   NEC   N     +A C +    Y+C C  G+  DQ    C ++NEC   ++ C+Y   C +T+G Y C C  GY   G   C +  G N
Sbjct:  485 ITGLTILNQTIDICKHHANLC-LNGRCIPTVSSYRCECNMGYKQDANG-DCIDVDECTS-NPCTNG--DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCK--NGRCVNTDGSFQCICNAGFELT-TDGKNCVDHDECTTTNMCLN--GMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDG----RVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSEC-------CCANPDYGFGEPCQPCPAKNSAE-FHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDN--GLCRNTPGSYSCTCPPGYVFRTETETCEDINEC----ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCE-VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGV-----------------TCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLC------RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDEC--MIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASC-LNIPGSF--KCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQ-CLNVPGAYRCECEMGFTPASD---SRSCQDIDECSFQNICVF-GTCNNLPGMFHCICDDGYELD-----RTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDEC--QELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHP--GVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTC-ENELPFNVTKRMCCCTYNVGKAWNKPC--------EPCPTPGTA--DFKTICGNI-PGFTFDIHTGKA------VDIDECKEIPGIC-ANGVCI--NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQR-NADCINSPGSYRCECAAGFKLSPNGACVDRNECLEI-PN------VCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTV--------GSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICL-FGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ------------SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHG----TVPSL-----HDTREDVNECLESPGIC--SNGQCINTDGS------FRCECPMGYNLDYTGVRCVDTDEC--SIGNPC-GNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPIGYALREDQKM-CKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSG-----TECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLC--TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSP----KPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQ-----HNCQFL---CVNTLGGFTCKCPPGFT--QHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNH-----RCQHGCQNILGGYRCGCPQGYIQH--YQWNQCVDENECSNPNAC--GSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNY--GCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFN 2740          

HSP 3 Score: 451.055 bits (1159), Expect = 7.346e-126
Identity = 644/2276 (28.30%), Postives = 921/2276 (40.47%), Query Frame = -1
Query: 1997 ECTNITCSNDAFCDFKDDDYGCHCKNGFM--GDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNIN---ECYP-------LSPCDNATEE----CFDKVPGYECRCQKGFMKNTT------------TGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPC-------------------NTVQCTKPNEICY-LGQCF------------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYY------CQCKTGFTGHCDEC-------------------------------RDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV--CSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD--TNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTNQ--CINTDECESQTSCDVNANCIDTHGSFICYCNEGY--IGDGINCFKKDTDTDACQ-IENYCTDGDCY----DGICHCPSGFV---------------FKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCET------NNVCNCGSHGICGPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDK---CKTKALQCQAGEV-CKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCV--DVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIG-DGKYDCRIDSKC---EKYGGCHEDASCIVNVESSIYECQ-------------CHTEFSGDGITSCIKNNLCFV----NGKS----SCHE------NAICEQVNATYRCICPDGFQ-GDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGT--GWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMV--GNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVC--------------TCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSK-----------DSSYTCQCIEGFQR--INGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDIDECAIKTHPCHDLA-RCSNVPGSCKCKCQPGFT----GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYE---------DSNQMECIGDVCYKKC---SDIDECVTRKSAC--------HKFAECTNNDGA-YVCTCPSYLTGDGKTT-CEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGK-CENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ--GGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSV-CYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCV 8071
            ECT      +  C  +D  + C CK GF+   +G  C D+DEC     +C  N  C N+ GSF C C  G     +G  C + +    CY        + P   A  +    C +   G+   CQ    KN+             T +  D NECA   ++C   +  C N  GSYRC+C  G+ P       C D++EC LV+    +   C NTPGSY CTC  GY  + +   C DI+EC SN      +  C N  GS+ C C  G+        C                   N    T  +E C  LG  +            C  G    +    CED++EC+     C     +C N  GS+ CEC  G  +    ++C +I      L    +  ECI    G +      C     +   C+EC                               +DI+EC      C   +  C N+IGSF CRCN G++ D     C++IDEC +    C      C N  G FEC C  GY+S      +C+D +EC      C     C+NT+GSF C C  G+  S    D  + + EC     LC  N  CVN      C C  GY+ + ++  C + DEC        +  C ++ GS+ C C+EGY  + DG +C     D D C+   + C  G C     +  C C  GF+                 SN C    CEN            GS +C C +G S+   ++ C D+DEC     +C  ++ C N  GS+ C C   ++    +G  C+ +              C+NG+                              C +NA C      Y C C  G+ G G  +C D+DEC   IN C  N  C N  G++ C C+ G++  S S  C+        N+C  G+       + C C  GYE++ +G  C D++EC     C +   C+NTPG Y+C CP +F  +P    C +++   C  K      G + C   +   V     C S      N C    + C  +N   +           C    G+  +    +  D+DEC      C   + C N  GSF C C  G+   E+  +   C DIDEC         G C NT+G++ C C   ++  +G ++C    K      Y G   +     NV   +  C              C T  + D  T C  N   F      GK+     C E      N +C     ++RC CP GF   D    C DIDEC+N +   C     C+NS G Y C C  G  +  +  CVD +EC   +     S+ +C + +G+Y C C  GF    D  +C D+DEC+        N  C N  G++ C C  G  L +   C D DEC    G     +   N  C N+   + C C  GY+ T  G  CI    C  +P +C      T  N      C C P ++++++ CI   EC+   + C     +C     GF+C C PGF +   G  C D  +      +F   KC        NT  +  C               C ++        C         L +    V +C+ S            D S+ C+C  G+        CVD DEC+  I +   N TC N+IGS+ C C +  +       C D NEC +NP++C    +C+NT GSYEC C  GY  + +   C+D+DECA   H C      C N+ G+  C C PG      G+G   C++ + C  +  + C  G   N+IG++  C C  G++         D+ Q  C  +V    C   S     VT+   C        H+   C     A Y   CP    G G TT   D +EC +  + C             +N +  F+C C  GY        C++ +EC +     C  N IC +TEGSY+C C  G+     GK C++++EC+ K  NC    +C +   GF+C+C PGF    + +  C D +EC + P+ C +    IC N PGSF C C  GFSL   G  C D++EC   + C     C N + G+ C C  G  Q         N+C++  + C   N   S  CY+    Y C CP GF  D+ F   C + NEC  + + C   N  C +T G + C C PG+ +   G CV
Sbjct:  620 ECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQT-PGIC-MNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDIC--ANGICENLRGSYRCNCNSGYEPD-ASGRNCIDIDEC-LVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCV---NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLA-RIKGVTCEDVNECEVFPGVCP--NGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKW--DEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGK--CRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSG--ICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLC-RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNG-GCDTQCTNSEGSYECSCSEGYALMPDGRSC----ADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENT----------KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWI---GNGIKCIDL------------DECSNGTHQ----------------------------CSINAQCVNTPGSYRCACSEGFTGDGF-TCSDVDECAENINLCE-NGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINC-VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPC----ETCPPVNSTEY--------YTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGN-CINTFGSFQCECPQGYYLSEDTRI---CEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTIC-GNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL-CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECL--EIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCG---NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFG-----QVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPG---TCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNIC--LFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ-SFCFTNFENGKCSVPKA--FNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS--IGNPCGNGTCTNVIGSFECNCNEGFEPG-PMMNCEDINECAQNPLLCA--FRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEG---CVDENECRTKPGI-CENGRCVNIIGSY-RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPH---GPGYTTDGRDIDECKVMPNLCTNG--------QCINTMGSFRCFCKVGYTTDISGTSCIDLDEC-SQSPKPC--NYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQF--LCVNTLGGFTCKCPPGFT---QHHTACIDNNECGSQPSLCGA--KGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHG--CQNILGGYRCGCPQGYIQH-----YQWNQCVDE-NECSNPNACGSASCYNTLGSYKCACPSGFSFDQ-FSSACHDVNECSSSKNPC---NYGCSNTEGGYLCGCPPGYYRVGQGHCV 2734          

HSP 4 Score: 90.5077 bits (223), Expect = 1.195e-16
Identity = 49/121 (40.50%), Postives = 70/121 (57.85%), Query Frame = -1
Query: 15722 YGECFNSTASGESECRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVN 16078
            +GEC N+   G   C C+ GY  +     CTD+DEC  G++ C  +  C+N  G++ C C+ G++GNG+ C D +EC + T  CS  A C NT GSY+C C  G+ G+G  CS +   A N
Sbjct: 1338 FGECENT--KGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAEN 1456          

HSP 5 Score: 75.485 bits (184), Expect = 5.071e-12
Identity = 49/128 (38.28%), Postives = 73/128 (57.03%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL-LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N   CD    CTN+   +RC C  G+  +   +M    ++CID +EC L        +C NT GSFIC+C +G+ VK   T C D++EC + +  CD +A C+N  GS+ C+C+ G+ G+G
Sbjct: 1283 DIDECENNPDICD-GGQCTNIPGEYRCLCYDGF--MASMDM----KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNG 1403          

HSP 6 Score: 72.4034 bits (176), Expect = 4.258e-11
Identity = 47/125 (37.60%), Postives = 63/125 (50.40%), Query Frame = -1
Query: 9266 SKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9640
            ++ D NEC  +   C  +  C N D  FRC+C  G+       +   G  C+D DEC++        CTN  GSF CNC+ GF       C DINEC+ N  +C     C+NT+GSY C C  G+
Sbjct: 2168 TREDVNECLESPGICS-NGQCINTDGSFRCECPMGYN------LDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPIGY 2283          

HSP 7 Score: 70.0922 bits (170), Expect = 2.181e-10
Identity = 49/129 (37.98%), Postives = 61/129 (47.29%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            ID NEC  N + C +   C N    F C C  G+    G         C D DEC +    C   + C N PGSF C+C  G++      C D++ECS  +  C  NA C+NT GSY C C  GF G G
Sbjct: 1324 IDVNECDLNSNIC-MFGECENTKGSFICHCQLGYSVKKGTT------GCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNG-IKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDG 1444          

HSP 8 Score: 69.3218 bits (168), Expect = 3.574e-10
Identity = 45/147 (30.61%), Postives = 60/147 (40.82%), Query Frame = -1
Query: 15767 CHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNEC----------------------------------------ESKTANCSAYATCYNTFGSYKCICQNGYE 16087
            C  +  C N    G  +C C++G+ G    C D+DECS G++ CS N  CVN  G+Y C C  GF G+G  C+D +EC                                        E    N   + TC N  G + CIC +GYE
Sbjct: 1378 CDMHASCLN--IPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYE 1522          

HSP 9 Score: 67.3958 bits (163), Expect = 1.204e-9
Identity = 49/126 (38.89%), Postives = 67/126 (53.17%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSD---CTNTPGSFICNCHVGFVKAAPT-VCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC      CD    CTN +  + C C +G+       +  +GRSC D DEC     P   D   CTN PG + C C+ GF+ +     C D+NEC LNS+IC    +C NT GS+IC+C+ G+
Sbjct: 1242 DIDECMIMNGGCDTQ--CTNSEGSYECSCSEGYA------LMPDGRSCADIDECE--NNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNIC-MFGECENTKGSFICHCQLGY 1356          

HSP 10 Score: 67.3958 bits (163), Expect = 1.214e-9
Identity = 49/141 (34.75%), Postives = 68/141 (48.23%), Query Frame = -1
Query: 9221 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9643
            +S ID +ECS +   C+    C N +  ++C C +G+       +  +G++C D DEC   +      C NT G F C C  GF +   T C D NEC    S+C A   C NT GS+ C C+ GF       +CE V  C
Sbjct: 2487 TSCIDLDECSQSPKPCNYI--CKNTEGSYQCSCPRGYV------LQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHH-TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDEC 2618          

HSP 11 Score: 66.6254 bits (161), Expect = 2.314e-9
Identity = 57/145 (39.31%), Postives = 71/145 (48.97%), Query Frame = -1
Query: 9212 DFNECSTNFHDCDLHAN--CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPT-VCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCW 9631
            D NEC+    D D+ AN  C NL   +RC+C  G+      E  ++GR+CID DEC +  L C     C NTPGS+ C C  G+V    T  C DINEC  N  +   N  C N  GS+ C C PG + S     C       CW
Sbjct:  768 DINECAL---DPDICANGICENLRGSYRCNCNSGY------EPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCV---NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCW 899          

HSP 12 Score: 66.6254 bits (161), Expect = 2.454e-9
Identity = 53/156 (33.97%), Postives = 68/156 (43.59%), Query Frame = -1
Query: 15611 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSF 16075
            G C N   S   EC     Y      C DIDECS G  +C  N DC+N  G+Y C C  GF +     C D NEC  +  N  ++  C +  GSY+CIC NG++              + DQT C          +  C  H  G+ TC  T GS+
Sbjct: 1822 GVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNEC-LEIPNVCSHGLCVDLQGSYQCICHNGFK-------------ASQDQTMCM--------DVDECERHPCGNGTCKNTVGSY 1955          

HSP 13 Score: 65.855 bits (159), Expect = 3.858e-9
Identity = 47/124 (37.90%), Postives = 62/124 (50.00%), Query Frame = -1
Query: 9266 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9634
            ID +EC  N   C  +  C N D  F+C C  G+      E+ ++G++C+D DEC          C N  GSF C C  GFV A     C D++EC     IC  N  CIN+ GS+ C+C PG 
Sbjct:  574 IDIDECIQNGVLCK-NGRCVNTDGSFQCICNAGF------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQ-TPGIC-MNGHCINSEGSFRCDCPPGL 688          

HSP 14 Score: 65.4698 bits (158), Expect = 4.919e-9
Identity = 47/115 (40.87%), Postives = 60/115 (52.17%), Query Frame = -1
Query: 15740 GECFNSTASGESECRCKKGYEGRADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16075
            G C N+   G   C C  G+E   +N C DIDECS        NG C N++G++ CLC  G+    +G NC D NEC +   +CS   TC N  GS++CIC  GYE     C  I
Sbjct: 1946 GTCKNTV--GSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDI 2057          

HSP 15 Score: 63.1586 bits (152), Expect = 2.203e-8
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = -1
Query: 9221 VIGSLMC---SSSKIDFNECS-TNFHDCDLHAN------CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9667
             IGS  C   S   +D  E + T+  +C +  +      C N    F C+C +G++   G  M  N   C+D DEC    L C   + C NT GSF C+C +G  +  +   C DINECSL+ ++C  N  C+N  G+Y C+C PG++ + +   C  +  C
Sbjct: 1092 TIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYES--GFMMMKN---CMDIDECERNPLLCRGGT-CVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLC-RNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDEC 1246          

HSP 16 Score: 62.3882 bits (150), Expect = 3.611e-8
Identity = 50/159 (31.45%), Postives = 64/159 (40.25%), Query Frame = -1
Query: 9263 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLG----------------------------------GNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFR 9634
            ID +ECS   H C ++A C N    +RC C +G+ G G                                  G    S+ RSC D DEC+         C N PG F C C  G+ +      C DI+EC+    I   N  C+NT G Y CNC P F+
Sbjct: 1407 IDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA--DPINCVNGLCVNTPGRYECNCPPDFQ 1563          

HSP 17 Score: 62.3882 bits (150), Expect = 4.342e-8
Identity = 44/127 (34.65%), Postives = 64/127 (50.39%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N H C     C N+  G+RC C +G+        +     C+D++EC+      ++ C NT GS+ C C  GF      + C+D+NECS + + C  N  C NT G Y+C C PG+   G
Sbjct: 2614 DVDECDGN-HRC--QHGCQNILGGYRCGCPQGYI------QHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPC--NYGCSNTEGGYLCGCPPGYYRVG 2729          

HSP 18 Score: 61.6178 bits (148), Expect = 6.883e-8
Identity = 38/95 (40.00%), Postives = 49/95 (51.58%), Query Frame = -1
Query: 15770 GESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16048
            G  +C C +GY  + D   C D+DEC    + C     CVN LG + C C  GF  +   C D NEC S+ + C A   C NT GS+ C CQ G+
Sbjct: 2511 GSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFL--CVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGF 2603          

HSP 19 Score: 61.2326 bits (147), Expect = 9.950e-8
Identity = 47/131 (35.88%), Postives = 68/131 (51.91%), Query Frame = -1
Query: 9251 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCP---STSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9631
            D +ECS   + C  +A+C N    +RC+C  G++      +  NG +C+D +EC  L+ P   S   C +  GS+ C CH GF  +   T+C D++EC  +      N  C NT GSY C C PGF  + N
Sbjct: 1850 DIDECSNGDNLCQRNADCINSPGSYRCECAAGFK------LSPNG-ACVDRNEC--LEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPC---GNGTCKNTVGSYNCLCYPGFELTHN 1968          

HSP 20 Score: 60.8474 bits (146), Expect = 1.055e-7
Identity = 60/193 (31.09%), Postives = 83/193 (43.01%), Query Frame = -1
Query: 15617 YGECFNSTASGESECRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE---------------------GNGSI--------CSQIPIIAVNPDQTNCS-----FHQDASCDQLATCVDHADGSFTCDCTEG 16078
            YG+C N+   G  +CRC  G+  +    NCTDIDEC     +C  +G CVN  G++ C C  G+    +   NC D +ECE     C    TC NT GS++C C  G+E                      NG          CS  P     PD+  C+        +  CD   T   +++GS+ C C+EG
Sbjct: 1086 YGKCRNTI--GSFKCRCNSGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRG-GTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT---NSEGSYECSCSEG 1271          

HSP 21 Score: 60.4622 bits (145), Expect = 1.631e-7
Identity = 93/313 (29.71%), Postives = 120/313 (38.34%), Query Frame = -1
Query: 1625 DECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIP---NSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKC---INTAGGFTCD--------CPEGFIYN--NYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQ-FPNSCLDGLCNNLPGSFECLCNIGY 2512
            D    P  C S  HS C          CP   +L GG     N+C++P   NSCG        +    C+C++G      G         ++I +C V       C D      C C  G++       VCEN  +   N   C   N  C   YG     C+  +        V+   C+   Q     C    C   I  A G  C+        C  GFI N     C DVDEC      ++   C    G+CINTVG F+C C  G    E + KC DIDEC   P  C  G C+N  GS+ C+C  GY
Sbjct:   81 DVLRGPNVCGSRFHSYC----------CPGWKTLPGG-----NQCIVPICRNSCGDGFCSRPNM----CTCSSGQISSTCGS--------KSIQQCSVRCMNGGTCAD----DHCQCQKGYIGTYCGQPVCENGCQ---NGGRCIGPN-RCACVYGFTGPQCERDYRTGPCFTQVNNQMCQ--GQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQ-----AIPGICQ--GGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGY 349          

HSP 22 Score: 60.077 bits (144), Expect = 1.994e-7
Identity = 51/159 (32.08%), Postives = 67/159 (42.14%), Query Frame = -1
Query: 15617 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDAS-----CDQLATCVDHADGSFTCDCTEG 16075
            G+C N+  S   EC      +     C D DECS G+     NG C N +G++ C C  GF  G  +NC D NEC      C+    C NTFGSY+C C  GY             A+  DQ  C    + +     C+       +  G+F C C  G
Sbjct: 2185 GQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPC--GNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAF--RCMNTFGSYECTCPIGY-------------ALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPG 2326          

HSP 23 Score: 58.151 bits (139), Expect = 7.617e-7
Identity = 75/275 (27.27%), Postives = 102/275 (37.09%), Query Frame = -1
Query: 8954 LHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPT--VCNDINECSLNSSICD----------------------------------------ANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWG---DPHCLSFDGNW---------LHYQGR-CKYTLVRDECRNGL-------PIESSTANFEVIMKNWDQNTGTNSMVSWAKEITVKIMNYTIMMKIGFELVVDGQ 9592
            L+  C    S +RC+C  G++        +NG  CID DEC    C +  DC NTPGS+ C CH GF +  PT   C DI+EC  N  +C                                          N  CIN  GS+ C CKPGF  + N   C  V  C   G   + HC++ +G++         +   GR C  T +R  C  G+       P   +    E    N D   G       AK        +  +   G  + VDG+
Sbjct:  506 LNGRCIPTVSSYRCECNMGYK------QDANG-DCIDVDECTSNPC-TNGDCVNTPGSYYCKCHAGFQRT-PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSA----EFHGLCSSGVGITVDGR 767          

HSP 24 Score: 57.7658 bits (138), Expect = 1.038e-6
Identity = 43/123 (34.96%), Postives = 57/123 (46.34%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFV-KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC    + C  +  C N    FRC C  G+          +G SCID DEC+    P    C NT GS+ C+C  G+V +     C D++EC      C     C+NT G + C C PGF
Sbjct: 2449 DIDECKVMPNLC-TNGQCINTMGSFRCFCKVGYT------TDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC--QFLCVNTLGGFTCKCPPGF 2562          

HSP 25 Score: 56.6102 bits (135), Expect = 2.134e-6
Identity = 63/195 (32.31%), Postives = 85/195 (43.59%), Query Frame = -1
Query: 15527 GECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNC-SFHQDASC---DQLATCVDHADGSFT---CDCTEGSFGDGLQGANQTGCTYYPCP-QNSTAFEGYC 16075
            G C N+   G  +C C  G+E   D  NC D DEC+  +     NG C+N+ G++ C+CK GFV   NG  CTD +EC+  T        C N+ GS++C C              P +AV  D   C   H  ++C    +   CV    G+ T   C C    +G G            PCP +NS  F G C
Sbjct:  589 GRCVNT--DGSFQCICNAGFELTTDGKNCVDHDECTTTNMC--LNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQ--TPGICMNGHCINSEGSFRCDCP-------------PGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGE--------PCQPCPAKNSAEFHGLC 756          

HSP 26 Score: 56.6102 bits (135), Expect = 2.566e-6
Identity = 42/110 (38.18%), Postives = 57/110 (51.82%), Query Frame = -1
Query: 15770 CHEYGECFNSTASGESECRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL--NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16087
            C   G C N+   G   C C++G+  +    NC D+DEC  G++ C     C N LG Y C C  G++ +     C D NEC +  A     A+CYNT GSYKC C +G+
Sbjct: 2582 CGAKGICQNT--PGSFSCECQRGFSLDATGLNCEDVDECD-GNHRCQHG--CQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNA--CGSASCYNTLGSYKCACPSGF 2684          

HSP 27 Score: 56.6102 bits (135), Expect = 2.609e-6
Identity = 43/116 (37.07%), Postives = 58/116 (50.00%), Query Frame = -1
Query: 6962 KPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDE 7309
             P E+C      C+ GF  N+ T  C+D+DEC      C G    C N  GS+EC C  G++ S   + CE+I+EC      C E  EC +T G Y+C C  G+    D  R ID+
Sbjct:  249 HPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQG--GNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGIC-ETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQ 361          

HSP 28 Score: 55.8398 bits (133), Expect = 4.349e-6
Identity = 36/81 (44.44%), Postives = 44/81 (54.32%), Query Frame = -1
Query: 9251 IDDDECALLKCP-STSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9487
            +D DEC  +    +   C N  GSF C C  GF       VC DI+ECS   ++C  NADCIN+ GSY C C  GF+ S N
Sbjct: 1807 VDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPN 1887          

HSP 29 Score: 54.6842 bits (130), Expect = 9.399e-6
Identity = 44/149 (29.53%), Postives = 59/149 (39.60%), Query Frame = -1
Query: 15767 CHEYGECFNSTAS---------------------------------------GESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16087
            C    +C NS  S                                       G  +C C  G++   D   C D+DEC R  + C  NG C N +G+YNCLC  GF + +  +C D +EC S          C+N  GS+KC+C  GYE
Sbjct: 1861 CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECER--HPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYE 2006          
BLAST of SMED30010561 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 487.263 bits (1253), Expect = 5.898e-137
Identity = 673/2454 (27.42%), Postives = 970/2454 (39.53%), Query Frame = -1
Query: 1199 NGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGV-TCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTVQCTKPNEICY--LGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKC----ANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAE------CIDTDGGYYCQCKTGFTGHCD--ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYS--GDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD---------TNGSC---VDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTN-QCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN----------CFKKDTDTDACQIE----------------------NYCTDGDCYDGICHCPSGFVFKSN---------------KCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIK-SCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-------ETNNVCNCGSHGICGPNYICQCKSGYEINPS-GMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFY-GDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQ-VCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI----VNVESSIYECQCHTEF-----------------------SGDGITSC--------IKNNLCFVNGKSSCHENAICEQVNAT-YRCICP--DGFQGDGYN-FCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDE--CKFGVANCSENALCINKPGTFAC-ECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNM-VGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKD--SSYTCQCIEGFQRI-NGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY---CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPN-GDCELINE--CLENIDR--CQVLNGADSVCY-------------------DLP--IGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSC-LDGLCNNLPGSFECLCNIGYDLVNGK--CTDINECSNNSQICGPQA-AGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQ-IGICRNINECQ-IEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICG 7996
            N  +G   + + ID C + T++C  N  C  T  S+ C C  G+  +    C +++EC   SPC +   +C +    Y CRC  GF    T   C D +EC  +G LC      C NT GS++C C  GF  SP D   C D NEC     C      C N  GS+ C C  G+     G  C DIDEC +  +C   +  C N  GS+ C+CL G   G DG         T     CY  + +  C   F   VT + C         AN   G    C    A     ++  C  G  +++  +           +++C  + E      C +  G Y C C  G+       +C D+DECA  LN+   D   C+NS GS++C C  G+    D  +C ++DECL    +       C N+ G + C+C  G + D         T G+C   + E+ C     G    ++C  T G+            G  C+            C ++  C         G+   T   C + +ECES      N  C++T GSF C C EG + D             CF +  D D C +                         C D +  +    CP G  F S                K F   C +   +N + S               L +    C DIDEC  + D C + + C N  GS++C+C P Y   F   K CM V     +     G  C N  GS  C      +    G      +  S   G+CP +  C   +  + C C  G++    +  C DI+EC  ++ N   +  C NTEGS+ CSC +GYS       C       E   VC+ G        + C C  G+   P    C DV+EC       +   C NT GS+ C C   +        C + D+C+     C +   C L++ GS      C    +    EC  +++ V Q   C     C    G   C C  G+ GDG  C D DEC+  +V   +N  C N  G + C C +GF   E+     +C D+DEC     CA  G C+N  G F+C C  G+  D     R    C     C +  +CI    +N   S Y C C  +F                        GD   SC         + + C   G++  +   +C   N T YR +CP  +GFQ +       DIDEC             CVN+ G + C C  G    +   IC DIDECS++  +       C N  G Y+C C   +     G  C D+ +  C        +N L  N      C     G   N       + C  P  SP     D   +C N+ PG+  +  +G        +    C ++P  C AN  C   N+     CEC   F   +    C    EC ++   C ++ ++C+ +   ++C+C  G+ +  G  C  +NEC    P+      + S G C++T+GS++C C++  Q + + + C       M +D CDR+     + K+   SY C C  GF    NG CVD DEC   +        C N  GS+ C C D  +L    K C D NEC      C     C N +GS+ C C  G++    +C DIDEC+ + + C     C+N PGS +C C PGF   D  + C +T              S+C        C+    +  +    C      +   D  E   ++ +      C    GA        + G   +  ED NECA     C      C N D +      F+C C  GY        C++ +EC   V + C +   C +  G +EC C  GF+      CE+I+EC      C+    C +    + C C  G+   ++  + C D+DEC +           C N  G+F CVCP G     G    C D NEC        N  C NT   F C C  G +  P   +C  I +  C   + +  C+ L+ +                         LP    Y  +CP G      +     + +EC +  H C  ++ EC+++ GSF+C C+ G++ ++    C+D DEC    +     C N     T G F C CP G++   +   C D+DEC+  Q      NC  +   C+NTVG F C C  GF   ++   C D DEC   P  C   G C+N PGSF C C+ G+ LV+    C D+NEC       GP      C N  G ++C C  G+       +  C   NEC     TC S A C +   G+ C+C  G+  DQ +G C+ ++EC      C Y   C +T G + C C  GY   G   C +  G
Sbjct:  397 NSNIGTATLNQTIDICRHFTNLC-LNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTS-SPCHHG--DCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHL--GRCVNTEGSFQCVCNAGFELSP-DGKNCVDHNECATSTMCVNGV--CLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICV--NGHCTNTEGSFRCQCLGGLAVGTDG----RVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSEC-------CCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRD----------INECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECA--LNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECL----SSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAW----------GSPCE-----------RCEIDPACAR-------GFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR-WDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFA-----LDAQERNCTDIDECRISPDLCGQGT-CVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINEC--RVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASC-LNIPGSF--SCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAE-NVDLCDNGQCLNAPGGYRCECEMGFDPTEDH---RACQDVDECAQGNLCAF-GSCENLPGMFRCICNGGYELD-----RGGGNCTDINECADPVNCINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDEC--QELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTH--SGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPC----EACPTPI-SP-----DYQILCGNQAPGFLTDIHTGKP------LDIDECGEIPAIC-ANGICI--NQIGSFRCECPAGFNYNSILLACEDVDECGSRESPC-QQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREI-PN------VCSHGDCMDTEGSYMCLCHRGFQASADQTLC-------MDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLP-GTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCL-FGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQ------------SFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGA--------VPGPDDSR-EDVNECAENPGVCT--NGVCVNTDGS------FRCECPFGYSLDFTGINCVDTDEC--SVGHPCGQ-GTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFR--CHNTEGSYLCTCPAGYTLREDGAM-CRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHG----SGYTAEGRDVDECRMLAHLC--AHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFLCKN-----TKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQ-----HNCQFL---CVNTVGAFTCRCPPGFT--QHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD------GPHRCQHGCQNQLGGYRCSCPQGFTQH--SQWAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSY--SCANTPGGFLCGCPQGYFRAGQGHCVSGLG 2653          

HSP 2 Score: 462.225 bits (1188), Expect = 2.466e-129
Identity = 653/2279 (28.65%), Postives = 900/2279 (39.49%), Query Frame = -1
Query: 1997 ECTNITCSNDAFCDFKDDDYGCHCKNGFM--GDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSPCDNATEE--CFDKVPG------------------------------YECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNL-VHECDKNYAKCTNTPGSYYCTCDSGYQ--GDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRC-------------LDGTPGC------DGDNPCNTVQCTKPNEICY-LGQCF------------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYY----CQCKTG--FTGHCDECRDIDECAFS-----------------------LNNCDS-----DRATCENSIGSFTCRCNEGYSGDGSV--CSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD--TNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGY--IGSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTNQ--CINTDECESQTS-CDVNANCIDTHGSFICYCNEGY--IGDGINCFKKDTDTDACQI-ENYCTDGDCYD----GICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCN-QSCPTGQYCNN----GSCSCLMGLNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCE------TNNVCNCGSHGICGPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDKCKTKALQCQ----AGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCV--DVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFI----GDGKYDCRIDSKCEKYGG-CHEDAS---------CIVNVESSI-YECQ-CHTEFSGDGITSCIKNNLCFVN----GKS----SCHE------NAICEQVNATYRCICPDGFQGDGYNF-CNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGT--GWFCIKQTPCDVPNACKANQTCTPSNENSLA---ICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMV--GNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVC--------------TCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSK-----------DSSYTCQCIEG----FQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDIDECAIKTHPCHDLA-RCSNVPGSCKCKCQPGF-----TGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYE---------DSNQMECIGDVCYKKCSDID---ECVTRKSACHKFAECTN---------NDGAYVCTCP--SYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGK-CENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECT-NPTSCSSMPHSICMNNPGSFECVCPHGFSL--QGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPN-GDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCV 8071
            EC   T   +  C  +D  + C CK GF+    G  C DIDEC     +C  N  C NT GSF C C  G     +G  C +    +  S C  A E+  C    PG                              ++  C  G +  TT G   D NECA    +C   +  C N  GSYRC C  G+  +      CTDV+EC L    CD  +  C N+PGSY C+C  G+    D   C D+DEC S+         C NL GSY C+C             LD T G       +     N    +  +E C  LG  +            C  GF   +T   C+D++EC++    C     +C N  GS+ CEC  G  + +  ++C ++      L    +  EC  T  G Y    C C  G  +   C+ C D +   F+                       +N C          TC N++GSF C C  G++ D     C++IDEC +    C +    C N  G FEC C  GY+S      +C+D +EC      C     C NTDGS+ C C  G+     G  C   E ++EC     LCP +  CVN      C C +G++++ ++  C++ +EC  Q   CDV+  CI+T GS+ C C +GY  + DG  C     D D C+     C  G C +      C C  GF+                                      + D   C+D+DEC+ N   C     C N  GS+ C C   Y+ V K    C  V   +    +C +   C N     SC CL G      +  +L+ C      C P       +C      Y C C+ G+ G G   C D DEC   ++ C  N  C N  G + C C+ G+        C+        N+C  GS       + C C  GYE++  G  C D+NEC     C I   CINTPGSY C CP++F  +P    C + +     L+      +G  C   +   V     C S      N C    ++C   N   +        R  C    G+  +    +  D+DEC      C     C N  GSF C C  G+   E+  +   C DIDEC         G C NT+G++ C C   ++    G+   D R       Y G C  + +         C  N+  +    C+ C T  S D    C      F+     GK      C E      N IC     ++RC CP GF  +     C D+DEC +  +  C     C+N  G Y C C  G  +     CV  +EC   +     S+  C + EG+Y C C  GF    D  LC DIDEC         N  C N  G++ C C  G  + +   C D DEC    G     +      C N    + C CQ G++ T  G  C+    C          TC P    +L     C C P F++++D CI   EC  + + C   T  C      F+C C PGF +   G+ C D  +       F A KC        NT  +  C               C QE        C        G D+    V +C  +            D S+ C+C  G    F  IN  CVD DEC+  +       TC N+IG + C C D  +  L    C D +EC  NP++C    +C NT+GSY C C  GY  + +G  C D+DECA     CH     C N+ G+  C C PG      +G+G   C + + C A+ D+ C  G   N  G+F  C+C  G++         D  Q  C  +V    C  +    E VTR   C                    AY   CP  S  T +G+    D +EC +  H C             +N L  F+CHC  GY        CL+ +EC + V   C    +C +T+GS+ C C  G+     G+ C++++EC  +  NC    +C +    F+C+C PGF    +    C D DEC+  P  C +  H  C N PGSF C C  GF+L   G  C D+NEC  P+ C     C N + G+ CSC  G  Q      C   NEC  +   C       + C +   G+ CVCP GF  D+     C+  +EC      C  S   C +T G F C C  G+ +   G CV
Sbjct:  534 ECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC-QTPGIC-VNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDT---HVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSG-LGITTDGR--DINECALDPEVC--ANGVCENLRGSYRCVCNLGYE-AGASGKDCTDVDECALNSLLCDNGW--CQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVS---GVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFAR-MTGVTCDDVNECESFPGVCP--NGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRW--DEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGT--CVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCR-GGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRAC----ADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFM-------------------------------------ATPDMRTCVDVDECDLNPHICLHGD-CENTKGSFVCHCQLGYM-VRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSP-----RGDCLNVPGSYRCTCRQGFAGDGF-FCEDRDECAENVDLCD-NGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNC-INGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPC----ELCPMANTTEY--------RTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGD-CVNTFGSFQCECPPGYHLSEHTRI---CEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRES-PCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNEC--REIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCG---NGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVG-----QVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-----LSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGT--CTNSPGSFQCLCPPGFVLSDNGHRCFDTRQ-SFCFTRFEAGKCSVPKA--FNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGIN--CVDTDECS--VGHPCGQGTCTNVIGGFECACADGFEPGL-MMTCEDIDECSLNPLLCA--FRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEG---CTDDNECHAQPDL-CVNGRCVNTAGSF-RCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGR----DVDECRMLAHLCAHG--------ECINSLGSFRCHCQAGYTPDATATTCLDMDEC-SQVPKPCT--FLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQF--LCVNTVGAFTCRCPPGFTQHHQA---CFDNDECSAQPGPCGA--HGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHG--CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-----GSASCRNTLGGFRCVCPSGFDFDQAL-GGCQEVDECAGRRGPCSYS---CANTPGGFLCGCPQGYFRAGQGHCV 2649          

HSP 3 Score: 437.958 bits (1125), Expect = 7.115e-122
Identity = 680/2581 (26.35%), Postives = 968/2581 (37.50%), Query Frame = -1
Query: 1238 GNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCH------------CKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTD--VNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDI-DECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGF--TGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--SGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCICRAGY-IGS-GRNCDPQE------GLEECGKLLCPLNALCVNSTCLCKS---GYENSTNQCINTDECESQTSCD----------------------VNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIEN-YCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKC-PPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC-NNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC------------------------ETNNVCNCGSHGICGP-----------NYICQCKSGYE------INPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNK-CFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGY--YGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGF--IGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEF-SGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQ-GDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG--TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYK--GTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNM---------------------VGNTCQDKNECDPTSPDFAAQKC---------------LASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSC---KNNATCNNMIGSYVCK-------------------CPDNLK---------------LDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGT--NCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNEC-ALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDE-----------CTNPTSC-SSMPHSICMNNPG----------------SFECVCPHGFSLQGG---YCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNG-ADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEG---FIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFEC-------------------LCNI-GYDLVNGKC----------TDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIG-ICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGY 8200
            G C++P  C C  +DGT   +        CSV C   G      C          C     D GCH            C  GFMG         +C  +         C   +G   C      +  G+ CT    C  +     A     +  P     C++GF+ N  TG C D +EC     LC     +C N  GS+ C C  G R S   S  C D     C  V    +             C CD G         ++     SN+  Q        LPG           G +G  P        P+     G      G  N  T  + + ID C    N C     +C     SY CEC  GY      +  +         H    + +C++  G Y+C+C  GF  T     C D+DEC  S   C   R  C N+ GSF C CN G+  S DG  C + +EC          +  C N +G F C C  G+     G  C+D +EC+    G   N  C NT+GSF C C  G  +G+ GR C          G  E G    P       S C C +   G+      C   D  E Q  C                        N  C +  GS+ C CN GY        K  TD D C + +  C +G C +      C CP GF F                                       D+  C D+DEC   +     + +C N  GSY CKC P + LD                    P+G +C ++   +C + +     +      S  S  C        + CE         C  G+  +   +C D++EC      C  N  C NT GSF C C  G   ++S  LC                           +VC C    + G             +   C  G        ++     +DVNEC+          C NT GS+ C C   F  D Q + C + D+C+     C  G  C  +     CE      S  ++   C+ V++  ++        C   +G   C C  G+     G  C D+DECS  D  CP+   C N  G+F C+C+ GFQ   +      C DI+EC +      +  C NT GS++C C  G+  + DG+    +D +CE+     +   C  N+    + C C+  F +   + +C+  + C +N     H +  CE    ++ C C  G+    G   C+D+DEC     HNC S   C+N  G ++C C  G V     C D+DEC S Q ++CS    C N  G+Y C C +GF GDG  C D DEC   V  C +N  C+N PG + CEC+ G     +   C D DEC +               C+N    + C C  GY+    G  C     C  P  C  N  C   N     +C C  DF+L      C+     + +  NC  ET +  + D G  C  + G  +                     + NT + +  C P    F   +                L  GG C+NT GSF C C     ++E+   C+ ID C+     C      C ++   +YTC C   + ++NG     + C D   S      N TC N +   V +                   CP  +                 D+      D +EC E P IC +   C+N  GS+ C+C  G+ +N     CED+DEC  +  PC   A C N+PGS +CKC  G+      +C+  + C    +V C  G   +  G+++ C C  G++ S             C DIDEC   +  C     C N  G+Y C C           C D +EC  L    C           + +N    F C C +G+      + C++ NECL+ +   C+    C + EGS+ C C  GF Q+ S  C +I+EC E+ + C +   C +    F C C PGF  SD  +  C D  +           C+ P +  ++     C   PG                +F+ +CP G     G      D+NEC        N VC NT   F C C  G       D   IN C++  D C V +      C ++  G+ C C DGF  +      CE+ +EC +N   C      C +T GS+ C C  G++   DG  C D DEC   +Q         +C N  G F C CP G      +   C D +EC      +  D C  VNG C+NT G F+C C+ GF      T+C DI +       L  +C +L  S E                    LC + G       C           D++EC   + +C   A G CIN+ GSF+C C  GY      +   C  ++EC ++   C     C +    + C C  GY  ++ G  C++++EC   + +C +L  C++T G++ C C  G+
Sbjct:   93 GFCSQPNLCTC--ADGTLAPSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGP--------QCERDYRT----GPCFGQVGPEGCQ----HQLTGLVCTKALCCATVG---RAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQ--GGSCVNMVGSFHCRCPVGHRLSD-SSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCL--NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCH----HGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGR--CVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMC---VNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ--TPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASG--KDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFW-------------------------------------QDTEICKDVDEC---LSSPCVSGVCRNLAGSYTCKCGPGSRLD--------------------PSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDP--ACARGFARMTGVTCDDVNECESFPGVCP-NGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQG-TCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQ-CVNVIGAFQCSCHAGFQSTPD---RQGCVDINECRVQNG-GCDVHCINTEGSYRCSCGQGYSLMPDGRACADVD-ECEENPRVCDQGHC-TNMPGG-HRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGD--CENTKGSFVCHCQLGYMVRKGATGCSDVDEC-EVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS-QEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLC-DNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLC-------AFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNC-INGVCI--NTPGSYLCSCPQDFELNPSGVGCV-----DTRAGNCFLETHD--RGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLC-PGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT--CYNTL-GNYTCVCPAEYLQVNGG----NNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICAN-GICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNV-CSHGDCMDTEGSYM-CLCHRGFQASADQ--------TLCMDIDEC--DRQPCGN-GTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFG--------HCLNTAGSFHCLCQDGFELTADGKNCVDTNECLS-LAGTCLP-GTCQNLEGSFRCICPPGF-QVQSDHCIDIDECSEEPNLC-LFGTCTNSPGSFQCLCPPGFVLSDNGH-RCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSL----DFTGIN-CVDT-DECSVGHPCGQGTCTNVIGGFECACADGF--EPGLMMTCEDIDECSLNPLLCAF---RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHA--RGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNEC-----HAQPDLC--VNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLC---AHGECINSLGSFRCHCQAGYTPD--ATATTCLDMDECSQVPKPC--TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGF 2476          

HSP 4 Score: 323.939 bits (829), Expect = 3.133e-87
Identity = 484/1807 (26.78%), Postives = 675/1807 (37.35%), Query Frame = -1
Query: 3350 QPTCYNNTNSMLCTGQCVESCICAPGY---VLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDD------------DYGCHCKNGFMG--DGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYP-LSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLV-HECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCF---------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGE-----NAECIDTDGGYYCQCKTGF-------------TGHC-DECRDIDECAFSLN---NCDSDRATCENSIGSF------------------TCRCNEGYSGD--GSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYK-SDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGY--IGSGRNCDPQEGLEECGKLLCPL-------NALCVNST---CLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC-QIENYCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSC-------SCLMGLNSQTDDDGNL-----NCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP--------NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENF-YGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF--QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVD---DICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL--CHDIDE-------CKFGVANCSENALCINK--------------------PGTFA----CECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYK--GTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRIN--GSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG 8293
            Q TC N   S          C C PGY    +   NC   + C    +       G   TN + S KC+C     +L      C +   C   D              + C C  GF    D   C DI+EC      CD +  C NT GS+ CSC +G+    +G  C +++EC      CD     C +   G+ C C  GFM       C D +EC    ++C  +  +C NT GS+ C C+ G+      +  C+DV+EC +  H CD ++A C N PGS+ C C  G+ GDG  C D+DEC S +    P   C+N+PGSY C C  G  G DG    +  +C +  ++C  GQC          C+ GF        C+D+DEC    N CA     C NL G + C C  GY +               ++++C +     N  CI+T G Y C C   F              G+C  E  D  +   S +        RA+C  S+G                     C   EG+  +    +  +IDEC  L GL  C      C N  G F+C C  GY  S+    C D +EC      C     C NT G++ C+C A Y  +  G NC          K +C         N L  N T   C C      + N+    + C +  S D    C +    F+   + G          K  D D C +I   C +G C + I    C CP+GF + S                                         C D+DEC      CQ+N+ C N  GSY CKC   Y      G  C  V  ++C +       C++G C        CL     Q   D  L      C +            N  C+  +  Y C C PG+       C D DEC   +        C NT GSF C C+ G+   +    C   N C     G C P        ++ C C  G+++  S  C D++EC  +    +   C N+PGS++C CP  F   D  ++CF+ +      + +AG+      + +   K  C  S+        P     Q  +      C   +G           G  +   DV+EC+     C  N  C N DGSF C C  G+      +   +C D DEC +   C   G C N IG F+C C DGF                      +   ++  E  I EC              +   LC             C     +Y C CP G+  + DG   C D+DECA+      +   +C N  G + CVC  G   +    + C D +EC + Q + C  N  C N  G++ C C EGF     L  CHDI +        +    + S ++  + +                    PGT A    C   +G    G    D DEC+             +  C N    + C CQ+GY    T   C+    C  VP  C    T    N     +C C   + LE D  TC    EC ++  NC      CV     F C C PGF      C D +EC        A       G C NT GSF C C+Q   +  +   C+ ++ C  G   C    ++    +   Y C C +GF + +    CVD +ECA    +C  +A+C N +G + C CP     D +   C + +EC      C     C NT G + C C  GY   G
Sbjct: 1041 QGTCVNTPGSF--------ECECFPGYESGFMLMKNCMDVDEC----ARDPLLCRGGTCTNTDGSYKCQCP-PGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQG--HCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHIC--LHGDCENTKGSFVCHCQLGYMVRK-GATGCSDVDECEVGGHNCD-SHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAG-DGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDEC-AQGNLCA--FGSCENLPGMFRCICNGGYELDR-------GGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGL--CQGGD--CVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT-CYNTLGNYTCVCPAEYLQVNGGNNCMDMR------KSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNR--PCEACPTPISPDYQILCGNQAPGFLTDIHTG----------KPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSIL-------------------------------------LACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGY--KLSPGGAC--VGRNECRE---IPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCG--------NGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-LSLAGTCLPGTCQNLEGSFRCICPPGFQVQ-SDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTT--KTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVP--------GPDDSREDVNECAENPGVC-TNGVCVNTDGSFRCECPFGYSLDFTGI---NCVDTDECSVGHPCG-QGTCTNVIGGFECACADGF----------------------EPGLMMTCE-DIDECS-------------LNPLLCAFR----------CHNTEGSYLCTCPAGYTLREDGA-MCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHA-QPDLC-VNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGR---DVDECRM------LAHLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPC----TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL---CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAH------GHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHGCQN----QLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-GSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCS--YSCANTPGGFLCGCPQGYFRAG 2644          

HSP 5 Score: 121.324 bits (303), Expect = 6.834e-26
Identity = 176/685 (25.69%), Postives = 256/685 (37.37%), Query Frame = -1
Query:  494 NSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDE---------------------------CQFPNSCLDGLCNNLPGS----FECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQ-IGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCVCQGPRCRDN-------GPVCDTQGITYQS--EKQMFETTCKQNIVGEV----EYYNECQKSCATVTCPGI---EKCSMVNDRPSCTC----------QNCTQAELTPRLFCSNN---GIEFHSICQMKTWICNTKSEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKASMFNGNCEDPLFETQQCYNGPCPGDACE-NITCAPGSFCESGKCICPDCSDQRIPDPVCGK 2353
            N  C  T S + C C  G  Q   G+C  ++EC  +             C ++P  Y C C  GF       Q C + +EC ++   C      CV+T GSF+CVC  GF  + DG +CVD++EC  S       C NG C+N  G F+C C  GF+     + C+D+DEC    +         VNGHC NT G F+C C  G  +  +   CVD                              C  P+      C   P      F+ LC+ G  +      DINEC+ + ++C   A G+C N  GS++C CN+GYE   G S   C  V+EC   ++ C  N  C +    Y C C  G+   Q   IC++++EC +   C     C +  GSY C                 CGP S L       ++  +  C    Q  RC  N          C T G  + S  E+   +  C +          +  NEC+        PG+    +C        C C          + C    L P     +    G+      +M    C+    I   +   C    D E  E+ S       C  G    +R  +    F  +  +       C +G C       +  CA G   ++ +  C D  + RI   +CG+
Sbjct:  421 NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCH-------HGDCVNIPGTYHCRCYPGFQATPTR-QACVDVDECIVSGGLCHLG--RCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATS-----TMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGIC--------VNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDG-RDINECALDPEVC---ANGVCENLRGSYRCVCNLGYE--AGASGKDCTDVDECALNSLLC-DNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDEC-LSSPC-VSGVCRNLAGSYTCK----------------CGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESF------PGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCS----IGAVWGVECEACPDPESLEFASL------CPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQ 1041          

HSP 6 Score: 119.398 bits (298), Expect = 2.382e-25
Identity = 147/513 (28.65%), Postives = 205/513 (39.96%), Query Frame = -1
Query: 1235 CKPGFKWSDETNLNCEDIDECTN-PTSCSSMPHSICMNNPGSFECVCP--HGFSLQGGYCNDINE--CLIPNSCGQNSVCANTVSGF-----------NCSCANGARQL--PNGDCELINECLENIDRCQVLNGADSVCYDL----------PIGYACVCPDGFVNDEVFPQVC---ENQNECEIN--IHSCQA-----SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGF--IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGK--CTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGY-----------------------ENSGGKSYNPCQSVNECVKLNITCPSNAQC----VDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYK 2566
            C+ GF  +  T   C+D+DEC   P  C       C+N  GSF C CP  H  S     C D     C      G+   CA  ++G             C  A    +L  P G  E    C +   R  +L G   +   L          P+G A + P G  +    P +     N     +N  I  C+       N  C+ T  S++C C  G++++  G+C+D DEC  S       C++G C+N  G + C C  GF        C+DVDEC +         C    G C+NT G FQC CN GF +  +   CVD +EC     C++G+C N  GSF CLC  G+ L  G   C DI+EC    Q  G    G C N  GSF+C+C  G                        + S  + +    + +EC   N        C       S  ++ +C  G      G  R+INEC ++        C +  GSY+C C  GY+
Sbjct:  232 CRRGFIPNIHTGA-CQDVDECQAVPGLCQG---GSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGR---CAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQ---RLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHG-SDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSP------CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVS-----GGLCHL--GRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC----QTPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDG--RDINECALDPEVCANGVCENLRGSYRCVCNLGYE 714          

HSP 7 Score: 107.842 bits (268), Expect = 7.305e-22
Identity = 101/350 (28.86%), Postives = 149/350 (42.57%), Query Frame = -1
Query: 2693 KPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT----GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGD-GKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECR 3721
            + +D C M    C     +CI+S   S+ C C  G+       +C+D+DEC+     C     C N  GS++C CP    L+   + C D +EC      C  L  C+NT G++ C+C  G+  +   C D DEC+ +  PC     C N PGS +C+C  GFT    G G     E D  P R    C      N +G +  C+C  G+   +Q        + +C D +EC      C   A C N  G + C CPS    D     C++ +ECA     C+ + +         N    F C C  GY +  G   C++     +P   D  +    + +E  YEC+
Sbjct: 2362 RDVDECRMLAHLCAHG--ECINSL-GSFRCHCQAGYTPDATATTCLDMDECSQVPKPC--TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDG-PHRCQHGCQ-----NQLGGY-RCSCPQGFTQHSQ--------WAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCA---------NTPGGFLCGCPQGYFRA-GQGHCVSGLG-FSPGPQDTPDKEELLSSEACYECK 2677          

HSP 8 Score: 90.8929 bits (224), Expect = 8.859e-17
Identity = 85/291 (29.21%), Postives = 114/291 (39.18%), Query Frame = -1
Query: 7460 SDCASPCQPTCYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCT----NTPGSYYCTCDSGYQGDGRN 8314
            S    PC   C N   S LC+        C  GY+LE                       + RT ++   +C  +    Q  C N               + C C  GF      C D DECS     C ++  C NT GSF C C +GF    +G  C ++NEC     C +    C +++ GY C C +GF +++    C D NECA +   C   S +C NT G +RC C  GF     D      +  C  V EC      C+    NTPG + C C  GY   G+ 
Sbjct: 2410 SQVPKPCTFLCKNTKGSFLCS--------CPRGYLLEE----------------------DGRTCKDLD-ECTSRQHNCQFLCVNTV-----------GAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHG---CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCG--SASCRNTLGGFRCVCPSGFD---FDQ----ALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQG 2646          

HSP 9 Score: 85.8853 bits (211), Expect = 3.144e-15
Identity = 57/169 (33.73%), Postives = 83/169 (49.11%), Query Frame = -1
Query: 15716 EQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPD 16216
             +C CYDG   + A  D+           C   +    +P++  H  G+C N+   G   C C+ GY  R  A  C+D+DEC  G + C  +  C+N  G+++C C  G+VG+G  C D +EC S+   CS    C N  GSY+C C+ G+ G+G  C      A N D
Sbjct: 1219 HRCLCYDG---FMATPDM---------RTCVDVDECDLNPHICLH--GDCENT--KGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVD 1371          

HSP 10 Score: 83.1889 bits (204), Expect = 2.020e-14
Identity = 50/128 (39.06%), Postives = 71/128 (55.47%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL-LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N   CD   +CTN+  G RC C  G+          + R+C+D DEC L        DC NT GSF+C+C +G+ V+   T C+D++EC +    CD++A C+N  GS+ C C PG+ G G
Sbjct: 1196 DVDECEENPRVCD-QGHCTNMPGGHRCLCYDGFMAT------PDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDG 1316          

HSP 11 Score: 80.1073 bits (196), Expect = 1.725e-13
Identity = 53/130 (40.77%), Postives = 70/130 (53.85%), Query Frame = -1
Query: 15767 STKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16144
            S    C G N   + PNV  H  G+C ++   G   C C +G++  AD   C DIDEC R       NG C N +G+YNCLC  GFV   NG +C DF+EC +       +  C NT GS+ C+CQ+G+E
Sbjct: 1798 SPGGACVGRNECREIPNVCSH--GDCMDT--EGSYMCLCHRGFQASADQTLCMDIDECDRQP---CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFE 1919          

HSP 12 Score: 74.7146 bits (182), Expect = 8.558e-12
Identity = 48/129 (37.21%), Postives = 61/129 (47.29%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D +EC  N H C LH +C N    F C C  G+       +      C D DEC +    C S + C N PGSF C C  G+V      C+D++EC      C    DC+N  GSY C C+ GF G G
Sbjct: 1237 VDVDECDLNPHIC-LHGDCENTKGSFVCHCQLGYM------VRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDG-FECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDG 1357          

HSP 13 Score: 72.0182 bits (175), Expect = 5.271e-11
Identity = 48/125 (38.40%), Postives = 62/125 (49.60%), Query Frame = -1
Query: 9266 SKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9640
            S+ D NEC+ N   C  +  C N D  FRC+C  G+       +   G +C+D DEC++        CTN  G F C C  GF       C DI+ECSLN  +C     C NT GSY+C C  G+
Sbjct: 2081 SREDVNECAENPGVC-TNGVCVNTDGSFRCECPFGYS------LDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFR--CHNTEGSYLCTCPAGY 2196          

HSP 14 Score: 71.633 bits (174), Expect = 7.494e-11
Identity = 55/181 (30.39%), Postives = 85/181 (46.96%), Query Frame = -1
Query: 15599 CSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGL 16129
            C+  +   ++P V   + G C N    G   C C  G+    D   C D+DEC    ++C  +GDC N  G++ C C+ G++       C+D +ECE    NC ++A+C N  GS+ C C  G+ G+G  C  +       D+      Q+  C     C++   GS+ C C +G  GDG 
Sbjct: 1194 CADVDECEENPRVC--DQGHCTN--MPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICL-HGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDL-------DEC---VSQEHRCSPRGDCLN-VPGSYRCTCRQGFAGDGF 1358          

HSP 15 Score: 69.3218 bits (168), Expect = 3.357e-10
Identity = 49/133 (36.84%), Postives = 69/133 (51.88%), Query Frame = -1
Query: 9239 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA-LLKCPSTSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDC 9631
            D +EC +    C  +A+C N+   +RC C +G++        S G +C+  +EC  +    S  DC +T GS++C CH GF  +A  T+C DI+EC         N  C N  GSY C C PGF  + N GDC
Sbjct: 1763 DVDECGSRESPCQQNADCINIPGSYRCKCTRGYK-------LSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPC---GNGTCKNIIGSYNCLCFPGFVVTHN-GDC 1884          

HSP 16 Score: 68.1662 bits (165), Expect = 7.630e-10
Identity = 62/236 (26.27%), Postives = 87/236 (36.86%), Query Frame = -1
Query: 15767 DDPHAVDSCHLRDTSG---CVCNDGFLRS--GTTCTPKEQCG-----CYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNV---QCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNEC----------------------------------------ESKTANCSAYATCYNTFGSYKCICQNGYE 16315
            ++P   D  H  +  G   C+C DGF+ +    TC   ++C      C  GD        +          + +   S V +  V    C  +  C N    G   CRC  G+ G    C D+DEC    + CS  GDC+N  G+Y C C+ GF G+G  C D +EC                                        E    N  A+ +C N  G ++CIC  GYE
Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLN--IPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYE 1435          

HSP 17 Score: 66.6254 bits (161), Expect = 1.934e-9
Identity = 43/128 (33.59%), Postives = 63/128 (49.22%), Query Frame = -1
Query: 9266 SSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9646
            ++   D +EC    H C  H  C N    FRC C  G+         +   +C+D DEC+ +  P T  C NT GSF+C+C  G+ ++     C D++EC+     C     C+NT G++ C C PGF
Sbjct: 2358 TAEGRDVDECRMLAHLC-AHGECINSLGSFRCHCQAGYT------PDATATTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNC--QFLCVNTVGAFTCRCPPGF 2476          

HSP 18 Score: 66.2402 bits (160), Expect = 2.940e-9
Identity = 51/152 (33.55%), Postives = 72/152 (47.37%), Query Frame = -1
Query: 15701 CSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYE--GRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE--GNGSICSQIPIIAVNP---DQTNCS 16129
            C   +   +DP +     G C N+   G  +C+C  G+E   +   C DIDECS    +C  +G CVN +G + C C  GF    +   C D NEC  +   C  +  C NT GSY+C C  GY    +G  C+ +     NP   DQ +C+
Sbjct: 1069 CMDVDECARDPLLC--RGGTCTNT--DGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCT 1213          

HSP 19 Score: 65.855 bits (159), Expect = 3.876e-9
Identity = 56/174 (32.18%), Postives = 88/174 (50.57%), Query Frame = -1
Query: 9134 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC-----GCWGDPHCLSFDGNWLHYQGRCKYTLVRD 9631
            D +EC  +   C     C N    F C+C  G++       +   ++C+D DECA   L C   + CTNT GS+ C C  G  + A  T C DI+ECSL+  +C  +  C+N  G++ C+C  GF+ + +   C  +  C     GC  D HC++ +G++    G+  Y+L+ D
Sbjct: 1028 DIDECRISPDLCG-QGTCVNTPGSFECECFPGYE-----SGFMLMKNCMDVDECARDPLLCRGGT-CTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGC--DVHCINTEGSYRCSCGQ-GYSLMPD 1190          

HSP 20 Score: 64.3142 bits (155), Expect = 1.007e-8
Identity = 62/249 (24.90%), Postives = 98/249 (39.36%), Query Frame = -1
Query: 8942 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDEC-ALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTV-CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWGDP---HCLSFDGNWLHYQGRCKYTLVRDECRNGL-------------PIESSTANFEVIMKNWDQNTGTNSMVSWAKEITVKIMNYTIMMKIGFELVVDGQKTSI 9634
             D +ECS     C  H +C N    FRC+C +G+       + S+G  C D +EC    +C     C N  G + C+C  GF + +    C D NEC+L+   C  +A C NT G + C C  GF      G C+ V  C     P    C +  G +L    +  +   +  C +GL              + SS A +E  +                 ++ +  ++   ++ +G  L   G+   I
Sbjct: 2484 FDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFT------LVSSGHGCEDVNECDGPHRC--QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-GSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECKINGLSPRDRPRRSAHRDHQVNLATLDSEALLTLGLNLSHLGRAERI 2723          

HSP 21 Score: 62.3882 bits (150), Expect = 4.474e-8
Identity = 47/138 (34.06%), Postives = 61/138 (44.20%), Query Frame = -1
Query: 9221 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9634
            +D +ECS     C     C N    F C C +G+       +  +GR+C D DEC   +      C NT G+F C C  GF +     C D +ECS     C A+  C NT GS+ C C  GF    +   CE V  C
Sbjct: 2404 LDMDECSQVPKPCTFL--CKNTKGSFLCSCPRGYL------LEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHH-QACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNEC 2532          

HSP 22 Score: 62.3882 bits (150), Expect = 4.626e-8
Identity = 54/184 (29.35%), Postives = 83/184 (45.11%), Query Frame = -1
Query: 15548 CHEYGECFNSTASGESECRCKKGYE--GRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGCTYYPCPQNS 16087
            C  +G C N+   G   C C +G+        C D++EC  G + C     C NQLG Y C C  GF  +     C D NEC      C + A+C NT G ++C+C +G++ + ++     +      +  CS+          +C +   G F C C +G F  G QG   +G  + P PQ++
Sbjct: 2496 CGAHGHCHNT--PGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHG--CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSY----------SCAN-TPGGFLCGCPQGYFRAG-QGHCVSGLGFSPGPQDT 2661          

HSP 23 Score: 62.003 bits (149), Expect = 5.801e-8
Identity = 39/101 (38.61%), Postives = 54/101 (53.47%), Query Frame = -1
Query: 15716 DIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE---GNGSI----CSQIPIIAVNPD 15991
            DIDEC     +C+ NG C+NQ+G++ C C  GF  N   L C D +EC S+ + C   A C N  GSY+C C  GY+   G   +    C +IP +  + D
Sbjct: 1721 DIDECGEIPAICA-NGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCSHGD 1820          

HSP 24 Score: 60.8474 bits (146), Expect = 1.124e-7
Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = -1
Query: 9251 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK---CPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9634
            +DF+EC+T         +C N    F C C  G+      E+ ++G++C+D +EC  L     P T  C N  GSF C C  GF +     C DI+ECS   ++C     C N+ GS+ C C PGF  S N
Sbjct: 1885 VDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGF------ELTADGKNCVDTNECLSLAGTCLPGT--CQNLEGSFRCICPPGF-QVQSDHCIDIDECSEEPNLC-LFGTCTNSPGSFQCLCPPGFVLSDN 2005          

HSP 25 Score: 60.8474 bits (146), Expect = 1.223e-7
Identity = 58/194 (29.90%), Postives = 83/194 (42.78%), Query Frame = -1
Query: 9119 SSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCP--STSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC-----------GCWGDPHCLSFDGNWLHYQGRCK-----YTLVRDECRNG 9646
            +   +D +EC      C  +  C N    FRC+C  G+         S   +C D DEC   + P    +DC N PGS+ C C  G+  +    C   NEC    ++C ++ DC++T GSY+C C  GF+ S +   C  +  C              G  +CL F G  + + G C       TLV   CR G
Sbjct: 1716 TGKPLDIDECGEIPAIC-ANGICINQIGSFRCECPAGFN------YNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFG 1901          

HSP 26 Score: 60.077 bits (144), Expect = 1.906e-7
Identity = 33/91 (36.26%), Postives = 48/91 (52.75%), Query Frame = -1
Query: 15770 CRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16036
            C C +GY  E     C D+DEC+   + C     CVN +G + C C  GF  +   C D +EC ++   C A+  C+NT GS++C C  G+
Sbjct: 2429 CSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGF 2517          

HSP 27 Score: 60.077 bits (144), Expect = 2.021e-7
Identity = 45/123 (36.59%), Postives = 62/123 (50.41%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC+ N   CD +  C N   G+RC+C  G+      +   + R+C D DECA     +   C N PG F C C+ G+ +      C DINEC+    +   N  CINT GSY+C+C   F
Sbjct: 1362 DRDECAENVDLCD-NGQCLNAPGGYRCECEMGF------DPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECA--DPVNCINGVCINTPGSYLCSCPQDF 1475          

HSP 28 Score: 58.9214 bits (141), Expect = 4.051e-7
Identity = 47/140 (33.57%), Postives = 60/140 (42.86%), Query Frame = -1
Query: 9221 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9631
            D NEC   F     H  C N    F C C       GG  + +  R+C D DEC +         C NTPGSF C C  G+      +  C D++EC+ +  +C     C NT GSY C C PG   +     CE +  C
Sbjct:  986 DVNECKV-FPGLCTHGTCRNTVGSFHCACA------GGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGT-CTNTDGSYKCQCPPGHELTAKGTACEDIDEC 1117          

HSP 29 Score: 58.9214 bits (141), Expect = 4.632e-7
Identity = 36/106 (33.96%), Postives = 49/106 (46.23%), Query Frame = -1
Query: 15761 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGN 16075
            G C N   S   EC     Y      C D+DEC      C  N DC+N  G+Y C C  G+ +  G  C   NEC  +  N  ++  C +T GSY C+C  G++ +
Sbjct: 1735 GICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECR-EIPNVCSHGDCMDTEGSYMCLCHRGFQAS 1839          

HSP 30 Score: 58.9214 bits (141), Expect = 4.671e-7
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = -1
Query: 9239 NFHDCDLHANCTNLDSGFRCDCIKGW-QGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPT--VCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDC 9610
            +F +  L+  C    S +RC+C  G+ Q + G         CID DEC    C    DC N PG++ C C+ GF +A PT   C D++EC ++  +C     C+NT GS+ C C  GF  S +  +C
Sbjct:  414 HFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGE--------CIDVDECTSSPC-HHGDCVNIPGTYHCRCYPGF-QATPTRQACVDVDECIVSGGLCHL-GRCVNTEGSFQCVCNAGFELSPDGKNC 529          

HSP 31 Score: 58.9214 bits (141), Expect = 4.994e-7
Identity = 43/118 (36.44%), Postives = 55/118 (46.61%), Query Frame = -1
Query: 15740 YGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE--GNGSICSQI 16078
            +G C N+  S    C      + +  NCTDIDEC     +C   G CVN  G++ C C  G+    +   NC D +EC      C    TC NT GSYKC C  G+E    G+ C  I
Sbjct:  999 HGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCG-QGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRG-GTCTNTDGSYKCQCPPGHELTAKGTACEDI 1114          

HSP 32 Score: 57.3806 bits (137), Expect = 1.309e-6
Identity = 44/124 (35.48%), Postives = 59/124 (47.58%), Query Frame = -1
Query: 9266 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKA-APTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9634
            +D +EC  +   C L   C N +  F+C C  G+      E+  +G++C+D +ECA         C N  GSF C C  GF+ A     C DI+EC     IC  N  C NT GS+ C C  G 
Sbjct:  488 VDVDECIVSGGLCHL-GRCVNTEGSFQCVCNAGF------ELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ-TPGIC-VNGHCTNTEGSFRCQCLGGL 602          

HSP 33 Score: 57.3806 bits (137), Expect = 1.331e-6
Identity = 48/136 (35.29%), Postives = 66/136 (48.53%), Query Frame = -1
Query: 15755 FCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGS 16150
            FC  ++ C+         NV   + G+C N  A G   C C+ G++   D+  C D+DEC++G+      G C N  G + C+C  G+     G NCTD NEC +   NC     C NT GSY C C   +E N S
Sbjct: 1359 FCEDRDECA--------ENVDLCDNGQCLN--APGGYRCECEMGFDPTEDHRACQDVDECAQGNLC--AFGSCENLPGMFRCICNGGYELDRGGGNCTDINEC-ADPVNC-INGVCINTPGSYLCSCPQDFELNPS 1480          

HSP 34 Score: 54.6842 bits (130), Expect = 8.475e-6
Identity = 45/137 (32.85%), Postives = 64/137 (46.72%), Query Frame = -1
Query: 15617 EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--EGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16015
            EGR     D+DEC   +++C+ +G+C+N LG++ C C+ G+        C D +EC      C+    C NT GS+ C C  GY  E +G  C  +        Q NC F           CV+   G+FTC C  G
Sbjct: 2360 EGR-----DVDECRMLAHLCA-HGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFL--CKNTKGSFLCSCPRGYLLEEDGRTCKDLD--ECTSRQHNCQF----------LCVNTV-GAFTCRCPPG 2475          
BLAST of SMED30010561 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 487.263 bits (1253), Expect = 5.898e-137
Identity = 673/2454 (27.42%), Postives = 970/2454 (39.53%), Query Frame = -1
Query: 1199 NGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGV-TCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTP-GCDGDNPCNTVQCTKPNEICY--LGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKC----ANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAE------CIDTDGGYYCQCKTGFTGHCD--ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYS--GDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD---------TNGSC---VDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTN-QCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN----------CFKKDTDTDACQIE----------------------NYCTDGDCYDGICHCPSGFVFKSN---------------KCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIK-SCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-------ETNNVCNCGSHGICGPNYICQCKSGYEINPS-GMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFY-GDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQ-VCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCI----VNVESSIYECQCHTEF-----------------------SGDGITSC--------IKNNLCFVNGKSSCHENAICEQVNAT-YRCICP--DGFQGDGYN-FCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDD--ICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDE--CKFGVANCSENALCINKPGTFAC-ECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNM-VGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKD--SSYTCQCIEGFQRI-NGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY---CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPN-GDCELINE--CLENIDR--CQVLNGADSVCY-------------------DLP--IGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSC-LDGLCNNLPGSFECLCNIGYDLVNGK--CTDINECSNNSQICGPQA-AGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQ-IGICRNINECQ-IEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICG 7996
            N  +G   + + ID C + T++C  N  C  T  S+ C C  G+  +    C +++EC   SPC +   +C +    Y CRC  GF    T   C D +EC  +G LC      C NT GS++C C  GF  SP D   C D NEC     C      C N  GS+ C C  G+     G  C DIDEC +  +C   +  C N  GS+ C+CL G   G DG         T     CY  + +  C   F   VT + C         AN   G    C    A     ++  C  G  +++  +           +++C  + E      C +  G Y C C  G+       +C D+DECA  LN+   D   C+NS GS++C C  G+    D  +C ++DECL    +       C N+ G + C+C  G + D         T G+C   + E+ C     G    ++C  T G+            G  C+            C ++  C         G+   T   C + +ECES      N  C++T GSF C C EG + D             CF +  D D C +                         C D +  +    CP G  F S                K F   C +   +N + S               L +    C DIDEC  + D C + + C N  GS++C+C P Y   F   K CM V     +     G  C N  GS  C      +    G      +  S   G+CP +  C   +  + C C  G++    +  C DI+EC  ++ N   +  C NTEGS+ CSC +GYS       C       E   VC+ G        + C C  G+   P    C DV+EC       +   C NT GS+ C C   +        C + D+C+     C +   C L++ GS      C    +    EC  +++ V Q   C     C    G   C C  G+ GDG  C D DEC+  +V   +N  C N  G + C C +GF   E+     +C D+DEC     CA  G C+N  G F+C C  G+  D     R    C     C +  +CI    +N   S Y C C  +F                        GD   SC         + + C   G++  +   +C   N T YR +CP  +GFQ +       DIDEC             CVN+ G + C C  G    +   IC DIDECS++  +       C N  G Y+C C   +     G  C D+ +  C        +N L  N      C     G   N       + C  P  SP     D   +C N+ PG+  +  +G        +    C ++P  C AN  C   N+     CEC   F   +    C    EC ++   C ++ ++C+ +   ++C+C  G+ +  G  C  +NEC    P+      + S G C++T+GS++C C++  Q + + + C       M +D CDR+     + K+   SY C C  GF    NG CVD DEC   +        C N  GS+ C C D  +L    K C D NEC      C     C N +GS+ C C  G++    +C DIDEC+ + + C     C+N PGS +C C PGF   D  + C +T              S+C        C+    +  +    C      +   D  E   ++ +      C    GA        + G   +  ED NECA     C      C N D +      F+C C  GY        C++ +EC   V + C +   C +  G +EC C  GF+      CE+I+EC      C+    C +    + C C  G+   ++  + C D+DEC +           C N  G+F CVCP G     G    C D NEC        N  C NT   F C C  G +  P   +C  I +  C   + +  C+ L+ +                         LP    Y  +CP G      +     + +EC +  H C  ++ EC+++ GSF+C C+ G++ ++    C+D DEC    +     C N     T G F C CP G++   +   C D+DEC+  Q      NC  +   C+NTVG F C C  GF   ++   C D DEC   P  C   G C+N PGSF C C+ G+ LV+    C D+NEC       GP      C N  G ++C C  G+       +  C   NEC     TC S A C +   G+ C+C  G+  DQ +G C+ ++EC      C Y   C +T G + C C  GY   G   C +  G
Sbjct:  397 NSNIGTATLNQTIDICRHFTNLC-LNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTS-SPCHHG--DCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHL--GRCVNTEGSFQCVCNAGFELSP-DGKNCVDHNECATSTMCVNGV--CLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICV--NGHCTNTEGSFRCQCLGGLAVGTDG----RVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSEC-------CCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRD----------INECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECA--LNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECL----SSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAW----------GSPCE-----------RCEIDPACAR-------GFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR-WDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFA-----LDAQERNCTDIDECRISPDLCGQGT-CVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINEC--RVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASC-LNIPGSF--SCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAE-NVDLCDNGQCLNAPGGYRCECEMGFDPTEDH---RACQDVDECAQGNLCAF-GSCENLPGMFRCICNGGYELD-----RGGGNCTDINECADPVNCINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDEC--QELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTH--SGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPC----EACPTPI-SP-----DYQILCGNQAPGFLTDIHTGKP------LDIDECGEIPAIC-ANGICI--NQIGSFRCECPAGFNYNSILLACEDVDECGSRESPC-QQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREI-PN------VCSHGDCMDTEGSYMCLCHRGFQASADQTLC-------MDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLP-GTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCL-FGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQ------------SFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGA--------VPGPDDSR-EDVNECAENPGVCT--NGVCVNTDGS------FRCECPFGYSLDFTGINCVDTDEC--SVGHPCGQ-GTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFR--CHNTEGSYLCTCPAGYTLREDGAM-CRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHG----SGYTAEGRDVDECRMLAHLC--AHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFLCKN-----TKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQ-----HNCQFL---CVNTVGAFTCRCPPGFT--QHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD------GPHRCQHGCQNQLGGYRCSCPQGFTQH--SQWAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSY--SCANTPGGFLCGCPQGYFRAGQGHCVSGLG 2653          

HSP 2 Score: 462.225 bits (1188), Expect = 2.466e-129
Identity = 653/2279 (28.65%), Postives = 900/2279 (39.49%), Query Frame = -1
Query: 1997 ECTNITCSNDAFCDFKDDDYGCHCKNGFM--GDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSPCDNATEE--CFDKVPG------------------------------YECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNL-VHECDKNYAKCTNTPGSYYCTCDSGYQ--GDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRC-------------LDGTPGC------DGDNPCNTVQCTKPNEICY-LGQCF------------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYY----CQCKTG--FTGHCDECRDIDECAFS-----------------------LNNCDS-----DRATCENSIGSFTCRCNEGYSGDGSV--CSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD--TNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGY--IGSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTNQ--CINTDECESQTS-CDVNANCIDTHGSFICYCNEGY--IGDGINCFKKDTDTDACQI-ENYCTDGDCYD----GICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCN-QSCPTGQYCNN----GSCSCLMGLNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCE------TNNVCNCGSHGICGPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDKCKTKALQCQ----AGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCV--DVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFI----GDGKYDCRIDSKCEKYGG-CHEDAS---------CIVNVESSI-YECQ-CHTEFSGDGITSCIKNNLCFVN----GKS----SCHE------NAICEQVNATYRCICPDGFQGDGYNF-CNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGT--GWFCIKQTPCDVPNACKANQTCTPSNENSLA---ICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMV--GNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVC--------------TCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSK-----------DSSYTCQCIEG----FQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGY--KWNGTNCEDIDECAIKTHPCHDLA-RCSNVPGSCKCKCQPGF-----TGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYE---------DSNQMECIGDVCYKKCSDID---ECVTRKSACHKFAECTN---------NDGAYVCTCP--SYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGK-CENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECT-NPTSCSSMPHSICMNNPGSFECVCPHGFSL--QGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPN-GDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCV 8071
            EC   T   +  C  +D  + C CK GF+    G  C DIDEC     +C  N  C NT GSF C C  G     +G  C +    +  S C  A E+  C    PG                              ++  C  G +  TT G   D NECA    +C   +  C N  GSYRC C  G+  +      CTDV+EC L    CD  +  C N+PGSY C+C  G+    D   C D+DEC S+         C NL GSY C+C             LD T G       +     N    +  +E C  LG  +            C  GF   +T   C+D++EC++    C     +C N  GS+ CEC  G  + +  ++C ++      L    +  EC  T  G Y    C C  G  +   C+ C D +   F+                       +N C          TC N++GSF C C  G++ D     C++IDEC +    C +    C N  G FEC C  GY+S      +C+D +EC      C     C NTDGS+ C C  G+     G  C   E ++EC     LCP +  CVN      C C +G++++ ++  C++ +EC  Q   CDV+  CI+T GS+ C C +GY  + DG  C     D D C+     C  G C +      C C  GF+                                      + D   C+D+DEC+ N   C     C N  GS+ C C   Y+ V K    C  V   +    +C +   C N     SC CL G      +  +L+ C      C P       +C      Y C C+ G+ G G   C D DEC   ++ C  N  C N  G + C C+ G+        C+        N+C  GS       + C C  GYE++  G  C D+NEC     C I   CINTPGSY C CP++F  +P    C + +     L+      +G  C   +   V     C S      N C    ++C   N   +        R  C    G+  +    +  D+DEC      C     C N  GSF C C  G+   E+  +   C DIDEC         G C NT+G++ C C   ++    G+   D R       Y G C  + +         C  N+  +    C+ C T  S D    C      F+     GK      C E      N IC     ++RC CP GF  +     C D+DEC +  +  C     C+N  G Y C C  G  +     CV  +EC   +     S+  C + EG+Y C C  GF    D  LC DIDEC         N  C N  G++ C C  G  + +   C D DEC    G     +      C N    + C CQ G++ T  G  C+    C          TC P    +L     C C P F++++D CI   EC  + + C   T  C      F+C C PGF +   G+ C D  +       F A KC        NT  +  C               C QE        C        G D+    V +C  +            D S+ C+C  G    F  IN  CVD DEC+  +       TC N+IG + C C D  +  L    C D +EC  NP++C    +C NT+GSY C C  GY  + +G  C D+DECA     CH     C N+ G+  C C PG      +G+G   C + + C A+ D+ C  G   N  G+F  C+C  G++         D  Q  C  +V    C  +    E VTR   C                    AY   CP  S  T +G+    D +EC +  H C             +N L  F+CHC  GY        CL+ +EC + V   C    +C +T+GS+ C C  G+     G+ C++++EC  +  NC    +C +    F+C+C PGF    +    C D DEC+  P  C +  H  C N PGSF C C  GF+L   G  C D+NEC  P+ C     C N + G+ CSC  G  Q      C   NEC  +   C       + C +   G+ CVCP GF  D+     C+  +EC      C  S   C +T G F C C  G+ +   G CV
Sbjct:  534 ECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC-QTPGIC-VNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDT---HVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSG-LGITTDGR--DINECALDPEVC--ANGVCENLRGSYRCVCNLGYE-AGASGKDCTDVDECALNSLLCDNGW--CQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVS---GVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFAR-MTGVTCDDVNECESFPGVCP--NGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRW--DEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGT--CVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCR-GGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRAC----ADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFM-------------------------------------ATPDMRTCVDVDECDLNPHICLHGD-CENTKGSFVCHCQLGYM-VRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSP-----RGDCLNVPGSYRCTCRQGFAGDGF-FCEDRDECAENVDLCD-NGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNC-INGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPC----ELCPMANTTEY--------RTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGD-CVNTFGSFQCECPPGYHLSEHTRI---CEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRES-PCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNEC--REIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCG---NGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVG-----QVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-----LSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGT--CTNSPGSFQCLCPPGFVLSDNGHRCFDTRQ-SFCFTRFEAGKCSVPKA--FNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGIN--CVDTDECS--VGHPCGQGTCTNVIGGFECACADGFEPGL-MMTCEDIDECSLNPLLCA--FRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEG---CTDDNECHAQPDL-CVNGRCVNTAGSF-RCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGR----DVDECRMLAHLCAHG--------ECINSLGSFRCHCQAGYTPDATATTCLDMDEC-SQVPKPCT--FLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQF--LCVNTVGAFTCRCPPGFTQHHQA---CFDNDECSAQPGPCGA--HGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHG--CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-----GSASCRNTLGGFRCVCPSGFDFDQAL-GGCQEVDECAGRRGPCSYS---CANTPGGFLCGCPQGYFRAGQGHCV 2649          

HSP 3 Score: 437.958 bits (1125), Expect = 7.115e-122
Identity = 680/2581 (26.35%), Postives = 968/2581 (37.50%), Query Frame = -1
Query: 1238 GNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCH------------CKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTD--VNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDI-DECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGF--TGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--SGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCICRAGY-IGS-GRNCDPQE------GLEECGKLLCPLNALCVNSTCLCKS---GYENSTNQCINTDECESQTSCD----------------------VNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIEN-YCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKC-PPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC-NNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC------------------------ETNNVCNCGSHGICGP-----------NYICQCKSGYE------INPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNK-CFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGY--YGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGF--IGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEF-SGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQ-GDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG--TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYK--GTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNM---------------------VGNTCQDKNECDPTSPDFAAQKC---------------LASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSC---KNNATCNNMIGSYVCK-------------------CPDNLK---------------LDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGT--NCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNEC-ALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDE-----------CTNPTSC-SSMPHSICMNNPG----------------SFECVCPHGFSLQGG---YCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNG-ADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEG---FIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFEC-------------------LCNI-GYDLVNGKC----------TDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIG-ICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGY 8200
            G C++P  C C  +DGT   +        CSV C   G      C          C     D GCH            C  GFMG         +C  +         C   +G   C      +  G+ CT    C  +     A     +  P     C++GF+ N  TG C D +EC     LC     +C N  GS+ C C  G R S   S  C D     C  V    +             C CD G         ++     SN+  Q        LPG           G +G  P        P+     G      G  N  T  + + ID C    N C     +C     SY CEC  GY      +  +         H    + +C++  G Y+C+C  GF  T     C D+DEC  S   C   R  C N+ GSF C CN G+  S DG  C + +EC          +  C N +G F C C  G+     G  C+D +EC+    G   N  C NT+GSF C C  G  +G+ GR C          G  E G    P       S C C +   G+      C   D  E Q  C                        N  C +  GS+ C CN GY        K  TD D C + +  C +G C +      C CP GF F                                       D+  C D+DEC   +     + +C N  GSY CKC P + LD                    P+G +C ++   +C + +     +      S  S  C        + CE         C  G+  +   +C D++EC      C  N  C NT GSF C C  G   ++S  LC                           +VC C    + G             +   C  G        ++     +DVNEC+          C NT GS+ C C   F  D Q + C + D+C+     C  G  C  +     CE      S  ++   C+ V++  ++        C   +G   C C  G+     G  C D+DECS  D  CP+   C N  G+F C+C+ GFQ   +      C DI+EC +      +  C NT GS++C C  G+  + DG+    +D +CE+     +   C  N+    + C C+  F +   + +C+  + C +N     H +  CE    ++ C C  G+    G   C+D+DEC     HNC S   C+N  G ++C C  G V     C D+DEC S Q ++CS    C N  G+Y C C +GF GDG  C D DEC   V  C +N  C+N PG + CEC+ G     +   C D DEC +               C+N    + C C  GY+    G  C     C  P  C  N  C   N     +C C  DF+L      C+     + +  NC  ET +  + D G  C  + G  +                     + NT + +  C P    F   +                L  GG C+NT GSF C C     ++E+   C+ ID C+     C      C ++   +YTC C   + ++NG     + C D   S      N TC N +   V +                   CP  +                 D+      D +EC E P IC +   C+N  GS+ C+C  G+ +N     CED+DEC  +  PC   A C N+PGS +CKC  G+      +C+  + C    +V C  G   +  G+++ C C  G++ S             C DIDEC   +  C     C N  G+Y C C           C D +EC  L    C           + +N    F C C +G+      + C++ NECL+ +   C+    C + EGS+ C C  GF Q+ S  C +I+EC E+ + C +   C +    F C C PGF  SD  +  C D  +           C+ P +  ++     C   PG                +F+ +CP G     G      D+NEC        N VC NT   F C C  G       D   IN C++  D C V +      C ++  G+ C C DGF  +      CE+ +EC +N   C      C +T GS+ C C  G++   DG  C D DEC   +Q         +C N  G F C CP G      +   C D +EC      +  D C  VNG C+NT G F+C C+ GF      T+C DI +       L  +C +L  S E                    LC + G       C           D++EC   + +C   A G CIN+ GSF+C C  GY      +   C  ++EC ++   C     C +    + C C  GY  ++ G  C++++EC   + +C +L  C++T G++ C C  G+
Sbjct:   93 GFCSQPNLCTC--ADGTLAPSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGP--------QCERDYRT----GPCFGQVGPEGCQ----HQLTGLVCTKALCCATVG---RAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQ--GGSCVNMVGSFHCRCPVGHRLSD-SSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCL--NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCH----HGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGR--CVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMC---VNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ--TPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASG--KDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFW-------------------------------------QDTEICKDVDEC---LSSPCVSGVCRNLAGSYTCKCGPGSRLD--------------------PSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDP--ACARGFARMTGVTCDDVNECESFPGVCP-NGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQG-TCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQ-CVNVIGAFQCSCHAGFQSTPD---RQGCVDINECRVQNG-GCDVHCINTEGSYRCSCGQGYSLMPDGRACADVD-ECEENPRVCDQGHC-TNMPGG-HRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGD--CENTKGSFVCHCQLGYMVRKGATGCSDVDEC-EVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS-QEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLC-DNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLC-------AFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNC-INGVCI--NTPGSYLCSCPQDFELNPSGVGCV-----DTRAGNCFLETHD--RGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLC-PGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT--CYNTL-GNYTCVCPAEYLQVNGG----NNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICAN-GICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNV-CSHGDCMDTEGSYM-CLCHRGFQASADQ--------TLCMDIDEC--DRQPCGN-GTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFG--------HCLNTAGSFHCLCQDGFELTADGKNCVDTNECLS-LAGTCLP-GTCQNLEGSFRCICPPGF-QVQSDHCIDIDECSEEPNLC-LFGTCTNSPGSFQCLCPPGFVLSDNGH-RCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSL----DFTGIN-CVDT-DECSVGHPCGQGTCTNVIGGFECACADGF--EPGLMMTCEDIDECSLNPLLCAF---RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHA--RGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNEC-----HAQPDLC--VNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLC---AHGECINSLGSFRCHCQAGYTPD--ATATTCLDMDECSQVPKPC--TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGF 2476          

HSP 4 Score: 323.939 bits (829), Expect = 3.133e-87
Identity = 484/1807 (26.78%), Postives = 675/1807 (37.35%), Query Frame = -1
Query: 3350 QPTCYNNTNSMLCTGQCVESCICAPGY---VLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDD------------DYGCHCKNGFMG--DGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYP-LSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLV-HECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCF---------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGE-----NAECIDTDGGYYCQCKTGF-------------TGHC-DECRDIDECAFSLN---NCDSDRATCENSIGSF------------------TCRCNEGYSGD--GSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYK-SDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGY--IGSGRNCDPQEGLEECGKLLCPL-------NALCVNST---CLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC-QIENYCTDGDCYDGI----CHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSC-------SCLMGLNSQTDDDGNL-----NCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP--------NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENF-YGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF--QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVD---DICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL--CHDIDE-------CKFGVANCSENALCINK--------------------PGTFA----CECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYK--GTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRIN--GSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG 8293
            Q TC N   S          C C PGY    +   NC   + C    +       G   TN + S KC+C     +L      C +   C   D              + C C  GF    D   C DI+EC      CD +  C NT GS+ CSC +G+    +G  C +++EC      CD     C +   G+ C C  GFM       C D +EC    ++C  +  +C NT GS+ C C+ G+      +  C+DV+EC +  H CD ++A C N PGS+ C C  G+ GDG  C D+DEC S +    P   C+N+PGSY C C  G  G DG    +  +C +  ++C  GQC          C+ GF        C+D+DEC    N CA     C NL G + C C  GY +               ++++C +     N  CI+T G Y C C   F              G+C  E  D  +   S +        RA+C  S+G                     C   EG+  +    +  +IDEC  L GL  C      C N  G F+C C  GY  S+    C D +EC      C     C NT G++ C+C A Y  +  G NC          K +C         N L  N T   C C      + N+    + C +  S D    C +    F+   + G          K  D D C +I   C +G C + I    C CP+GF + S                                         C D+DEC      CQ+N+ C N  GSY CKC   Y      G  C  V  ++C +       C++G C        CL     Q   D  L      C +            N  C+  +  Y C C PG+       C D DEC   +        C NT GSF C C+ G+   +    C   N C     G C P        ++ C C  G+++  S  C D++EC  +    +   C N+PGS++C CP  F   D  ++CF+ +      + +AG+      + +   K  C  S+        P     Q  +      C   +G           G  +   DV+EC+     C  N  C N DGSF C C  G+      +   +C D DEC +   C   G C N IG F+C C DGF                      +   ++  E  I EC              +   LC             C     +Y C CP G+  + DG   C D+DECA+      +   +C N  G + CVC  G   +    + C D +EC + Q + C  N  C N  G++ C C EGF     L  CHDI +        +    + S ++  + +                    PGT A    C   +G    G    D DEC+             +  C N    + C CQ+GY    T   C+    C  VP  C    T    N     +C C   + LE D  TC    EC ++  NC      CV     F C C PGF      C D +EC        A       G C NT GSF C C+Q   +  +   C+ ++ C  G   C    ++    +   Y C C +GF + +    CVD +ECA    +C  +A+C N +G + C CP     D +   C + +EC      C     C NT G + C C  GY   G
Sbjct: 1041 QGTCVNTPGSF--------ECECFPGYESGFMLMKNCMDVDEC----ARDPLLCRGGTCTNTDGSYKCQCP-PGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQG--HCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHIC--LHGDCENTKGSFVCHCQLGYMVRK-GATGCSDVDECEVGGHNCD-SHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAG-DGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDEC-AQGNLCA--FGSCENLPGMFRCICNGGYELDR-------GGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGL--CQGGD--CVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT-CYNTLGNYTCVCPAEYLQVNGGNNCMDMR------KSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNR--PCEACPTPISPDYQILCGNQAPGFLTDIHTG----------KPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSIL-------------------------------------LACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGY--KLSPGGAC--VGRNECRE---IPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCG--------NGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-LSLAGTCLPGTCQNLEGSFRCICPPGFQVQ-SDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTT--KTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVP--------GPDDSREDVNECAENPGVC-TNGVCVNTDGSFRCECPFGYSLDFTGI---NCVDTDECSVGHPCG-QGTCTNVIGGFECACADGF----------------------EPGLMMTCE-DIDECS-------------LNPLLCAFR----------CHNTEGSYLCTCPAGYTLREDGA-MCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHA-QPDLC-VNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGR---DVDECRM------LAHLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPC----TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL---CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAH------GHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHGCQN----QLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-GSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCS--YSCANTPGGFLCGCPQGYFRAG 2644          

HSP 5 Score: 121.324 bits (303), Expect = 6.834e-26
Identity = 176/685 (25.69%), Postives = 256/685 (37.37%), Query Frame = -1
Query:  494 NSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIY--NNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDE---------------------------CQFPNSCLDGLCNNLPGS----FECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQ-IGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCVCQGPRCRDN-------GPVCDTQGITYQS--EKQMFETTCKQNIVGEV----EYYNECQKSCATVTCPGI---EKCSMVNDRPSCTC----------QNCTQAELTPRLFCSNN---GIEFHSICQMKTWICNTKSEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKASMFNGNCEDPLFETQQCYNGPCPGDACE-NITCAPGSFCESGKCICPDCSDQRIPDPVCGK 2353
            N  C  T S + C C  G  Q   G+C  ++EC  +             C ++P  Y C C  GF       Q C + +EC ++   C      CV+T GSF+CVC  GF  + DG +CVD++EC  S       C NG C+N  G F+C C  GF+     + C+D+DEC    +         VNGHC NT G F+C C  G  +  +   CVD                              C  P+      C   P      F+ LC+ G  +      DINEC+ + ++C   A G+C N  GS++C CN+GYE   G S   C  V+EC   ++ C  N  C +    Y C C  G+   Q   IC++++EC +   C     C +  GSY C                 CGP S L       ++  +  C    Q  RC  N          C T G  + S  E+   +  C +          +  NEC+        PG+    +C        C C          + C    L P     +    G+      +M    C+    I   +   C    D E  E+ S       C  G    +R  +    F  +  +       C +G C       +  CA G   ++ +  C D  + RI   +CG+
Sbjct:  421 NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCH-------HGDCVNIPGTYHCRCYPGFQATPTR-QACVDVDECIVSGGLCHLG--RCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATS-----TMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGIC--------VNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDG-RDINECALDPEVC---ANGVCENLRGSYRCVCNLGYE--AGASGKDCTDVDECALNSLLC-DNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDEC-LSSPC-VSGVCRNLAGSYTCK----------------CGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESF------PGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCS----IGAVWGVECEACPDPESLEFASL------CPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQ 1041          

HSP 6 Score: 119.398 bits (298), Expect = 2.382e-25
Identity = 147/513 (28.65%), Postives = 205/513 (39.96%), Query Frame = -1
Query: 1235 CKPGFKWSDETNLNCEDIDECTN-PTSCSSMPHSICMNNPGSFECVCP--HGFSLQGGYCNDINE--CLIPNSCGQNSVCANTVSGF-----------NCSCANGARQL--PNGDCELINECLENIDRCQVLNGADSVCYDL----------PIGYACVCPDGFVNDEVFPQVC---ENQNECEIN--IHSCQA-----SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGF--IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGK--CTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGY-----------------------ENSGGKSYNPCQSVNECVKLNITCPSNAQC----VDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYK 2566
            C+ GF  +  T   C+D+DEC   P  C       C+N  GSF C CP  H  S     C D     C      G+   CA  ++G             C  A    +L  P G  E    C +   R  +L G   +   L          P+G A + P G  +    P +     N     +N  I  C+       N  C+ T  S++C C  G++++  G+C+D DEC  S       C++G C+N  G + C C  GF        C+DVDEC +         C    G C+NT G FQC CN GF +  +   CVD +EC     C++G+C N  GSF CLC  G+ L  G   C DI+EC    Q  G    G C N  GSF+C+C  G                        + S  + +    + +EC   N        C       S  ++ +C  G      G  R+INEC ++        C +  GSY+C C  GY+
Sbjct:  232 CRRGFIPNIHTGA-CQDVDECQAVPGLCQG---GSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGR---CAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQ---RLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHG-SDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSP------CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVS-----GGLCHL--GRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC----QTPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDG--RDINECALDPEVCANGVCENLRGSYRCVCNLGYE 714          

HSP 7 Score: 107.842 bits (268), Expect = 7.305e-22
Identity = 101/350 (28.86%), Postives = 149/350 (42.57%), Query Frame = -1
Query: 2693 KPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFT----GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGD-GKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECR 3721
            + +D C M    C     +CI+S   S+ C C  G+       +C+D+DEC+     C     C N  GS++C CP    L+   + C D +EC      C  L  C+NT G++ C+C  G+  +   C D DEC+ +  PC     C N PGS +C+C  GFT    G G     E D  P R    C      N +G +  C+C  G+   +Q        + +C D +EC      C   A C N  G + C CPS    D     C++ +ECA     C+ + +         N    F C C  GY +  G   C++     +P   D  +    + +E  YEC+
Sbjct: 2362 RDVDECRMLAHLCAHG--ECINSL-GSFRCHCQAGYTPDATATTCLDMDECSQVPKPC--TFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDG-PHRCQHGCQ-----NQLGGY-RCSCPQGFTQHSQ--------WAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCA---------NTPGGFLCGCPQGYFRA-GQGHCVSGLG-FSPGPQDTPDKEELLSSEACYECK 2677          

HSP 8 Score: 90.8929 bits (224), Expect = 8.859e-17
Identity = 85/291 (29.21%), Postives = 114/291 (39.18%), Query Frame = -1
Query: 7460 SDCASPCQPTCYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCT----NTPGSYYCTCDSGYQGDGRN 8314
            S    PC   C N   S LC+        C  GY+LE                       + RT ++   +C  +    Q  C N               + C C  GF      C D DECS     C ++  C NT GSF C C +GF    +G  C ++NEC     C +    C +++ GY C C +GF +++    C D NECA +   C   S +C NT G +RC C  GF     D      +  C  V EC      C+    NTPG + C C  GY   G+ 
Sbjct: 2410 SQVPKPCTFLCKNTKGSFLCS--------CPRGYLLEE----------------------DGRTCKDLD-ECTSRQHNCQFLCVNTV-----------GAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHG---CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCG--SASCRNTLGGFRCVCPSGFD---FDQ----ALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQG 2646          

HSP 9 Score: 85.8853 bits (211), Expect = 3.144e-15
Identity = 57/169 (33.73%), Postives = 83/169 (49.11%), Query Frame = -1
Query: 15716 EQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPD 16216
             +C CYDG   + A  D+           C   +    +P++  H  G+C N+   G   C C+ GY  R  A  C+D+DEC  G + C  +  C+N  G+++C C  G+VG+G  C D +EC S+   CS    C N  GSY+C C+ G+ G+G  C      A N D
Sbjct: 1219 HRCLCYDG---FMATPDM---------RTCVDVDECDLNPHICLH--GDCENT--KGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVD 1371          

HSP 10 Score: 83.1889 bits (204), Expect = 2.020e-14
Identity = 50/128 (39.06%), Postives = 71/128 (55.47%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL-LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D +EC  N   CD   +CTN+  G RC C  G+          + R+C+D DEC L        DC NT GSF+C+C +G+ V+   T C+D++EC +    CD++A C+N  GS+ C C PG+ G G
Sbjct: 1196 DVDECEENPRVCD-QGHCTNMPGGHRCLCYDGFMAT------PDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDG 1316          

HSP 11 Score: 80.1073 bits (196), Expect = 1.725e-13
Identity = 53/130 (40.77%), Postives = 70/130 (53.85%), Query Frame = -1
Query: 15767 STKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16144
            S    C G N   + PNV  H  G+C ++   G   C C +G++  AD   C DIDEC R       NG C N +G+YNCLC  GFV   NG +C DF+EC +       +  C NT GS+ C+CQ+G+E
Sbjct: 1798 SPGGACVGRNECREIPNVCSH--GDCMDT--EGSYMCLCHRGFQASADQTLCMDIDECDRQP---CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFE 1919          

HSP 12 Score: 74.7146 bits (182), Expect = 8.558e-12
Identity = 48/129 (37.21%), Postives = 61/129 (47.29%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D +EC  N H C LH +C N    F C C  G+       +      C D DEC +    C S + C N PGSF C C  G+V      C+D++EC      C    DC+N  GSY C C+ GF G G
Sbjct: 1237 VDVDECDLNPHIC-LHGDCENTKGSFVCHCQLGYM------VRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDG-FECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDG 1357          

HSP 13 Score: 72.0182 bits (175), Expect = 5.271e-11
Identity = 48/125 (38.40%), Postives = 62/125 (49.60%), Query Frame = -1
Query: 9266 SKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9640
            S+ D NEC+ N   C  +  C N D  FRC+C  G+       +   G +C+D DEC++        CTN  G F C C  GF       C DI+ECSLN  +C     C NT GSY+C C  G+
Sbjct: 2081 SREDVNECAENPGVC-TNGVCVNTDGSFRCECPFGYS------LDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFR--CHNTEGSYLCTCPAGY 2196          

HSP 14 Score: 71.633 bits (174), Expect = 7.494e-11
Identity = 55/181 (30.39%), Postives = 85/181 (46.96%), Query Frame = -1
Query: 15599 CSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD--NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGL 16129
            C+  +   ++P V   + G C N    G   C C  G+    D   C D+DEC    ++C  +GDC N  G++ C C+ G++       C+D +ECE    NC ++A+C N  GS+ C C  G+ G+G  C  +       D+      Q+  C     C++   GS+ C C +G  GDG 
Sbjct: 1194 CADVDECEENPRVC--DQGHCTN--MPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICL-HGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDL-------DEC---VSQEHRCSPRGDCLN-VPGSYRCTCRQGFAGDGF 1358          

HSP 15 Score: 69.3218 bits (168), Expect = 3.357e-10
Identity = 49/133 (36.84%), Postives = 69/133 (51.88%), Query Frame = -1
Query: 9239 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA-LLKCPSTSDCTNTPGSFICNCHVGFVKAA-PTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDC 9631
            D +EC +    C  +A+C N+   +RC C +G++        S G +C+  +EC  +    S  DC +T GS++C CH GF  +A  T+C DI+EC         N  C N  GSY C C PGF  + N GDC
Sbjct: 1763 DVDECGSRESPCQQNADCINIPGSYRCKCTRGYK-------LSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPC---GNGTCKNIIGSYNCLCFPGFVVTHN-GDC 1884          

HSP 16 Score: 68.1662 bits (165), Expect = 7.630e-10
Identity = 62/236 (26.27%), Postives = 87/236 (36.86%), Query Frame = -1
Query: 15767 DDPHAVDSCHLRDTSG---CVCNDGFLRS--GTTCTPKEQCG-----CYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNV---QCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNEC----------------------------------------ESKTANCSAYATCYNTFGSYKCICQNGYE 16315
            ++P   D  H  +  G   C+C DGF+ +    TC   ++C      C  GD        +          + +   S V +  V    C  +  C N    G   CRC  G+ G    C D+DEC    + CS  GDC+N  G+Y C C+ GF G+G  C D +EC                                        E    N  A+ +C N  G ++CIC  GYE
Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLN--IPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYE 1435          

HSP 17 Score: 66.6254 bits (161), Expect = 1.934e-9
Identity = 43/128 (33.59%), Postives = 63/128 (49.22%), Query Frame = -1
Query: 9266 SSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9646
            ++   D +EC    H C  H  C N    FRC C  G+         +   +C+D DEC+ +  P T  C NT GSF+C+C  G+ ++     C D++EC+     C     C+NT G++ C C PGF
Sbjct: 2358 TAEGRDVDECRMLAHLC-AHGECINSLGSFRCHCQAGYT------PDATATTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNC--QFLCVNTVGAFTCRCPPGF 2476          

HSP 18 Score: 66.2402 bits (160), Expect = 2.940e-9
Identity = 51/152 (33.55%), Postives = 72/152 (47.37%), Query Frame = -1
Query: 15701 CSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYE--GRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF--VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE--GNGSICSQIPIIAVNP---DQTNCS 16129
            C   +   +DP +     G C N+   G  +C+C  G+E   +   C DIDECS    +C  +G CVN +G + C C  GF    +   C D NEC  +   C  +  C NT GSY+C C  GY    +G  C+ +     NP   DQ +C+
Sbjct: 1069 CMDVDECARDPLLC--RGGTCTNT--DGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCP-HGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCT 1213          

HSP 19 Score: 65.855 bits (159), Expect = 3.876e-9
Identity = 56/174 (32.18%), Postives = 88/174 (50.57%), Query Frame = -1
Query: 9134 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC-----GCWGDPHCLSFDGNWLHYQGRCKYTLVRD 9631
            D +EC  +   C     C N    F C+C  G++       +   ++C+D DECA   L C   + CTNT GS+ C C  G  + A  T C DI+ECSL+  +C  +  C+N  G++ C+C  GF+ + +   C  +  C     GC  D HC++ +G++    G+  Y+L+ D
Sbjct: 1028 DIDECRISPDLCG-QGTCVNTPGSFECECFPGYE-----SGFMLMKNCMDVDECARDPLLCRGGT-CTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGC--DVHCINTEGSYRCSCGQ-GYSLMPD 1190          

HSP 20 Score: 64.3142 bits (155), Expect = 1.007e-8
Identity = 62/249 (24.90%), Postives = 98/249 (39.36%), Query Frame = -1
Query: 8942 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDEC-ALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTV-CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAICGCWGDP---HCLSFDGNWLHYQGRCKYTLVRDECRNGL-------------PIESSTANFEVIMKNWDQNTGTNSMVSWAKEITVKIMNYTIMMKIGFELVVDGQKTSI 9634
             D +ECS     C  H +C N    FRC+C +G+       + S+G  C D +EC    +C     C N  G + C+C  GF + +    C D NEC+L+   C  +A C NT G + C C  GF      G C+ V  C     P    C +  G +L    +  +   +  C +GL              + SS A +E  +                 ++ +  ++   ++ +G  L   G+   I
Sbjct: 2484 FDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFT------LVSSGHGCEDVNECDGPHRC--QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTC-GSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECKINGLSPRDRPRRSAHRDHQVNLATLDSEALLTLGLNLSHLGRAERI 2723          

HSP 21 Score: 62.3882 bits (150), Expect = 4.474e-8
Identity = 47/138 (34.06%), Postives = 61/138 (44.20%), Query Frame = -1
Query: 9221 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9634
            +D +ECS     C     C N    F C C +G+       +  +GR+C D DEC   +      C NT G+F C C  GF +     C D +ECS     C A+  C NT GS+ C C  GF    +   CE V  C
Sbjct: 2404 LDMDECSQVPKPCTFL--CKNTKGSFLCSCPRGYL------LEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHH-QACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNEC 2532          

HSP 22 Score: 62.3882 bits (150), Expect = 4.626e-8
Identity = 54/184 (29.35%), Postives = 83/184 (45.11%), Query Frame = -1
Query: 15548 CHEYGECFNSTASGESECRCKKGYE--GRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGCTYYPCPQNS 16087
            C  +G C N+   G   C C +G+        C D++EC  G + C     C NQLG Y C C  GF  +     C D NEC      C + A+C NT G ++C+C +G++ + ++     +      +  CS+          +C +   G F C C +G F  G QG   +G  + P PQ++
Sbjct: 2496 CGAHGHCHNT--PGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHG--CQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGS-ASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSY----------SCAN-TPGGFLCGCPQGYFRAG-QGHCVSGLGFSPGPQDT 2661          

HSP 23 Score: 62.003 bits (149), Expect = 5.801e-8
Identity = 39/101 (38.61%), Postives = 54/101 (53.47%), Query Frame = -1
Query: 15716 DIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNG--LNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE---GNGSI----CSQIPIIAVNPD 15991
            DIDEC     +C+ NG C+NQ+G++ C C  GF  N   L C D +EC S+ + C   A C N  GSY+C C  GY+   G   +    C +IP +  + D
Sbjct: 1721 DIDECGEIPAICA-NGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCSHGD 1820          

HSP 24 Score: 60.8474 bits (146), Expect = 1.124e-7
Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = -1
Query: 9251 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK---CPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGN 9634
            +DF+EC+T         +C N    F C C  G+      E+ ++G++C+D +EC  L     P T  C N  GSF C C  GF +     C DI+ECS   ++C     C N+ GS+ C C PGF  S N
Sbjct: 1885 VDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGF------ELTADGKNCVDTNECLSLAGTCLPGT--CQNLEGSFRCICPPGF-QVQSDHCIDIDECSEEPNLC-LFGTCTNSPGSFQCLCPPGFVLSDN 2005          

HSP 25 Score: 60.8474 bits (146), Expect = 1.223e-7
Identity = 58/194 (29.90%), Postives = 83/194 (42.78%), Query Frame = -1
Query: 9119 SSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCP--STSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC-----------GCWGDPHCLSFDGNWLHYQGRCK-----YTLVRDECRNG 9646
            +   +D +EC      C  +  C N    FRC+C  G+         S   +C D DEC   + P    +DC N PGS+ C C  G+  +    C   NEC    ++C ++ DC++T GSY+C C  GF+ S +   C  +  C              G  +CL F G  + + G C       TLV   CR G
Sbjct: 1716 TGKPLDIDECGEIPAIC-ANGICINQIGSFRCECPAGFN------YNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFG 1901          

HSP 26 Score: 60.077 bits (144), Expect = 1.906e-7
Identity = 33/91 (36.26%), Postives = 48/91 (52.75%), Query Frame = -1
Query: 15770 CRCKKGY--EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16036
            C C +GY  E     C D+DEC+   + C     CVN +G + C C  GF  +   C D +EC ++   C A+  C+NT GS++C C  G+
Sbjct: 2429 CSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL--CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGF 2517          

HSP 27 Score: 60.077 bits (144), Expect = 2.021e-7
Identity = 45/123 (36.59%), Postives = 62/123 (50.41%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGF-VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +EC+ N   CD +  C N   G+RC+C  G+      +   + R+C D DECA     +   C N PG F C C+ G+ +      C DINEC+    +   N  CINT GSY+C+C   F
Sbjct: 1362 DRDECAENVDLCD-NGQCLNAPGGYRCECEMGF------DPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECA--DPVNCINGVCINTPGSYLCSCPQDF 1475          

HSP 28 Score: 58.9214 bits (141), Expect = 4.051e-7
Identity = 47/140 (33.57%), Postives = 60/140 (42.86%), Query Frame = -1
Query: 9221 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAVAIC 9631
            D NEC   F     H  C N    F C C       GG  + +  R+C D DEC +         C NTPGSF C C  G+      +  C D++EC+ +  +C     C NT GSY C C PG   +     CE +  C
Sbjct:  986 DVNECKV-FPGLCTHGTCRNTVGSFHCACA------GGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGT-CTNTDGSYKCQCPPGHELTAKGTACEDIDEC 1117          

HSP 29 Score: 58.9214 bits (141), Expect = 4.632e-7
Identity = 36/106 (33.96%), Postives = 49/106 (46.23%), Query Frame = -1
Query: 15761 GECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF-VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGN 16075
            G C N   S   EC     Y      C D+DEC      C  N DC+N  G+Y C C  G+ +  G  C   NEC  +  N  ++  C +T GSY C+C  G++ +
Sbjct: 1735 GICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECR-EIPNVCSHGDCMDTEGSYMCLCHRGFQAS 1839          

HSP 30 Score: 58.9214 bits (141), Expect = 4.671e-7
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = -1
Query: 9239 NFHDCDLHANCTNLDSGFRCDCIKGW-QGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPT--VCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDC 9610
            +F +  L+  C    S +RC+C  G+ Q + G         CID DEC    C    DC N PG++ C C+ GF +A PT   C D++EC ++  +C     C+NT GS+ C C  GF  S +  +C
Sbjct:  414 HFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGE--------CIDVDECTSSPC-HHGDCVNIPGTYHCRCYPGF-QATPTRQACVDVDECIVSGGLCHL-GRCVNTEGSFQCVCNAGFELSPDGKNC 529          

HSP 31 Score: 58.9214 bits (141), Expect = 4.994e-7
Identity = 43/118 (36.44%), Postives = 55/118 (46.61%), Query Frame = -1
Query: 15740 YGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE--GNGSICSQI 16078
            +G C N+  S    C      + +  NCTDIDEC     +C   G CVN  G++ C C  G+    +   NC D +EC      C    TC NT GSYKC C  G+E    G+ C  I
Sbjct:  999 HGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCG-QGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRG-GTCTNTDGSYKCQCPPGHELTAKGTACEDI 1114          

HSP 32 Score: 57.3806 bits (137), Expect = 1.309e-6
Identity = 44/124 (35.48%), Postives = 59/124 (47.58%), Query Frame = -1
Query: 9266 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKA-APTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9634
            +D +EC  +   C L   C N +  F+C C  G+      E+  +G++C+D +ECA         C N  GSF C C  GF+ A     C DI+EC     IC  N  C NT GS+ C C  G 
Sbjct:  488 VDVDECIVSGGLCHL-GRCVNTEGSFQCVCNAGF------ELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ-TPGIC-VNGHCTNTEGSFRCQCLGGL 602          

HSP 33 Score: 57.3806 bits (137), Expect = 1.331e-6
Identity = 48/136 (35.29%), Postives = 66/136 (48.53%), Query Frame = -1
Query: 15755 FCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGS 16150
            FC  ++ C+         NV   + G+C N  A G   C C+ G++   D+  C D+DEC++G+      G C N  G + C+C  G+     G NCTD NEC +   NC     C NT GSY C C   +E N S
Sbjct: 1359 FCEDRDECA--------ENVDLCDNGQCLN--APGGYRCECEMGFDPTEDHRACQDVDECAQGNLC--AFGSCENLPGMFRCICNGGYELDRGGGNCTDINEC-ADPVNC-INGVCINTPGSYLCSCPQDFELNPS 1480          

HSP 34 Score: 54.6842 bits (130), Expect = 8.475e-6
Identity = 45/137 (32.85%), Postives = 64/137 (46.72%), Query Frame = -1
Query: 15617 EGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--EGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16015
            EGR     D+DEC   +++C+ +G+C+N LG++ C C+ G+        C D +EC      C+    C NT GS+ C C  GY  E +G  C  +        Q NC F           CV+   G+FTC C  G
Sbjct: 2360 EGR-----DVDECRMLAHLCA-HGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFL--CKNTKGSFLCSCPRGYLLEEDGRTCKDLD--ECTSRQHNCQF----------LCVNTV-GAFTCRCPPG 2475          
BLAST of SMED30010561 vs. Ensembl Celegans
Match: mua-3 (Transmembrane cell adhesion receptor mua-3 [Source:UniProtKB/Swiss-Prot;Acc:P34576])

HSP 1 Score: 227.254 bits (578), Expect = 2.275e-58
Identity = 373/1433 (26.03%), Postives = 554/1433 (38.66%), Query Frame = -1
Query: 1169 VESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVN-ATYRCICPDGFQGDGYN-FCNDIDECANDNTHN---------CSSLEKCVNSNGQYNCVCGDGAVYVDD-ICVDIDECSSNQTNKC--SSNAICQNKEGTYSCQCAEGFYGDGLLCHDI---DECKFGVANCSENALCINKPGTFACECQAGTLGN--------GTTC-GDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKG--------TGWFCIKQT-PCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDN---------CDRETSNCVQL-DPGFKCECKPGF-------NMVGNTCQDK-NECD-PT-----SPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNS-------SCKPI-DSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVD---------VDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSK-------KACTDR-NECQENPMICGDLSKCLNTDGSYECQCVTGY--------KWNGTNCED--IDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR------------------DDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECV-TRKSACHKFAECTNNDGAYVCTCPSYL--TGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVK----IPGTQICLN-KNECLNPVENDCVENAICIDTEGSYECRCKSGFKQL-PS----GKC--ENINECE-EKSDNCSINSVCQDKADGFSCQC-------KPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGF--------SLQGGYC-NDINECLI-PNSCGQNSVCANTVSGFNCSCANG-------ARQLPNGDCELINECLENID-----RCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQ---VCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEIS-----------EQSNMKFCN-NGKCINT-AGGFTCDCPEGFIYNNYD--------CIDVDECSLDQVSS---LADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQ-FPNSCLD---------GLCNNLPGSFECLCNIGYD------LVNGKC--TDINECSNNSQICGPQAAGICINAAGSFQCKCNVGY--ENSGGKSYNPCQSVNECVKLNIT-CPSNAQCVDRSNGYECICKDGYQEDQI-----GICRNINEC--QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLC 4825
            VE+    C C   F+    T     +LC     +SC     C+      +RC CP+G+  D  + FC  + E      H+         CS  E+C N    + C C  G   + +  C     C+ N    C       C  +   Y+CQC        +   DI   +EC  G  +C  +A CI+   ++ C CQ+G + +        G  C   ++EC       G+  C  NA+C + + GY C C+SG+           G  C +    C  P  N C  N  C  + E     C CKP F   ++   P   CE    N         CDR  + C+Q+ D  + C C PGF       +  G  C     ECD PT     SPD A          C +T   ++C C Q  ++ + S        CKP+ + CA+G+D+C R    C  + DS +TC+C   +  ++   V          ++EC    + C   ATC +   SY+C CP +  +DLS        + C  R NEC  N   C   + C++T  SY+C+C   +        +  G  C    +DEC    H CH  A C ++P    C+C   F     +      S P R                  +  K      C ++G    C+C   Y+  +            CS I+EC+ T+ + CH  A+C +    Y C C       GD +           E    +LN   C      +++   ++C C  G++      PG +IC    NECL P  N C  NA CID E  YEC C+ GF  + PS    G+   E +NEC   + ++C  N+ C+D  D + C C        P   +     L    I+EC +       P + C +N  SF C CP GF        +  G  C   ++EC    ++C  ++ C +   G+ C C +G           P   C     C  N D      C+ L G         + Y CVC  G+V+     Q   VC   N C     +  + N+ C D    ++C CK GF   S         CE             +      C+  G C  T A  +TC+C  G+   + D        C+  +   LD   +    A  C +VNG        + C C  G+              C+   N CLD          +C +LP  + C C I            G+     +NEC+N S +    A   C +    ++C+C  GY  ++     +     +NEC   N+  C  NA C+D + GY+C CK  Y+++        ICR +NEC     ++C   ADC D D  Y CTC++G+             PN   PG++C
Sbjct:  859 VENGRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEECQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPIT--DICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLD-----GSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDRNAHCIDTIEG--YSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDR-NARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAV---------CTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDS-FTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQS-HIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRA----SHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSS---------GSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLND--CHQNAACIDLEEGYECKCNQGFMDHSHGRPG-RICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMF--INECESGVH-DCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGG---------MKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNG-----PEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECANPS-LNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-LNECLNPNRNTCDRNADCRDLDYGYTCTCRHGFYDQ---------SPNPQEPGRIC 2226          

HSP 2 Score: 181.03 bits (458), Expect = 1.958e-44
Identity = 346/1424 (24.30%), Postives = 531/1424 (37.29%), Query Frame = -1
Query: 2969 RSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGL------EEC--GKLLCPLNALCVNS----TCLCKSGY---------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYI------GDGINCFKKDTDTDACQIENYC-TDGDCY-----DGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCID-IDEC-NENVDDCQ--ENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGV--------GIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC-QDVNECQT-QSPCHILAQCINTPGSYKCQCPENFYGD-------PQNKC---FEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSE--SCATNGECQNTIGSFKCECKDGF--IGDGKYDCRI------DSKCEKYGGCHEDASCIVNVESSIYECQCHTEF----SGDGITSCIK-NNLCFVNGKSSCHENAICEQVNATYRCICPDGF-------QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVC-------GDGAVYVDDICVD-IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGD--------GLLCHD-IDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE--DECKKPKGSPGAPECDENAVCKN-KDPGYTCECQSGY------KGTGWFCIKQTPCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCE-CKPGFNMVGNTCQD--KNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNEN-NSSCKPIDSCAMGLDNC-DRKVEDCISSK-------DSSYTCQCIEGF--------QRINGSCVD-VDECADK-IDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDR------NECQENPMI--CGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECV-TRKSACHKFAECTNNDGAYVCTC 6808
            R  Q C      + C+C    K         +NEC   ++ CD +A CI+TD S++C C++G+I    N   + G        EC  G   C  NALC ++     C CKSG+               +   N+C N         CD NA+CIDT   + C C  G++        G  C +  T+      +N C  +  C      D  C CP GF  KS                                 S S     CI  I EC N  ++DC   + ++C +    Y C+C   +LD+               + S   G+ C      C +G++         +C+++      GIC  N +       + C+C   Y  V        G K  R I+EC    N+C+    C++TE S+ C+C +                    SH    P+ + +        P   C   +NEC + +  C   A CI+TP SYKC+C ++F  +       P   C     D+C+T    C    +C+    G  C+  S +  ++  +    P  ++CQ         C+++ G                    ++C         N  C+   G   C+C V +QR  +     SC+ I+ECL ++   C T  +C + +  + C+C+DGF  IGD +   R+      + +      CH++A+CI   E   YEC+C+  F     G     C +  N C     +SC  NA C      Y C C DGF          G      ++ECAN   ++C    +C ++   Y C C            +   +C+  I+EC S   + C  +A C++ E +++C+C  GF           G +C   +DEC+ G   CS +A C +    + CEC+ G +        +    C  P+  P   +C   AVC+      Y C C  GY         G  C++   C  P  N C  N  C   +E     CECK  F             +   D+  R          G  CE   P      + CQD  +N+C P      A  C A+G        S+ C C     + + +   KP   C +    C D +  DC ++           YTC+C +G+        +R    C   ++EC D+ ++ C + A C ++   Y C+CP N K          R      NEC  NP +  C   + C + +  Y C+C  GY        D D       P H   RCS +   C                   DS    D   C   + C        C C   Y D    +  G +C      ++EC+   ++ C + A+C + D  Y CTC
Sbjct:  994 RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNP----RLNQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKS--------------------------------PSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISP-------------SISVKPGRLCKPLQNECALGID---------DCARDG-----GICEDNPD------SFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQ--------------------SHIDLSPDTVNR--------PGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQ-CSADFVDVSPHRASHP-GRLCQPRPTPPPPECRLDGG--------------------NQC-----KVHLNEVCRLMGGEPKCSCPVNYQRDSSG----SCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCHQNAACIDLEEG--YECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMFINECESG-VHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLNTCSRNAICY--DEPRGYRCECKRGFM------------DRSPDSSQR----------GRVCEPPPPPSPPPRHPCQDPERNDCHP------AGTCRATGA------QSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECA-NPSLNSCSAFADCFDEENGYRCRCRNGY-------HDDD-------PAHPGHRCSFMINEC-------------------DSSNLND---CDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-----LNECLNPNRNTCDRNADCRDLDYGYTCTC 2208          

HSP 3 Score: 164.466 bits (415), Expect = 2.204e-39
Identity = 336/1318 (25.49%), Postives = 504/1318 (38.24%), Query Frame = -1
Query: 4913 CICAPGY-VLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNI-----------TCSNDAFCDFKDDDYGCHCKNGFMGD--------GIMCKDI-DECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEG--------NGVTCTN-INECY--PLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDR-------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFR-PSPIDS---FVCTDV-NECN--LVHECDK-NYAKCTNTPGSYYCTCDSGYQ--------GDGRNCTDI-DECSSN-KVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL-------HQCGENAECIDTDGGYYCQCKTGFTGHCDE--------CRD--IDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCS-----EIDECLLGLHNCSRSH--QFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFD-NGCDDNADCINTDGSFLCICRAGY--IG----SGRNCDPQEGLEECGKLL---CPLNALCVN----STCLCKSGY------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC-QIENYCTDGDCYDGICHCPSGFVFKSNKCFD--ERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCID-IDECNENVDDCQENSICFNRFGSYDCKCPPNYLDV-----FKDGKVCMAVPLSQCNQ---SCPTGQYCNN----GSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCE-----ERLFG--YICKCKPGYEG-----------VGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG-------------------LCETNNVCNCGSHGIC----GPNYICQCKSGY-------EINPSGMC---QDVNECQTQSPCHILAQC--INTPGSYKCQCPENFY---GDPQN------KCFEDKCKTKAL-QCQAGEVCKLSLYGSVCE-KISCNSSEILINNE----CLPVNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGD-----GELC-VDVDECSNGDVS-CPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECL--LSESCATNGECQNTIGSFKCECKDGF 8233
            C C PG+  + NG C  P +C             +Q         C+C     +   T+I            C   A C   D+ Y C C++GF+          G +C  + +EC + ++ C  NA C +T   + C CK GF           G+ C   +NEC    L+ CD     C D + GY C C+ GF+     GN   R       ++C+   N CDR +         Y C C  GF+  SP  S    +C  V  EC+   +++CD  + A CT+T   Y C C  G+           GR C  + +EC+     C R    C + P S+ CRC         D      + T+P   C                      I+EC T  NDC+  +A C + + SY C C   +   S + +      C+  +       H C  NA+CIDT   Y C+C+  F     +        CR   +DEC    ++C  + A C++    +TC+C+  +        S  G +C         EC L   N  + H  + C  + G  +C C   Y+ D++GSC   NEC F   N C   ADCI+    + C CR G+  IG     GR C P   + EC       C  NA C++      C C  G+            +  TN+C+      S  SCD NA CID    + C C +G+I    +   K     AC ++ N C +    D           K+ +C D  +  E  CP N+     S             S     C+  I+EC   V DC  ++ C +   S+ C+CP  ++D       + G+VC+ + + +C +   +C +   C +     +C C  G     D   NL          P +CP N +C      E L G  Y C C  GY             V   +C D      ++N C+ N  C +    + C CKRG+   S                       C+     +C   G C      +Y C+C SGY          P  +C   + V     Q+ CH  A C  +N P  Y C+C + +     DP        K   ++C  ++L  C +  VCK    G  C+  I+                L VN+ C N    +C   A C  E     C C +GY+ D     G  C   ++EC + +++ C  N+ C +  G + CAC   ++             ++ECL     +C  N +C++    + C C+ GF
Sbjct:  963 CECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDR-NAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFD------RVTRPGRKCK-------------------RLINECQTGQNDCS-EEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVN-AICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPM--VNECQYPHLNDCHQNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRP----SLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGR---ACRELVNECANSRLND---------CDKNARCKDTMDSYECDCPVNSKDISPSP------------SFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKL-VDECREGRHTCSSHADCRDLEEGYTCECRDGY---VDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHD-----PRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNE-CANPSLNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICRLNECLNPNRNTCDRNADCRDLDYGYTCTCRHGF 2212          

HSP 4 Score: 161.384 bits (407), Expect = 2.099e-38
Identity = 263/1064 (24.72%), Postives = 400/1064 (37.59%), Query Frame = -1
Query: 1130 ETSNCVQLDPGFKCECKPGFNMVGN-TCQDKNECDPTSPD----FAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--------QRINGSCVDV-DECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDR--------NECQENPMI--CGDLSKCLNTDGSYECQCVTGY------KWNGTNCEDI---DECAIKTHPCHDLARCSNV-PGSCKCKCQPGFTGDGIYSCIETDSC---------PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSD----IDECVTRKSACHKFAECTNNDGAYVCTCP-SYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKI-------PGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGF-------KQLPSGKCEN--INECEEKSDNCSINSVCQDKADGFSCQCKPGF------KWSDETNL----NCEDIDECT--NPTSCSSMPHSICMNNPGSFECVCPHGFSL-QGGYCNDINECLIP--NSCGQNSVCANTVSGFNCSCANGA-----RQLPNGDCE-LINEC-LENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDE--VFPQVCEN-QNEC-EINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECE--ISEQSNMKFCN---NGKCINTAGGFTCDCP-------EGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFV------MIENSTKCVD-IDEC-QFPNSCLDGL-CNNLPGSFECLCNIGY-DLVNGKCTDINECSNNSQICGP----QAAGICINAAG-SFQCKCNVGY--ENSGGKSYNPCQSVNEC--VKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLAD--CLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCV 3946
            E   C      + CEC PGF  + N  C     C+P  P        Q+CL  G         + C C + +     +     + C  G  +CDR    CI + D SY C C  GF        +R    CV + +EC D  + C  NA C +    YVC+C     +D S    T          NEC  NP +  C   + C++T   Y C C  G+         G  CE I   D+C+   + C   ARC  +      C C PGF      S      C         P  +D   P  + C    +   C C  G+ D +    +  G +C    ++    ID+C      C       +N  ++ C C  +YL            +C    + C    + C       +    + C C   ++ +       PG +  +  NEC +   +DC  NA CIDT  SY+CRC+  F        + P   C    ++EC     +C +N++CQD   G++CQC   F      + S    L          EC       C    + +C    G  +C CP  +     G C+ INECL    N C   + C + V G+ C C +G      R+ P   C+ ++NEC   +++ C      ++ C DL  GY C C  GF++       ++C+   NEC   +++SC   N+ C+D    ++C C+ GF   S    +    C   ++E +N +  +   N +C +T   + CDCP           +    C+      +++  S   +CD  +  C +    F C C  GFV             CV  +DEC +  ++C     C +L   + C C  GY D      +      +  ++C P     +A +C    G  +QC C  GY  ++ G +    C   N C   +LN TC  NA C D   GY C CK G+ +      +    C+            C D +                         N C P   C+      Y C C+
Sbjct:  950 ENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGN-------IYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSAR-CIDT-DESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGF-VDYSPNPQTFPGMVCKELVNECT-NPRLNQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICE------DNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTS-NRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCH----QNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCD-RNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMF----INECESGVHDCDP-SATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLN-TCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPER------------------------NDCHPAGTCRATGAQSYTCECL 1960          

HSP 5 Score: 149.058 bits (375), Expect = 1.090e-34
Identity = 339/1404 (24.15%), Postives = 521/1404 (37.11%), Query Frame = -1
Query: 3887 GSYECRCLDG------TPGCDGD--NPCNTVQCTKPNEICYLG-----QCFCKHGFQNNVTTNICEDIDECDTAANDCA---------GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQC--GENAECIDTDGGYYCQCKTGFTGHCDECRDI---DECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSEI-DECLLGLHNCSRSHQFCFNVNGGFECRCLSGY------KSDTNGSCVDE--NEC---RFFDNGCDDNADCINTDGSFLCICRAGYI------GSGRNCDPQEGLEEC--GKLLCPLNALCV-----NSTCLCKSGYENST-------NQCINT-DECESQT--SCDV--NANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQ-IENYCTDG--DCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCID-IDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKD-----GKVCMAVPLSQC---NQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGI----------CPLNANCEERLFGYICKCKPGYEGVGIKSCRD------------IDEC---GGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVC------NCGSHGIC---GPNYICQCKSGYE-----INPSGMCQD-VNECQTQ--SPCHILAQCINTPGSYKCQCPENF----YGDPQNKC--FEDKCKTKAL-QCQAGEVCKLSLYGSVCE----KISCNSSEILINNECLPVNQVCQNI---NCGNHAFCK--IENGRADCFCDSGYYG-----DGELCVD-VDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRL---ENALVTDSCTD-IDECLL-SESCATNGECQNTIGSFKCECKDGFIGDGK-------------------YDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCND--------------IDECANDNTHNCSSLEKCVNSNGQ-YNCVCGDGAVYVD----------DICVDIDE-CSSNQTNKCSSNAICQNKEG--TYSCQCAEGFYGD--------GLLCHD-IDEC-KFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPK-------------GSPGAPECDENAVCKNKDPGYTCECQSGYKGTG--------WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKT-----ECENKTDN-CDRETSNCVQLDPGFKCECKPGF 7387
            G   C C +G      T  C GD  NP     C  P E C +      +C C  G+  +  +  C  + E   +    A             +C N    + CECL G+      +     +   ++   C   +  +C+     Y CQC      H     DI   +EC    ++CD   A C ++  S+ C C  G+           G VC  + +ECL G + CS  +  C +   G+ CRC SG+           G    E  NEC   R   N CD NA CI+T   + CIC+ G++        GR C+  +  ++C  GK  C  NA C+     + +C C  G+++ +         CI    EC++ T   CD    A C DT   ++C C +G++    +   K      C+ ++N C  G  DC                     R   +C  N        +          ++    +C   I+EC    +DC E + C +   SY C CP +++D+  D     G+ C+ + +++C      C     C +   S          D+   +  +    C P +          C +NA C++   GY C+C   +  V                     EC   GG      +NE C    G   CSC   Y R+ SSG C   N C      +C +   C      Y CQC+ G++       P  MC+  VNECQ    + CH  A CI+    Y+C+C + F    +G P   C    ++C   +L  C     C     G  CE     I  + S  L    C  +   C N    +C  +A CK  +++   DC  +S          G +C+  ++EC +G   C  ++ C++ + SF C C  GF      ++A     C   +DEC     +C+++ +C++    + CEC+DG++                       +DC   + CE  GG      CI       Y  Q      G     C++NN C     ++C  NAIC      YRC C  GF     +                     C +   ++C     C  +  Q Y C C  G  Y D           +CV  +  C   + N C + AIC    G   Y+C+C +G+  +        G +C   I+EC    + +C   A+C + P  + C+C             +D+   P+              +P    C   A C +++ GY C C++GY             F I +      N C  N  C   +      C CK  ++ E     P       EC N   N CDR  ++C  LD G+ C C+ GF
Sbjct:  862 GRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEE-CQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRH--PITDICLKNECLTGEHDCDRS-ARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCS-PNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRL--NQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRL--CKPLQNECALGIDDC--------------------ARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCL-MRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRD-SSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCHQNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQG-----YVDQSPGSQKG---RVCVRNNACHDPRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSG--YADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINA---------KDQSPDPRKPGRICSLSVNECANPSLNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCI--DTAGGYDCACKAPYRDEGPPQSPGRICRLNECLNPNRNTCDR-NADCRDLDYGYTCTCRHGF 2212          

HSP 6 Score: 131.339 bits (329), Expect = 2.494e-29
Identity = 162/606 (26.73%), Postives = 242/606 (39.93%), Query Frame = -1
Query: 2024 NECQENPMI-CGDLSKCLNTD-GSYECQCVTGY-------KWNGTNC-EDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGI-------YSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQM--ECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCP-SY-------LTGDGK----TTCEDQNECAL-ETHTCN-LNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEN---------------------------------------------------DCVENAICIDTEGSYECRCKSGFK-------QLPSGKC-ENINECEEKSDN-CSINSVCQDKADGFSCQCKPGF----------------KWSDETNLNCED----IDECTNPTSCSSMPHSICMNNPGSFECVCPH-GFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQL-------PNGDC-ELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFV------NDEVFPQVCENQNEC-EINIHSCQASNSECVDTYGSFKCVCKPGF 3454
            N CQ+  +  C  +++C +   G ++CQC  G+       ++ G  C   +DECA+  H C   A C +      CKC+ G++   +        SC + D C    ++ C   + C        C C +GY D ++      G VC    + ++EC   +  C   A C +    + C C  SY       L   GK    T   D  EC + +  +C+      C  ++NT      ++C C NGY ++P  + C+  NEC  P  N                                                   DC ENAIC DTE SY CRC+ GF        +LP  +C E +NEC   S N CS N+ C+D  +G+ C C+PG+                K  ++   + +D     D+  +P +     +  C+   G   C C    F    G C   + C   N+C +N++C N    + C C  G   L       P   C ELINEC  + + C       + C D   GYAC C DGF+      N     Q   + NEC E ++++C   N++CVDT   + C C  GF
Sbjct:   32 NPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMC---SNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCR---AVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENT------YKCRCANGYSRLPDGR-CVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACSKRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPY----ARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCD-ENADCVDTPDGYTCQCYGGF 619          

HSP 7 Score: 121.709 bits (304), Expect = 1.688e-26
Identity = 176/676 (26.04%), Postives = 269/676 (39.79%), Query Frame = -1
Query: 1238 CHKFAEC-TNNDGAYVCTCPSYLTGD-------GKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGY-------VKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQL------PSGKC--ENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLI--PNSC--GQNSVCANTVSGFNCSCANGARQLPNGDCELINECLE-NIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQ---------ASNSECVDTYGSFKCVCKPG-------FSKNSDGDCVD-YDEC---EISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDC-----------IDVDECSLDQVS-SLADNCDQ------VNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPC-----QSVNECVKLNITCPSNAQCVDRSNGYECICKDG-------YQEDQIGICRNI-NECQIE--DSCHYLADCLDTDGSYKCTCKYGY 3022
            C   AEC +   G + C CP   T         G+      +ECAL  HTC+ +        + ++    + C C +G+       ++ PG + C   + C N    DC   A C +T     C+C SG+  +      P+G+     +NEC E   +CS ++ C D ADGF+C+CK  ++  DE+                     S  + +PG   CV     ++Q     D  EC +  P SC   +  VC    + + C CANG  +LP+G C +INEC E  ++ C    G ++ C DL  GY C C  G+ +      V +    C   ++ C          + N+ C DT  S+ C C+PG       F+K     C++  +EC    +++ S   FC + K      G+ C C  G++ N+ +            ++  +  L   S S  D CD        N  C+   G   C C      +E + +  D            G C                 V   C+  N C  N+         IC+N   S+ C+C  GY +      N       + +NEC   +  C   A+C+D +NGY C C DG       Y +     C N  NEC  +  ++C   ADC+DT   Y C C  G+
Sbjct:   42 CDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHA-------DCIDTHQGYTCKCRSGWSDTSLDPLRSPG-RSCKKADMCSN---IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYR--DES---------------------SDTLKHPGK-NCV----RTVQP----DPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTC----GKNAECIDLAEGYTCQCRSGYAD---ISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAK-----EGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCEC------VETAFRYTD------------GSCR----------------VYSACSKRNTCDKNA---------ICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGF 619          

HSP 8 Score: 110.153 bits (274), Expect = 5.898e-23
Identity = 163/613 (26.59%), Postives = 245/613 (39.97%), Query Frame = -1
Query: 6383 YPLSPCDNATEECFDKVPGY-ECRCQKGFMKNTTTGNCDDR------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFV-----CTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--------QGDGRNCTDI-DECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAAN---DCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCD---------SDRATCENSIGSFTCRCNEGYSG--------DGSVCSE-IDECL-LGLHNCSRSHQFCFNVNGGFECRCLSGY----------------------KSD--------------------TNGSCVD----------ENECRFFDNGC------------DDNADCINTDGSFLCICRAGYI--------GSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTN--------QCINT-DEC--ESQTSCDVNANCIDTHGSFICYCNEGYI 7825
            Y L  CD    ECF + PGY +C+C KGF  ++       R      +ECA   + CD    +C +T   Y C C+ G+  + +D        C   + C+ + +C    A+C  TP    C C SGY        +  GR C  + +EC+  +      ATC++    + CRC D       D   +T+                KH  +N V T +  D  ECD +     D A R+  C  ++ +Y+C C  GY      +           L+ CG+NAECID   GY CQC++G+       +    C   +N C          S+ A C ++  S++CRC  G++          G  C E ++EC    L++CS+ + FC +   G+ C C  GY                      K+D                     N +CV           E   R+ D  C            D NA C+N   S+ C CR GYI          GR C  +E + EC      C   A C+++T    C C  G+ + ++        QC N+ +EC  +S  +CD NA+C+DT   + C C  G++
Sbjct:   37 YSLHDCD-PVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCD-PHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNI-DCAAE-AECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSY----RDESSDTL----------------KHPGKNCVRT-VQPDPPECDVSDPMSCDPAKREV-CIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSK-NAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACSKRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRIC--KELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFV 620          

HSP 9 Score: 101.293 bits (251), Expect = 2.433e-20
Identity = 159/556 (28.60%), Postives = 227/556 (40.83%), Query Frame = -1
Query: 6506 CSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSP--CD-NATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF-----RPSPIDSFVCTDV-NEC-NLVHECDKNYAKCTNTPGSYYCTCDSGYQG--------DGRNCTD-IDECSSNKV--CQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANL-DGSYECECLYGYRMSSXXXXXXXXXXXXX-------NLHQC--GENAECIDTDGGYYCQCKTGFTGHCDE--------CRDI-DECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSE-IDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE---------NECRFFDNGCDDNADCINTDGSFLCICRAGYIGS--------GRNCDPQEGLEEC--GKLLCPLNALCVN----STCLCKSGY 7951
            C N    C  N  C N    + C C  GFE   NG  C     C P  P  CD    ++C  +   Y C+C +   ++  T  C  +NEC    + CDR S  C +T  SY C C+ GF      PS     VC  + NEC +  + C  N A CT+T   Y C C SG+           G  C + ++EC++ ++  C R +A C++    Y C C  G    D        +   P   C              + TN     D+C    NDC  R A+C  + D  Y C C  G++  S +                   L+ C   + A C DTD GY C+C+ GF              C+ + +ECA  +++C  D   CE++  SFTCRC   Y        +  G  C   I+EC  G ++CS     C +    + C C   +  D +   V+          NEC    + C  NADCI+T  S+ C CR  ++          GR C P   ++EC  GK  C +NA+C +     TC C + +
Sbjct:  941 CHNGGVRCSENERCTNDGSDWFCECLPGFERIRNG-QCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPITDIC-LKNECLTGEHDCDR-SARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPN-ALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDR-NAHCIDTIEGYSCICKPGFVDMD--------EFGNPGRRC------------EQIKTN-----DKCSPGKNDC-DRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCS-EEATCTDTEDSYICACPQSH-IDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPAL-VDECRTGKHDCHVNAICQDLPQGYTCQCSADF 1462          

HSP 10 Score: 99.3673 bits (246), Expect = 9.774e-20
Identity = 155/592 (26.18%), Postives = 240/592 (40.54%), Query Frame = -1
Query: 5768 QCFCKHGFQNNVTTNI------CEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH----QCGENAECIDTDGGYYCQCKTGFTGHCDE--------CRDI-DECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQ--------------------FCFNVNGGFECRCLSGYKSDTNGSCVDENEC-RFFDNGCDDNADCINTDGSFLCICRAGYIG------SGRNCDPQEGLEECGK-----LLCPLNALCVNS----TCLCKSGYENST--------NQCIN-TDECESQT--SCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPK---NAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKD-----GKVCMAVPLSQC----NQSCPTGQ---YCNNGSCSCLMG---LNSQTDDDGNLNCSKNSASCLP---GICPLNANCEERLFGYICKCKPGYEGV 7282
            QC C  GF ++              +DEC    + C    A C +    Y C+C  G+  +S++ +      C          C   AEC +T  G  CQC +G+     +        CR + +ECA   ++C S  ATC ++   FTCRC + Y  + S     D       NC R+ Q                     C  V   ++CRC +GY    +G CV  NEC     N C  NA+CI+    + C CR+GY         GR C  +  + EC       + C  NA+C ++    +C C+ G+ + +         +CI   +EC S +   C  NA C D    +IC C  GY+ +  N  +         +E   TD              +  ++   D+ C+   PK   N  C    G   C C       +D S C     C++  + C +N+IC NRF SY C+C P Y+D+  D     G++C  + +++C    N+  P  +     N  +C CL G   ++S+ +      C+ ++  C       C  NA+C +   GY C+C  G+  V
Sbjct:   57 QCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPH-ADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSS-HATCIDTADGFTCRCKDSYRDESS-----DTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRIC--RARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTD--------------LKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGS-CRVYSACSKR-NTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKEL-INECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFVDV 622          

HSP 11 Score: 95.5153 bits (236), Expect = 1.391e-18
Identity = 159/597 (26.63%), Postives = 238/597 (39.87%), Query Frame = -1
Query: 6554 YGCHCKNGFMGD-------GIMC-KDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF--------EGNGVTCTNINECYPLSPCDNATE-ECFDKVPGYECRCQKGFMK-NTTTGNCDDR------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSF----------VCTDVNECNLVHECDKNYAK---CTNTPGSYYCTCDSGYQG--DGRNCTDIDECSSNKV--CQRPDATCVNLPGSYECRCLDG----TPGCDGDNPCNT------------VQCTKPNEIC----YLGQCFCKHGFQ------NNVTTNIC-EDIDECDTAA-NDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH----------------------QCGENAECIDTDGGYYCQC-KTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSE-IDECLLGLHNCSRSHQFCFNVNGGFECRCLSG-------YKSDTNGSCVDE-NECRFFD-NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCP 8014
            + C C  GF          G  C + +DEC+     CD +A C +T   ++C C+ G+           G +C   + C   S  D A E EC +   G  C+C  G++  +   G    R      NECA+  + C   +T C +T   + C CK  +R    D+           V  D  EC++      + AK   C     +Y C C +GY    DGR C  I+EC+  ++  C + +A C++L   Y C+C  G    +P       C              V C++ N IC    +   C C+ GF       N +    C E ++EC + + NDC+ + A C +    Y C C  GY  +S N        C   +                       +CG N  C+   G + C+C +T F      CR    C+   N CD + A C N   S+TC+C  GY        +  G +C E I+EC    + CS  +  C +   G+ C+CL G       Y       C +  NEC     N CD+NADC++T   + C C  G++    N +   G     +  CP
Sbjct:   56 FQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMC---SNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHAT-CIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGR-CVVINECAEPRLNTCGK-NAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSE-NAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCS-KNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACS-KRNTCDKN-AICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECS-PYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFVDVSSNANLPPGRVCTVQTTCP 641          

HSP 12 Score: 95.5153 bits (236), Expect = 1.630e-18
Identity = 142/582 (24.40%), Postives = 225/582 (38.66%), Query Frame = -1
Query: 3236 YRCICPDGF-------QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGA--VYVDDI------CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--------DGLLCHDI-DECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKG------SPGAPECD----------ENAVCKNKDPGYTCECQSGY-KGTGWFCIKQTPCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCD---------RETSNCVQLDPGFKCECKPGF--------NMVGNTCQDK-NECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSC--------KPIDSCAMGL--------DNCDRKVEDCIS-----SKDSSYTCQCIE-GFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPD---NLKLDLSK---KACTDR-NECQENPMICGDLSKCLNTDGSYECQCVTGY--------KWNGTNCEDI-DECAIKT-HPCHDLARCSNVPGSCKCKCQPGFT 4681
            ++C CP GF       +  G      +DECA    H C     C++++  Y C C  G     +D +      C   D CS+     C++ A C+       CQC  G+           G +C  + +EC  G  +CS +A CI+    F C C+       +     D  K P         P  PECD          +  VC   +  Y C C +GY +     C+    C  P  N C  N  C    E     C+C+  +   +    P   C  + + C           E + C   +  + C C+PGF         + G  C +  NEC   S +  ++        C + K  ++CTC    ++ + ++         KP++     L        D CD K   C +      +   + C+C+E  F+  +GSC     C+ K ++C  NA C N   SY C+C     +L  DL+    + C +  NEC  +   C   ++C++    Y CQC+ G+        K  G  C +  +EC+ K+ + C + A C + P    C+C  GF 
Sbjct:   56 FQCQCPKGFTDSSADKRFPGRKCVRAVDECAL-GRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNID---CAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESS-----DTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEG--YTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAF-----CEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACS-KRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFV 620          

HSP 13 Score: 90.1225 bits (222), Expect = 7.430e-17
Identity = 143/599 (23.87%), Postives = 219/599 (36.56%), Query Frame = -1
Query: 3887 VNECQTQS--PCHILAQCIN-TPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGF---QRLENALVTDSCTDI-DECLLSES-CATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDIC-------VDIDECSSNQTNK--CSSNAICQNKEGTYSCQCAEGFYG--------DGLLCHD-IDECKFGVAN-CSENALCINKPGTFACECQAGTLGNGTTCGDEDE--CKKPKGS-----------------PGAPECDENAVCKNKDPGYTCEC-QSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDF-KLEND-TCIPKTECENKTDNC---DRETS---NCVQLDPGFKCECKPGF 5515
             N CQ  S   C  +A+C +  PG ++CQCP+ F     +K F   KC     +C  G             + +C+      + +C+  +Q            CK  +G +D   D      G  C   D CSN  + C   + C+       C C  G+    R         C  + +EC      C+++  C +T   F C CKD +  +     +           H   +C+  V+    EC      S D                    +  +C  V  TY+C C +G+       C  I+ECA    + C    +C++    Y C C  G   +  +          ++ECS+ +     CS NAIC + E +YSC+C  GF           G  C + ++EC     N CS+NA C +    + C C+ G + N           C KP                    P  P+C  N  C  +   + CEC ++ ++ T   C   + C   N C  N  C   N      C+C+P +  L  D T  P   C+   + C   D E S    C+    G+ C+C  GF
Sbjct:   31 ANPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALG-------------RHTCDP-----HADCIDTHQ---------GYTCKCRSGWSDTSLDP-LRSPGRSCKKADMCSN--IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLK-----------HPGKNCVRTVQPDPPECDVSDPMSCDPA------------------KREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACSKRNTCDKNAICL--NRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGF 568          

HSP 14 Score: 89.3521 bits (220), Expect = 1.047e-16
Identity = 167/629 (26.55%), Postives = 248/629 (39.43%), Query Frame = -1
Query: 4226 ANCEERLFGYI-CKCKPGY-------EGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGL------CETNNVC---NCGSHGIC-----GPNYICQCKSGY------EINPSG-MCQD-VNEC-QTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCK--TKALQCQAGEVCKLS-------------LYGSVCEKISC-NSSEILINNECLPVNQVCQ-NIN-CGNHAFCKIENGRADCFCDSGYYG------DGELC-VDVDECSNGD---VSCPNNSFCQNKDGSFHCACNVGFQRLE---NALVTDSCTD-IDECLLSE--SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVD----------DICVD-IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--------GDGLLCHDI-DECKFGVAN-CSENALCINKPGTFACECQAG--------TLGNGTTCGDEDECKKPK 5830
            A C     GY  C+C  G+          G K  R +DEC    + C  + DC +T   +TC C+ G+S  S   L      C+  ++C   +C +   C     GP  +CQC SGY         P+G +C+  VNEC + +  C   A CI+T   + C+C ++ Y D  +   +   K   + +Q    E C +S             ++     K  C N    L +  C+ +N+  +  +N CG +A C        C C SGY         G +C   V+ECSN +   V C  N+ C + + S+ C C  GF  +    N L    C + ++EC       C+ N  C++    + C C+ G++ +     R           H    C   VE    + +  T FS D    C   N         C  N  C Q +  + C C +         C     C+  NT  C     C+N    Y C C  G  Y+D           IC + I+EC+S+  N+CS  A C +    Y+CQC +GF           G  C +  +EC     N C ENA C++ P  + C+C  G         L  G  C  +  C K K
Sbjct:   46 AECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGP--MCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRC-KDSYRDESSDTLKHPGKNCVRTVQPDPPE-CDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAAR-----------HPGRICTKPVEKIKTDLK-DTSFSTD--DGCDPKN-------PKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACSKRNT--CDKNAICLNRFDSYTCQCRPG--YIDLSADLTNAPGRICKELINECASSD-NECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFVDVSSNANLPPGRVCTVQTTCPKQK 644          

HSP 15 Score: 85.1149 bits (209), Expect = 1.948e-15
Identity = 147/569 (25.83%), Postives = 212/569 (37.26%), Query Frame = -1
Query: 5423 LHNCSRSHQFCFNVNGG-FECRCLSGY------KSDTNGSCVDE-NECRFFDNGCDDNADCINTDGSFLCICRAGYIGS--------GRNCDPQEGLEECGKLLCPLNALC----VNSTCLCKSGYENSTNQCIN---------TDEC-ESQTSCDVNANCIDTHGSFICYCNEGYIGD--------GINCFKK-DTDTDACQIENYCT----------------DGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQC-----IDIDECNENVD---DCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDI-----------------------DECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN----CGSHGIC---GPNYICQCKSGY-------EINPSGMCQD-VNECQTQ-SPCHILAQCINTPGSYKCQCPENF 6823
            LH+C    + CF+   G F+C+C  G+      K      CV   +EC    + CD +ADCI+T   + C CR+G+  +        GR+C   +  + C  + C   A C    +   C C SGY + + Q             +EC E +  C  +A CIDT   F C C + Y  +        G NC +    D   C + +  +                   C +G    P G     N+C + R  N C KNA C   +    C C  G +  S  SQ        ++EC+       DC EN+IC +   SY C+C P + DV                    +  +       C+  +N       N +CSK            NA CE+   GYIC C+PGY      + R                         D C  K   C  NE C    G   C C     R  + G C   + C+    C  + IC     +Y CQC+ GY          P  +C++ +NEC +  + C   A+CI+    Y CQC + F
Sbjct:   39 LHDCDPVAE-CFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSC---KKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRL-NTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADV--------------------SAAFNKLPGRRCIEAVNECASPSLN-DCSK------------NAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFR-YTDGSCRVYSACSKRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGF 568          

HSP 16 Score: 78.5666 bits (192), Expect = 2.068e-13
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = -1
Query: 9263 FNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFV-------KAAPTVCND-INECSLNSSICDANADCINTYGSYICNCKPGFR 9628
             +EC+   H CD HA+C +   G+ C C  GW     + + S GRSC   D C+ + C + ++C  TP   +C C  G+V       + A  VC   +NEC+     C ++A CI+T   + C CK  +R
Sbjct:   82 VDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYR 211          

HSP 17 Score: 71.2478 bits (173), Expect = 3.253e-11
Identity = 57/150 (38.00%), Postives = 73/150 (48.67%), Query Frame = -1
Query: 9230 NECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCID-DDEC--ALLKCPSTSDCTNTPGSFICNCHVGFVKAAP-------TVCND-INECS---LNSSICDANADCINTYGSYICNCKPGFRGS---GNPG-DCEAV 9625
            NEC T  HDCD  A C + D  + C C  G+     N     GR C+   +EC     +C   + CT+T   ++C C  GFV  +P        VC + +NEC+   LN   CD NA CI+T   Y C CKPGF      GNPG  CE +
Sbjct: 1026 NECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQ--CDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQI 1173          

HSP 18 Score: 59.6918 bits (143), Expect = 9.355e-8
Identity = 125/523 (23.90%), Postives = 182/523 (34.80%), Query Frame = -1
Query: 1238 EDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ-------GGYCND--INECLIPN------------------------------------------------SCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDR-CQVLNGADSVCYDLPIG--YACVCPDGFVNDEVFP--QVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQS-----NMKFCNNGKCINTAGGFTCDCPEGFI--------YNNYDCID-VDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTD-INECSNNSQICGPQAAGICINAA-GSFQCKCNVGYENSGGKSYNPCQ----SVNECVKLNIT---CPSNAQCVDRSNGYECICKDGYQEDQIGI-------CRNI-NECQ--IEDSCHYLADCLDTDGSYKCTCKYGY 2521
            ED+      T C    +  C    G   CVCP GF+         G  CN   I  C+ P                                                  C +N  C N  S + C C  G  ++ NG C     C  N    C V          LP G  Y C C     N++  P   +C  +NEC    H C  S + C+DT  S+ C C+ GF  +S           ++ Q+     + +   N  C +T  G+ C C  GF+        +    C + V+EC+  ++    + CD+ N HCI+T+ G+ C C  GF         VD+DE   P       C  +               N KC+   N+C  N++         CI      + C C  G+++    S  P +     + EC    +     P  A C D  +GY C C+ G+ +    I       C+ + NEC   I+D       C D   S+ C C   Y
Sbjct:  838 EDVCNPRTQTGCDRSLNEHCAVENGRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEECQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQC----LPRGNIYTCQC---GRNEKRHPITDICL-KNECLTGEHDCDRS-ARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRL----NQCDR-NAHCIDTIEGYSCICKPGF---------VDMDEFGNPGR----RCEQI-------------KTNDKCSPGKNDCDRNAR---------CIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNY 1311          

HSP 19 Score: 59.3066 bits (142), Expect = 1.352e-7
Identity = 89/308 (28.90%), Postives = 134/308 (43.51%), Query Frame = -1
Query: 7217 DDYGCHCKNGFMGD--------GIMCKD-IDECSNNT-SVCDSNAFCKNTIGSFSCSCKEGFEGN-------GVTCT-NINECY--PLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDD----RNECADTGNL--CDRVSTNCNNTFGSYRCDCKYGFR---PSPIDSFVCTDVNECNLVHE--CDKNYAKCTNTPGSYYCTCDSGY-------QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPN-EICYLGQ-CFCKHGFQNNVTTNICEDIDE 8020
            + Y C C++G+  +        G +CK  I+EC + + + C S A CK+    ++C C    +         G  C+ ++NEC    L+ C +A  +CFD+  GY CRC+ G+  +             NEC D+ NL  CDR + NC +T G Y C CK  +R   P      +C  +NEC   +   CD+N A C +    Y CTC  G+       Q  GR C +  +    +  +R   T V      E              PC    C K   E+C  G+ C CK G   + +T  C+++ E
Sbjct: 2006 EKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECANPSLNSC-SAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINEC-DSSNLNDCDR-NANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-LNECLNPNRNTCDRN-ADCRDLDYGYTCTCRHGFYDQSPNPQEPGRICIEFQQ---EEHIERVKVTTVQSEPRREF-------------PCGRDDCIKARGEVCISGEYCGCKPGEGRSASTGKCQEVQE 2292          

HSP 20 Score: 56.6102 bits (135), Expect = 7.783e-7
Identity = 42/134 (31.34%), Postives = 58/134 (43.28%), Query Frame = -1
Query: 15587 VCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTD---------FNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGAN 15961
             C  N  C+N+  +Y C C+ G++    + T+          NEC S    CS YA C +    Y C C +G+    S  ++ P          CS     +CD+ A CVD  DG +TC C  G F D    AN
Sbjct:  496 TCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDG-YTCQCY-GGFVDVSSNAN 627          

HSP 21 Score: 55.8398 bits (133), Expect = 1.387e-6
Identity = 38/130 (29.23%), Postives = 55/130 (42.31%), Query Frame = -1
Query: 9311 PVNSLVIGSLMCSSSKI---DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCID-DDEC--ALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADC 9682
            PVNS  I        ++     NEC +  HDCD  A C + +  F C+C  G+     N+    GR C+   DEC      C S +DC +    + C C  G+V  +P + +          +C  N DC
Sbjct: 1706 PVNSKDISPSPSFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDC 1835          

HSP 22 Score: 55.0694 bits (131), Expect = 2.514e-6
Identity = 63/226 (27.88%), Postives = 93/226 (41.15%), Query Frame = -1
Query: 2153 LNP-VENDCVENAICID-TEGSYECRCKSGFK----QLPSGKC---ENINECEEKSDN-CSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANG---------ARQLPNGDCELINECLENIDRCQV-LNGADSV--CYDLPIGYACVCPDGFVN 2764
             NP  +NDC  +  CI+ ++ +Y+C C  G++    Q P  KC      NECE K DN CS N+ C D    + C+C P +                 + +   S+P S+C+ +                 YC+D+N       C  N+ C N      C C  G            L  GD  L    + ++D C + LN    V  C D  +GY C CPDG+++
Sbjct: 2593 FNPCFKNDCDPHGKCIEISKYAYKCECGVGYRDINPQSPGKKCLPVHGFNECERKEDNECSENARCIDLEHLYKCECLPSY----------------YDTSPVGSVPGSLCVLD-----------------YCSDVN------FCPTNTTCKNMEQQAECKCDAGFMDIRKSEKRTALMLGDDTLCMH-VRDVDECALGLNNCSGVAHCIDRAVGYTCKCPDGYID 2778          

HSP 23 Score: 55.0694 bits (131), Expect = 2.710e-6
Identity = 38/132 (28.79%), Postives = 61/132 (46.21%), Query Frame = -1
Query: 9266 FNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCI-----DDDECAL---LKC-PSTSD-CTNTPGSFICNCHVGFVKAAPTVCNDINECS-LNSSICDANADCINTYGSYICNCKPGF 9628
             NEC+   HDC  HA C +   GF C C   ++    + +   G++C+     D  EC +   + C P+  + C     ++ C C  G+ +     C  INEC+    + C  NA+CI+    Y C C+ G+
Sbjct:  179 VNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGY 310          

HSP 24 Score: 53.9138 bits (128), Expect = 5.856e-6
Identity = 51/180 (28.33%), Postives = 77/180 (42.78%), Query Frame = -1
Query: 15620 CHEYGECFNSTASGESECRCKKGY-EGRADN-------CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN--------CTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--------EGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTE 16087
            C    ECF S   G  +C+C KG+ +  AD           +DEC+ G + C  + DC++    Y C C++G+    L+        C   + C +   +C+A A C  T     C C +GY           G +C  + +      + +CS H        ATC+D ADG FTC C +
Sbjct:   42 CDPVAECF-SEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSN--IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAV-VNECAEGRHDCSSH--------ATCIDTADG-FTCRCKD 208          

HSP 25 Score: 53.5286 bits (127), Expect = 6.752e-6
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = -1
Query: 9266 NECSTNFHDCDLHAN-CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSC---IDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCND--------INECSLNSSICDANADCINTYGSYICNCKPGF 9625
            NEC+    DC      C +    F C C   +  +  + +   GR C   I++ +     C   + CT+T  S+IC C    +  +P   N         INEC+ N   C  NADCI+T  SY C C+  F
Sbjct: 1280 NECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDF 1411          
BLAST of SMED30010561 vs. Ensembl Celegans
Match: mua-3 (Transmembrane cell adhesion receptor mua-3 [Source:UniProtKB/Swiss-Prot;Acc:P34576])

HSP 1 Score: 226.483 bits (576), Expect = 4.754e-58
Identity = 371/1432 (25.91%), Postives = 551/1432 (38.48%), Query Frame = -1
Query: 1169 VESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVN-ATYRCICPDGFQGDGYN-FCNDIDECANDNTHN---------CSSLEKCVNSNGQYNCVCGDGAVYVDD-ICVDIDECSSNQTNKC--SSNAICQNKEGTYSCQCAEGFYGDGLLCHDI---DECKFGVANCSENALCINKPGTFACECQAGTLGN--------GTTC-GDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKG--------TGWFCIKQT-PCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDN---------CDRETSNCVQL-DPGFKCECKPGF-------NMVGNTCQDK-NECD-PT-----SPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNS-------SCKPI-DSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVD---------VDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSK-------KACTDR-NECQENPMICGDLSKCLNTDGSYECQCVTGY--------KWNGTNCED--IDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR------------------DDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECV-TRKSACHKFAECTNNDGAYVCTCPSYL--TGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVK----IPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQL-PS----GKC--ENINECE-EKSDNCSINSVCQDKADGFSCQC-------KPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGF--------SLQGGYC-NDINECLI-PNSCGQNSVCANTVSGFNCSCANG-------ARQLPNGDCELINECLENID-----RCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQ---VCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEIS-----------EQSNMKFCN-NGKCINT-AGGFTCDCPEGFIYNNYD--------CIDVDECSLDQVSS---LADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQ-FPNSCLD---------GLCNNLPGSFECLCNIGYD------LVNGKC--TDINECSNNSQICGPQAAGICINAAGSFQCKCNVGY--ENSGGKSYNPCQSVNECVKLNIT-CPSNAQCVDRSNGYECICKDGYQEDQI-----GICRNINEC--QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLC 4825
            VE+    C C   F+    T     +LC     +SC     C+      +RC CP+G+  D  + FC  + E      H+         CS  E+C N    + C C  G   + +  C     C+ N    C       C  +   Y+CQC        +   DI   +EC  G  +C  +A CI+   ++ C CQ+G + +        G  C   ++EC       G+  C  NA+C + + GY C C+SG+           G  C +    C  P  N C  N  C  + E     C CKP F   ++   P   CE    N         CDR  + C+Q+ D  + C C PGF       +  G  C     ECD PT     SPD A          C +T   ++C C Q  ++ + S        CKP+ + CA+G+D+C R    C  + DS +TC+C   +  ++   V          ++EC    + C   ATC +   SY+C CP +  +DLS        + C  R NEC  N   C   + C++T  SY+C+C   +        +  G  C    +DEC    H CH  A C ++P    C+C   F     +      S P R                  +  K      C ++G    C+C   Y+  +            CS I+EC+ T+ + CH  A+C +    Y C C       GD +           E    +LN   C      +++   ++C C  G++      PG       NECL P  N C  NA CID E  YEC C+ GF  + PS    G+   E +NEC   + ++C  N+ C+D  D + C C        P   +     L    I+EC +       P + C +N  SF C CP GF        +  G  C   ++EC    ++C  ++ C +   G+ C C +G           P   C     C  N D      C+ L G         + Y CVC  G+V+     Q   VC   N C     +  + N+ C D    ++C CK GF   S         CE             +      C+  G C  T A  +TC+C  G+   + D        C+  +   LD   +    A  C +VNG        + C C  G+              C+   N CLD          +C +LP  + C C I            G+     +NEC+N S +    A   C +    ++C+C  GY  ++     +     +NEC   N+  C  NA C+D + GY+C CK  Y+++        ICR +NEC     ++C   ADC D D  Y CTC++G+             PN   PG++C
Sbjct: 1443 VENGRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEECQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPIT--DICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLD-----GSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDRNAHCIDTIEG--YSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDR-NARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAV---------CTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDS-FTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQS-HIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRA----SHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSS---------GSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLND--CHQNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMF--INECESGVH-DCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGG---------MKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNG-----PEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECANPS-LNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-LNECLNPNRNTCDRNADCRDLDYGYTCTCRHGFYDQ---------SPNPQEPGRIC 2810          

HSP 2 Score: 179.874 bits (455), Expect = 4.897e-44
Identity = 346/1424 (24.30%), Postives = 531/1424 (37.29%), Query Frame = -1
Query: 2969 RSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGL------EEC--GKLLCPLNALCVNS----TCLCKSGY---------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYI------GDGINCFKKDTDTDACQIENYC-TDGDCY-----DGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCID-IDEC-NENVDDCQ--ENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGV--------GIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC-QDVNECQT-QSPCHILAQCINTPGSYKCQCPENFYGD-------PQNKC---FEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSE--SCATNGECQNTIGSFKCECKDGF--IGDGKYDCRI------DSKCEKYGGCHEDASCIVNVESSIYECQCHTEF----SGDGITSCIK-NNLCFVNGKSSCHENAICEQVNATYRCICPDGF-------QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVC-------GDGAVYVDDICVD-IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGD--------GLLCHD-IDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE--DECKKPKGSPGAPECDENAVCKN-KDPGYTCECQSGY------KGTGWFCIKQTPCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCE-CKPGFNMVGNTCQD--KNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNEN-NSSCKPIDSCAMGLDNC-DRKVEDCISSK-------DSSYTCQCIEGF--------QRINGSCVD-VDECADK-IDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDR------NECQENPMI--CGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECV-TRKSACHKFAECTNNDGAYVCTC 6808
            R  Q C      + C+C    K         +NEC   ++ CD +A CI+TD S++C C++G+I    N   + G        EC  G   C  NALC ++     C CKSG+               +   N+C N         CD NA+CIDT   + C C  G++        G  C +  T+      +N C  +  C      D  C CP GF  KS                                 S S     CI  I EC N  ++DC   + ++C +    Y C+C   +LD+               + S   G+ C      C +G++         +C+++      GIC  N +       + C+C   Y  V        G K  R I+EC    N+C+    C++TE S+ C+C +                    SH    P+ + +        P   C   +NEC + +  C   A CI+TP SYKC+C ++F  +       P   C     D+C+T    C    +C+    G  C+  S +  ++  +    P  ++CQ         C+++ G                    ++C         N  C+   G   C+C V +QR  +     SC+ I+ECL ++   C T  +C + +  + C+C+DGF  IGD +   R+      + +      CH++A+CI   E   YEC+C+  F     G     C +  N C     +SC  NA C      Y C C DGF          G      ++ECAN   ++C    +C ++   Y C C            +   +C+  I+EC S   + C  +A C++ E +++C+C  GF           G +C   +DEC+ G   CS +A C +    + CEC+ G +        +    C  P+  P   +C   AVC+      Y C C  GY         G  C++   C  P  N C  N  C   +E     CECK  F             +   D+  R          G  CE   P      + CQD  +N+C P      A  C A+G        S+ C C     + + +   KP   C +    C D +  DC ++           YTC+C +G+        +R    C   ++EC D+ ++ C + A C ++   Y C+CP N K          R      NEC  NP +  C   + C + +  Y C+C  GY        D D       P H   RCS +   C                   DS    D   C   + C        C C   Y D    +  G +C      ++EC+   ++ C + A+C + D  Y CTC
Sbjct: 1578 RKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNP----RLNQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKS--------------------------------PSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISP-------------SISVKPGRLCKPLQNECALGID---------DCARDG-----GICEDNPD------SFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQ--------------------SHIDLSPDTVNR--------PGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQ-CSADFVDVSPHRASHP-GRLCQPRPTPPPPECRLDGG--------------------NQC-----KVHLNEVCRLMGGEPKCSCPVNYQRDSSG----SCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCHQNAACIDLEEG--YECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMFINECESG-VHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLNTCSRNAICY--DEPRGYRCECKRGFM------------DRSPDSSQR----------GRVCEPPPPPSPPPRHPCQDPERNDCHP------AGTCRATGA------QSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECA-NPSLNSCSAFADCFDEENGYRCRCRNGY-------HDDD-------PAHPGHRCSFMINEC-------------------DSSNLND---CDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-----LNECLNPNRNTCDRNADCRDLDYGYTCTC 2792          

HSP 3 Score: 162.155 bits (409), Expect = 1.244e-38
Identity = 335/1318 (25.42%), Postives = 503/1318 (38.16%), Query Frame = -1
Query: 4913 CICAPGY-VLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNI-----------TCSNDAFCDFKDDDYGCHCKNGFMGD--------GIMCKDI-DECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEG--------NGVTCTN-INECY--PLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDR-------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFR-PSPIDS---FVCTDV-NECN--LVHECDK-NYAKCTNTPGSYYCTCDSGYQ--------GDGRNCTDI-DECSSN-KVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL-------HQCGENAECIDTDGGYYCQCKTGFTGHCDE--------CRD--IDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCS-----EIDECLLGLHNCSRSH--QFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFD-NGCDDNADCINTDGSFLCICRAGY--IG----SGRNCDPQEGLEECGKLL---CPLNALCVN----STCLCKSGY------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC-QIENYCTDGDCYDGICHCPSGFVFKSNKCFD--ERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDI-DECNENVDDCQENSICFNRFGSYDCKCPPNYLDV-----FKDGKVCMAVPLSQCNQ---SCPTGQYCNN----GSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCE-----ERLFG--YICKCKPGYEG-----------VGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG-------------------LCETNNVCNCGSHGIC----GPNYICQCKSGY-------EINPSGMC---QDVNECQTQSPCHILAQC--INTPGSYKCQCPENFYG---DPQN------KCFEDKCKTKAL-QCQAGEVCKLSLYGSVCE-KISCNSSEILINNE----CLPVNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGD-----GELC-VDVDECSNGDVS-CPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECL--LSESCATNGECQNTIGSFKCECKDGF 8233
            C C PG+  + NG C  P +C             +Q         C+C     +   T+I            C   A C   D+ Y C C++GF+          G +C  + +EC + ++ C  NA C +T   + C CK GF           G+ C   +NEC    L+ CD     C D + GY C C+ GF+     GN   R       ++C+   N CDR +         Y C C  GF+  SP  S    +C  V  EC+   +++CD  + A CT+T   Y C C  G+           GR C  + +EC+     C R    C + P S+ CRC         D      + T+P   C                      I+EC T  NDC+  +A C + + SY C C   +   S + +      C+  +       H C  NA+CIDT   Y C+C+  F     +        CR   +DEC    ++C  + A C++    +TC+C+  +        S  G +C         EC L   N  + H  + C  + G  +C C   Y+ D++GSC   NEC F   N C   ADCI+    + C CR G+  IG     GR C P   + EC       C  NA C++      C C  G+            +  TN+C+      S  SCD NA CID    + C C +G+I    +   K     AC ++ N C +    D           K+ +C D  +  E  CP N+     S             S     C+   +EC   V DC  ++ C +   S+ C+CP  ++D       + G+VC+ + + +C +   +C +   C +     +C C  G     D   NL          P +CP N +C      E L G  Y C C  GY             V   +C D      ++N C+ N  C +    + C CKRG+   S                       C+     +C   G C      +Y C+C SGY          P  +C   + V     Q+ CH  A C  +N P  Y C+C + +     DP        K   ++C  ++L  C +  VCK    G  C+  I+                L VN+ C N    +C   A C  E     C C +GY+ D     G  C   ++EC + +++ C  N+ C +  G + CAC   ++             ++ECL     +C  N +C++    + C C+ GF
Sbjct: 1547 CECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDR-NAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFD------RVTRPGRKCK-------------------RLINECQTGQNDCS-EEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVN-AICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPM--VNECQYPHLNDCHQNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRP----SLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGR---ACRELVNECANSRLND---------CDKNARCKDTMDSYECDCPVNSKDISPSP------------SFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKL-VDECREGRHTCSSHADCRDLEEGYTCECRDGY---VDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHD-----PRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSGYADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNE-CANPSLNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCIDTAGGYDCACKAPYRDEGPPQSPGRICRLNECLNPNRNTCDRNADCRDLDYGYTCTCRHGF 2796          

HSP 4 Score: 160.614 bits (405), Expect = 3.725e-38
Identity = 263/1064 (24.72%), Postives = 400/1064 (37.59%), Query Frame = -1
Query: 1130 ETSNCVQLDPGFKCECKPGFNMVGN-TCQDKNECDPTSPD----FAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--------QRINGSCVDV-DECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDR--------NECQENPMI--CGDLSKCLNTDGSYECQCVTGY------KWNGTNCEDI---DECAIKTHPCHDLARCSNV-PGSCKCKCQPGFTGDGIYSCIETDSC---------PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSD----IDECVTRKSACHKFAECTNNDGAYVCTCP-SYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKI-------PGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGF-------KQLPSGKCEN--INECEEKSDNCSINSVCQDKADGFSCQCKPGF------KWSDETNL----NCEDIDECT--NPTSCSSMPHSICMNNPGSFECVCPHGFSL-QGGYCNDINECLIP--NSCGQNSVCANTVSGFNCSCANGA-----RQLPNGDCE-LINEC-LENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDE--VFPQVCEN-QNEC-EINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECE--ISEQSNMKFCN---NGKCINTAGGFTCDCP-------EGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFV------MIENSTKCVD-IDEC-QFPNSCLDGL-CNNLPGSFECLCNIGY-DLVNGKCTDINECSNNSQICGP----QAAGICINAAG-SFQCKCNVGY--ENSGGKSYNPCQSVNEC--VKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLAD--CLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCV 3946
            E   C      + CEC PGF  + N  C     C+P  P        Q+CL  G         + C C + +     +     + C  G  +CDR    CI + D SY C C  GF        +R    CV + +EC D  + C  NA C +    YVC+C     +D S    T          NEC  NP +  C   + C++T   Y C C  G+         G  CE I   D+C+   + C   ARC  +      C C PGF      S      C         P  +D   P  + C    +   C C  G+ D +    +  G +C    ++    ID+C      C       +N  ++ C C  +YL            +C    + C    + C       +    + C C   ++ +       PG +  +  NEC +   +DC  NA CIDT  SY+CRC+  F        + P   C    ++EC     +C +N++CQD   G++CQC   F      + S    L          EC       C    + +C    G  +C CP  +     G C+ INECL    N C   + C + V G+ C C +G      R+ P   C+ ++NEC   +++ C      ++ C DL  GY C C  GF++       ++C+   NEC   +++SC   N+ C+D    ++C C+ GF   S    +    C   ++E +N +  +   N +C +T   + CDCP           +    C+      +++  S   +CD  +  C +    F C C  GFV             CV  +DEC +  ++C     C +L   + C C  GY D      +      +  ++C P     +A +C    G  +QC C  GY  ++ G +    C   N C   +LN TC  NA C D   GY C CK G+ +      +    C+            C D +                         N C P   C+      Y C C+
Sbjct: 1534 ENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGN-------IYTCQCGRNEKRHPITDICLKNECLTGEHDCDRSAR-CIDT-DESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGF-VDYSPNPQTFPGMVCKELVNECT-NPRLNQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICE------DNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTS-NRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRDSSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCH----QNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCD-RNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMF----INECESGVHDCDP-SATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRVCVRNNACHDPRLN-TCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPER------------------------NDCHPAGTCRATGAQSYTCECL 2544          

HSP 5 Score: 155.992 bits (393), Expect = 8.979e-37
Identity = 243/924 (26.30%), Postives = 359/924 (38.85%), Query Frame = -1
Query: 1238 EDCISSKDSSYTCQCIEGFQRINGSCVD-VDECADKIDSCKNNATCNNMIGSYVCKCPDN-LKLDLSKKACTDR------NECQENPM-ICGDLSKCLNTDGSYECQCVTGY--------KWNGTNC-EDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKC--------PTGSYCNMIGN-FIYCNCTNGYED---SNQMECIGDVCYKKCSDIDECVTRKSACHKFAEC-TNNDGAYVCTCPSYLTGD-------GKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGY-------VKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQL------PSGKC--ENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGS--FECVCPHGFSLQGGYCNDINECLI--PNSC--GQNSVCANTVSGFNCSCANGARQLPNGDCELINECLE-NIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQ---------ASNSECVDTYGSFKCVCKPG-------FSKNSDGDCVD-YDEC---EISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDC-----------IDVDECSLDQVS-SLADNCDQ------VNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPC-----QSVNECVKLNITCPSNAQCVDRSNGYECICKDG-------YQEDQIGICRNI-NECQIE--DSCHYLADCLDTDGSYKCTCKYGY 3670
            E C  + +S Y C C EGF    G+C + +DECA     C   A C + +  Y C C +  L   +  KA   R      NEC    M  C   ++CL+    Y C+C   Y        +  G NC + I+ECA   H C   A C + P    C+C  GF  D   + +E    P R  V+          T S C    N    C C  GY++      + C  +     C D          C   AEC +   G + C CP   T         G+      +ECAL  HTC+ +        + ++    + C C +G+       ++ PG + C   + C N    DC   A C +T     C+C SG+  +      P+G+     +NEC E   +CS ++ C D ADGF+C+CK  ++  DE+                     S  + +PG      V P           D  EC +  P SC   +  VC    + + C CANG  +LP+G C +INEC E  ++ C    G ++ C DL  GY C C  G+ +      V +    C   ++ C          + N+ C DT  S+ C C+PG       F+K     C++  +EC    +++ S   FC + K      G+ C C  G++ N+ +            ++  +  L   S S  D CD        N  C+   G   C C      +E + +  D            G C                 V   C+  N C  N+         IC+N   S+ C+C  GY +      N       + +NEC   +  C   A+C+D +NGY C C DG       Y +     C N  NEC  +  ++C   ADC+DT   Y C C  G+
Sbjct:  390 ESCQKNSESKYECICREGFTIFEGTCRELIDECAQGKHDCHPEARCVDALIGYECLCREGYLDTSIDPKARPGRKCRKLINECTNALMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCDTHAICQDQPVGYSCRCPFGFI-DSSPTALE----PGRKCVQANNEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTKTHLNCQMEKRANPCQDYS-----LHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHA-------DCIDTHQGYTCKCRSGWSDTSLDPLRSPG-RSCKKADMCSN---IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYR--DES---------------------SDTLKHPGKNCVRTVQP-----------DPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTC----GKNAECIDLAEGYTCQCRSGYAD---ISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAK-----EGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCEC------VETAFRYTD------------GSCR----------------VYSACSKRNTCDKNA---------ICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGF 1203          

HSP 6 Score: 147.902 bits (372), Expect = 2.538e-34
Identity = 339/1404 (24.15%), Postives = 521/1404 (37.11%), Query Frame = -1
Query: 3887 GSYECRCLDG------TPGCDGD--NPCNTVQCTKPNEICYLG-----QCFCKHGFQNNVTTNICEDIDECDTAANDCA---------GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQC--GENAECIDTDGGYYCQCKTGFTGHCDECRDI---DECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSEI-DECLLGLHNCSRSHQFCFNVNGGFECRCLSGY------KSDTNGSCVDE--NEC---RFFDNGCDDNADCINTDGSFLCICRAGYI------GSGRNCDPQEGLEEC--GKLLCPLNALCV-----NSTCLCKSGYENST-------NQCINT-DECESQT--SCDV--NANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQ-IENYCTDG--DCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCID-IDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKD-----GKVCMAVPLSQC---NQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGI----------CPLNANCEERLFGYICKCKPGYEGVGIKSCRD------------IDEC---GGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVC------NCGSHGIC---GPNYICQCKSGYE-----INPSGMCQD-VNECQTQ--SPCHILAQCINTPGSYKCQCPENF----YGDPQNKC--FEDKCKTKAL-QCQAGEVCKLSLYGSVCE----KISCNSSEILINNECLPVNQVCQNI---NCGNHAFCK--IENGRADCFCDSGYYG-----DGELCVD-VDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRL---ENALVTDSCTD-IDECLL-SESCATNGECQNTIGSFKCECKDGFIGDGK-------------------YDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCND--------------IDECANDNTHNCSSLEKCVNSNGQ-YNCVCGDGAVYVD----------DICVDIDE-CSSNQTNKCSSNAICQNKEG--TYSCQCAEGFYGD--------GLLCHD-IDEC-KFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPK-------------GSPGAPECDENAVCKNKDPGYTCECQSGYKGTG--------WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKT-----ECENKTDN-CDRETSNCVQLDPGFKCECKPGF 7387
            G   C C +G      T  C GD  NP     C  P E C +      +C C  G+  +  +  C  + E   +    A             +C N    + CECL G+      +     +   ++   C   +  +C+     Y CQC      H     DI   +EC    ++CD   A C ++  S+ C C  G+           G VC  + +ECL G + CS  +  C +   G+ CRC SG+           G    E  NEC   R   N CD NA CI+T   + CIC+ G++        GR C+  +  ++C  GK  C  NA C+     + +C C  G+++ +         CI    EC++ T   CD    A C DT   ++C C +G++    +   K      C+ ++N C  G  DC                     R   +C  N        +          ++    +C   I+EC    +DC E + C +   SY C CP +++D+  D     G+ C+ + +++C      C     C +   S          D+   +  +    C P +          C +NA C++   GY C+C   +  V                     EC   GG      +NE C    G   CSC   Y R+ SSG C   N C      +C +   C      Y CQC+ G++       P  MC+  VNECQ    + CH  A CI+    Y+C+C + F    +G P   C    ++C   +L  C     C     G  CE     I  + S  L    C  +   C N    +C  +A CK  +++   DC  +S          G +C+  ++EC +G   C  ++ C++ + SF C C  GF      ++A     C   +DEC     +C+++ +C++    + CEC+DG++                       +DC   + CE  GG      CI       Y  Q      G     C++NN C     ++C  NAIC      YRC C  GF     +                     C +   ++C     C  +  Q Y C C  G  Y D           +CV  +  C   + N C + AIC    G   Y+C+C +G+  +        G +C   I+EC    + +C   A+C + P  + C+C             +D+   P+              +P    C   A C +++ GY C C++GY             F I +      N C  N  C   +      C CK  ++ E     P       EC N   N CDR  ++C  LD G+ C C+ GF
Sbjct: 1446 GRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEE-CQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRH--PITDICLKNECLTGEHDCDRS-ARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCS-PNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRL--NQCDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRL--CKPLQNECALGIDDC--------------------ARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCL-MRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPALVDECRTGKHDCHVNAICQDLPQGYTCQCSADFVDVSPHRASHPGRLCQPRPTPPPPECRLDGGNQCKVHLNEVCRLMGGEPKCSCPVNYQRD-SSGSCSIINECLFTQLNDCHTAADCIDQVQGYTCQCRDGFKDIGDRRRPGRMCKPMVNECQYPHLNDCHQNAACIDLEEGYECKCNQGFMDHSHGRPGRICKQLTNECLRPSLNSCDRNARCIDKEEGYECECRDGFIDVSPSPTLKGRACRELVNECANSRLNDCDKNARCKDTMDSYECDCPVNSKDISPSPSFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDCSSAAVCEPLGGMKYQCVCIQG-----YVDQSPGSQKG---RVCVRNNACHDPRLNTCSRNAICYDEPRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCHPAGTCRATGAQSYTCECLSG--YADRSPDPRNKPGRLCVLTEPVCLDPEQNDCHAAAICSEVNGPEKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINA---------KDQSPDPRKPGRICSLSVNECANPSLNSCSAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINECDSSNLNDCDRNANCI--DTAGGYDCACKAPYRDEGPPQSPGRICRLNECLNPNRNTCDR-NADCRDLDYGYTCTCRHGF 2796          

HSP 7 Score: 139.428 bits (350), Expect = 9.065e-32
Identity = 220/887 (24.80%), Postives = 357/887 (40.25%), Query Frame = -1
Query: 1739 PDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTC--------QDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNEN-NSSCKPIDSCAMGLDNC-DRKVEDCISS-----KDSSYTCQC--------IEGFQRINGSCVD-VDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNEC----QENPMICGDLSKCLN-TDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHD--------LARC-SNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSY-------CNMIGNFIYCNCTNGYEDS--NQMECIGDVCYKK--CSDID---ECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGY-------VKIPGTQ----ICLNKNEC--LNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINEC-EEKSDNCSINSVCQDKADGFSCQCKPGFK----WSDETNLNCEDIDECTNP----TSCSSMPHSICMNNPGSFECVCPHGFS--------LQGGYCND-INECLIP--NSCGQNSVCANTVSGFNCSCANG-------ARQLPNGDC---------ELINECLENIDRCQVLN---GADSVCYDLPIGYACVCPDGFVND-----EVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGF------SKNSDGDCVD--YDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFI-----YNN---YDCIDV-DECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMI 4021
            P+F    D       C NKT  C    S     +  ++C C+ GF +   TC        Q K++C P +              C++    + C C +  ++ + +   +P   C   ++ C +  + DC  +     K   YTC+C         EG ++   +C   ++ECA  + +C  +A C +    Y C+CP    +D S  A     +C     E        S+C+   +G   C+C+ GYK  GT      +   + +PC D        +A C S  PG  +C+C  GFT            C  R   +C  G +       C        C C +G+ D+  + +   G  C K   CS+ID   E   R++      +C +    YV     +    G+      NECA   H C+ + +  +  D        F C C + Y       +K PG      +  +  EC   +P+  D  +  +CI  E +Y+CRC +G+ +LP G+C  INEC E + + C  N+ C D A+G++CQC+ G+      S    +    ++EC+N       CS   ++IC +   S+ C C  GF+        L G  C + +NEC  P  N C +N+ C +   G+ C+C  G       A + P   C         +L +      D C   N   GA+  C      + C C +           V+   C  +N C+         N+ C++ + S+ C C+PG+        N+ G       +EC  S+     +    +CI+   G+ C C +GFI     YN      C +  +ECS   +++  +N D     C++T  G+ C C  GFV +
Sbjct:  370 PEFHFNRD----DIRCGNKT--CGLHESCQKNSESKYECICREGFTIFEGTCRELIDECAQGKHDCHPEA-------------RCVDALIGYECLCREGYLDTSIDPKARPGRKCRKLINECTNALMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCDTHAICQDQPVGYSCRCPFGF-IDSSPTALEPGRKCVQANNEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTKTHLNCQMEKRANPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKC-VRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGPMCQCVS---GYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADG-------FTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSE--NAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVY-SACSKRNTCD--------KNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPY---ARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENAD-----CVDTPDGYTCQCYGGFVDV 1206          

HSP 8 Score: 126.331 bits (316), Expect = 7.233e-28
Identity = 230/885 (25.99%), Postives = 346/885 (39.10%), Query Frame = -1
Query: 5768 LECTNITCSNDAFCDF-KDDDYGCHCKNGFMGDGIMCKD-IDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF--------EGNGVTCTN-INECYPLSPCD-NATEECFDKVPGYECRCQKGFMKNTTTG------NCDDR-NECADTGNLCDRVSTNCNNTFGSYRCDCKYGF---RPSPIDS-FVCTDVNECNLVHECDKNYAKCTNTP-GSYYCTCDSGYQGDGRNCTDIDECSSNKV---CQR-------PDATCVN-LPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH----QCGENAECIDTDGGYYCQCKTGFTGHCDE--------CRDI-DECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQ--------------------FCFNVNGGFECRCLSGYKSDTNGSCVDENEC-RFFDNGCDDNADCINTDGSFLCICRAGYIG------SGRNCDPQEGLEECGK-----LLCPLNALCVNS----TCLCKSGYENST--------NQCIN-TDECESQT--SCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPK---NAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKD-----GKVCMAVPLSQC----NQSCPTGQ---YCNNGSCSCLMG---LNSQTDDDGNLNCSKNSASCLP---GICPLNANCEERLFGYICKCKPGYEGV 8074
            + C N TC     C    +  Y C C+ GF      C++ IDEC+     C   A C + +  + C C+EG+           G  C   INEC      D +    C DK  GY CRCQ  ++  +  G      NC    NECA   + CD     C +    Y C C +GF    P+ ++    C   N  N         ++C     G   C C  GY+  G   T ++ C   K    CQ        P A C +  PG ++C+C  G      D      +C +  + C LG+                     CD  A+        C +    Y C+C  G+  +S++ +      C          C   AEC +T  G  CQC +G+     +        CR + +ECA   ++C S  ATC ++   FTCRC + Y  + S     D       NC R+ Q                     C  V   ++CRC +GY    +G CV  NEC     N C  NA+CI+    + C CR+GY         GR C  +  + EC       + C  NA+C ++    +C C+ G+ + +         +CI   +EC S +   C  NA C D    +IC C  GY+ +  N  +         +E   TD              +  ++   D+ C+   PK   N  C    G   C C       +D S C     C++  + C +N+IC NRF SY C+C P Y+D+  D     G++C  + +++C    N+  P  +     N  +C CL G   ++S+ +      C+ ++  C       C  NA+C +   GY C+C  G+  V
Sbjct:  379 IRCGNKTCGLHESCQKNSESKYECICREGFTIFEGTCRELIDECAQGKHDCHPEARCVDALIGYECLCREGYLDTSIDPKARPGRKCRKLINECTNALMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCD-THAICQDQPVGYSCRCPFGFIDSSPTALEPGRKCVQAN--NEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTK-THLN-CQMEKRANPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGR-------------------HTCDPHAD--------CIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSS-HATCIDTADGFTCRCKDSYRDESS-----DTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRIC--RARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTD--------------LKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGS-CRVYSACSKR-NTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKEL-INECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFVDV 1206          

HSP 9 Score: 121.324 bits (303), Expect = 2.583e-26
Identity = 216/822 (26.28%), Postives = 318/822 (38.69%), Query Frame = -1
Query: 6383 CICAPGYVLENGNCTK-------------PEA--------CGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQL--ECTNIT---CSNDAFCDFKDDDYGCHC--------KNGFMGDGIMC-KDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF---------------------------------EGNGVTC-------------TNIN----------ECYPLSPCDNATEECFDKVPGY-ECRCQKGFMKNTTTGNCDDR------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFV-----CTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGY--------QGDGRNCTD-IDECSSNKVCQRPDATCVNLPGSYECRCLDG-------TPGCDGDNPCNTVQCTKP--------------NEICYLGQ----CFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXX--------XXXXXNLHQCGENAECIDTDGGYYCQCKTGFT-----------GHCDECRDIDECAF-SLNNCDSDRATCENSIGSFTCRCNEGYSGD--------GSVCSE-IDECLLGLHNCSRS--------------HQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYI--------GSGRNCDPQEGLEECGKL--LCPLNALCVNST----CLCKSGYENSTN--------QCINT-DEC--ESQTSCDVNANCIDTHGSFICYCNEGYI 8233
            CIC  G+ +  G C +             PEA          CL  +G  Y +           KCR      +L  ECTN     CS +A C  K   Y C C        + G    G  C + I+EC++N   CD++A C++    +SC C  GF                                 E NG T              T++N          + Y L  CD    ECF + PGY +C+C KGF  ++       R      +ECA   + CD    +C +T   Y C C+ G+  + +D        C   + C+ + +C    A+C  TP    C C SGY        +  GR C   ++EC+  +      ATC++    + CRC D        T    G N   TVQ   P               E+C   +    C C +G+ + +    C  I+EC     +  G+ A+C +L   Y C+C  GY   S       I        +        C ENA C DT+  Y C+C+ GF              C E   ++ECA  SLN+C S  A CE++   + C C  GY  +        G +C++ +++    L + S S              ++ C   +G   C C+      T+GSC   + C    N CD NA C+N   S+ C CR GYI          GR C  +E + EC      C   A C+++T    C C  G+ + ++        QC N+ +EC  +S  +CD NA+C+DT   + C C  G++
Sbjct:  402 CICREGFTIFEGTCRELIDECAQGKHDCHPEARCVDALIGYECLCREG--YLDTSIDPKARPGRKCR------KLINECTNALMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCDTHAICQDQPVGYSCRCPFGFIDSSPTALEPGRKCVQANNEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTKTHLNCQMEKRANPCQDYSLHDCD-PVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCD-PHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNI-DCAAE-AECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGY-SRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEA--VNECASPSLNDC-SKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACS-KRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRIC--KELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFV 1204          

HSP 10 Score: 116.701 bits (291), Expect = 6.066e-25
Identity = 194/828 (23.43%), Postives = 297/828 (35.87%), Query Frame = -1
Query: 3887 IDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD--------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGL------CETNNVCNCGSHGIC------GPNYICQCKSGYEINPSG------MCQDVNECQTQS--PCHILAQCIN-TPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGF---QRLENALVTDSCTDI-DECLLSES-CATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDIC-------VDIDECSSNQTNK--CSSNAICQNKEGTYSCQCAEGFYG--------DGLLCHD-IDECKFGVAN-CSENALCINKPGTFACECQAGTLGNGTTCGDEDE--CKKPKGS-----------------PGAPECDENAVCKNKDPGYTCEC-QSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDF-KLEND-TCIPKTECENKTDNC---DRETS---NCVQLDPGFKCECKPGF 6124
            IDEC +   DC   + C +    Y+C C   YLD   D K   A P  +C +       C N                            L   C  NA C ++  GY C+C+  Y  V  +  R         I+EC   ++NC  +  C +    ++C C  G+  +S + L       + NN     S              +C+C  GY+   +       M +  N CQ  S   C  +A+C +  PG ++CQCP+ F     +K F   KC     +C  G             + +C+      + +C+  +Q            CK  +G +D   D      G  C   D CSN  + C   + C+       C C  G+    R         C  + +EC      C+++  C +T   F C CKD +  +     +           H   +C+  V+    EC      S D                    +  +C  V  TY+C C +G+       C  I+ECA    + C    +C++    Y C C  G   +  +          ++ECS+ +     CS NAIC + E +YSC+C  GF           G  C + ++EC     N CS+NA C +    + C C+ G + N           C KP                    P  P+C  N  C  +   + CEC ++ ++ T   C   + C   N C  N  C   N      C+C+P +  L  D T  P   C+   + C   D E S    C+    G+ C+C  GF
Sbjct:  419 IDECAQGKHDCHPEARCVDALIGYECLCREGYLDTSIDPK---ARPGRKCRKLI---NECTNA---------------------------LMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCDTHAICQDQPVGYSCRCPFGFIDSSPTALEPGRKCVQANNEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTKTHLNCQMEKRANPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALG-------------RHTCDP-----HADCIDTHQ---------GYTCKCRSGWSDTSLDP-LRSPGRSCKKADMCSN--IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLK-----------HPGKNCVRTVQPDPPECDVSDPMSCDPA------------------KREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCSKNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACSKRNTCDKNAICL--NRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGF 1152          

HSP 11 Score: 112.079 bits (279), Expect = 1.562e-23
Identity = 201/806 (24.94%), Postives = 297/806 (36.85%), Query Frame = -1
Query: 5423 CTKPNEICYLGQCFCKHGFQNNVTTNICED-IDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXX--------XXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE---------CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSE------------------------------IDECLLG-------------------------LHNCSRSHQFCFNVNGG-FECRCLSGY------KSDTNGSCVDE-NECRFFDNGCDDNADCINTDGSFLCICRAGYIGS--------GRNCDPQEGLEECGKLLCPLNALC----VNSTCLCKSGYENSTNQCIN---------TDEC-ESQTSCDVNANCIDTHGSFICYCNEGYIGD--------GINCFKK-DTDTDACQIENYCT----------------DGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQC-----IDIDECNENVD---DCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDI-----------------------DECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN----CGSHGIC---GPNYICQCKSGY-------EINPSGMCQD-VNECQTQ-SPCHILAQCINTPGSYKCQCPENF 7315
            C K +E  Y  +C C+ GF   +    C + IDEC    +DC   +A+C +    YEC C  GY  +SI+       +            ++ C +NA C+D   GY C+C+  +     E          + I+ECA +L+NCD+  A C++    ++CRC  G+        E                              + +CLLG                         LH+C    + CF+   G F+C+C  G+      K      CV   +EC    + CD +ADCI+T   + C CR+G+  +        GR+C   +  + C  + C   A C    +   C C SGY + + Q             +EC E +  C  +A CIDT   F C C + Y  +        G NC +    D   C + +  +                   C +G    P G     N+C + R  N C KNA C   +    C C  G +  S  SQ        ++EC+       DC EN+IC +   SY C+C P + DV                    +  +       C+  +N       N +CSK            NA CE+   GYIC C+PGY      + R                         D C  K   C  NE C    G   C C     R  + G C   + C+    C  + IC     +Y CQC+ GY          P  +C++ +NEC +  + C   A+CI+    Y CQC + F
Sbjct:  392 CQKNSESKY--ECICREGF--TIFEGTCRELIDECAQGKHDCHP-EARCVDALIGYECLCREGYLDTSIDPKARPGRKCRKLINECTNALMNDCSQNARCLDKPIGYTCRCQDDYVDVSREGARKPGRNCTQAINECASNLHNCDT-HAICQDQPVGYSCRCPFGFIDSSPTALEPGRKCVQANNEAATTSTTTSQCIKEKNGETVCKCLLGYKNVGTKTHLNCQMEKRANPCQDYSLHDCDPVAE-CFSEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSC---KKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRL-NTCGKNAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSENAICADTEHSYSCRCRPGFADV--------------------SAAFNKLPGRRCIEAVNECASPSLN-DCSK------------NAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFR-YTDGSCRVYSACSKRNTCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGF 1152          

HSP 12 Score: 101.293 bits (251), Expect = 2.950e-20
Identity = 159/556 (28.60%), Postives = 227/556 (40.83%), Query Frame = -1
Query: 6506 CSNNTSVCDSNAFCKNTIGSFSCSCKEGFE--GNGVTCTNINECYPLSP--CD-NATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF-----RPSPIDSFVCTDV-NEC-NLVHECDKNYAKCTNTPGSYYCTCDSGYQG--------DGRNCTD-IDECSSNKV--CQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANL-DGSYECECLYGYRMSSXXXXXXXXXXXXX-------NLHQCG--ENAECIDTDGGYYCQCKTGFTGHCDE--------CRDI-DECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSE-IDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE---------NECRFFDNGCDDNADCINTDGSFLCICRAGYIGS--------GRNCDPQEGLEEC--GKLLCPLNALCVN----STCLCKSGY 7951
            C N    C  N  C N    + C C  GFE   NG  C     C P  P  CD    ++C  +   Y C+C +   ++  T  C  +NEC    + CDR S  C +T  SY C C+ GF      PS     VC  + NEC +  + C  N A CT+T   Y C C SG+           G  C + ++EC++ ++  C R +A C++    Y C C  G    D        +   P   C              + TN     D+C    NDC  R A+C  + D  Y C C  G++  S +                   L+ C   + A C DTD GY C+C+ GF              C+ + +ECA  +++C  D   CE++  SFTCRC   Y        +  G  C   I+EC  G ++CS     C +    + C C   +  D +   V+          NEC    + C  NADCI+T  S+ C CR  ++          GR C P   ++EC  GK  C +NA+C +     TC C + +
Sbjct: 1525 CHNGGVRCSENERCTNDGSDWFCECLPGFERIRNG-QCAYPGSCNPNDPMSCDVRKRQQCLPRGNIYTCQCGRNEKRHPITDIC-LKNECLTGEHDCDR-SARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPN-ALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQCDR-NAHCIDTIEGYSCICKPGFVDMD--------EFGNPGRRC------------EQIKTN-----DKCSPGKNDC-DRNARCIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCS-EEATCTDTEDSYICACPQSH-IDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDFVDESPDSSRRPGRICRPAL-VDECRTGKHDCHVNAICQDLPQGYTCQCSADF 2046          

HSP 13 Score: 95.1301 bits (235), Expect = 2.057e-18
Identity = 159/597 (26.63%), Postives = 238/597 (39.87%), Query Frame = -1
Query: 6554 YGCHCKNGFMGD-------GIMC-KDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF--------EGNGVTCTNINECYPLSPCDNATE-ECFDKVPGYECRCQKGFMK-NTTTGNCDDR------NECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSF----------VCTDVNECNLVHECDKNYAK---CTNTPGSYYCTCDSGYQG--DGRNCTDIDECSSNKV--CQRPDATCVNLPGSYECRCLDG----TPGCDGDNPCNT------------VQCTKPNEIC----YLGQCFCKHGFQ------NNVTTNIC-EDIDECDTAA-NDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQ----------------------CGENAECIDTDGGYYCQC-KTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY--------SGDGSVCSE-IDECLLGLHNCSRSHQFCFNVNGGFECRCLSG-------YKSDTNGSCVDEN-ECRFFD-NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCP 8014
            + C C  GF          G  C + +DEC+     CD +A C +T   ++C C+ G+           G +C   + C   S  D A E EC +   G  C+C  G++  +   G    R      NECA+  + C   +T C +T   + C CK  +R    D+           V  D  EC++      + AK   C     +Y C C +GY    DGR C  I+EC+  ++  C + +A C++L   Y C+C  G    +P       C              V C++ N IC    +   C C+ GF       N +    C E ++EC + + NDC+ + A C +    Y C C  GY  +S N        C   + +                      CG N  C+   G + C+C +T F      CR    C+   N CD + A C N   S+TC+C  GY        +  G +C E I+EC    + CS  +  C +   G+ C+CL G       Y       C + N EC     N CD+NADC++T   + C C  G++    N +   G     +  CP
Sbjct:  640 FQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMC---SNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHAT-CIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGR-CVVINECAEPRLNTCGK-NAECIDLAEGYTCQCRSGYADISPVSQPGRICRARVNECSNKEKYNVDCSE-NAICADTEHSYSCRCRPGFADVSAAFNKLPGRRCIEAVNECASPSLNDCS-KNAFCEDAKEGYICTCRPGYVDNSPNAARHPGRICTKPVEKIKTDLKDTSFSTDDGCDPKNPKCGANEACVQRHGQHNCECVETAFRYTDGSCRVYSACS-KRNTCDKN-AICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECS-PYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDGYTCQCYGGFVDVSSNANLPPGRVCTVQTTCP 1225          

HSP 14 Score: 78.1814 bits (191), Expect = 2.448e-13
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = -1
Query: 9263 FNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFV-------KAAPTVCND-INECSLNSSICDANADCINTYGSYICNCKPGFR 9628
             +EC+   H CD HA+C +   G+ C C  GW     + + S GRSC   D C+ + C + ++C  TP   +C C  G+V       + A  VC   +NEC+     C ++A CI+T   + C CK  +R
Sbjct:  666 VDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAVVNECAEGRHDCSSHATCIDTADGFTCRCKDSYR 795          

HSP 15 Score: 71.2478 bits (173), Expect = 3.535e-11
Identity = 57/150 (38.00%), Postives = 73/150 (48.67%), Query Frame = -1
Query: 9230 NECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCID-DDEC--ALLKCPSTSDCTNTPGSFICNCHVGFVKAAP-------TVCND-INECS---LNSSICDANADCINTYGSYICNCKPGFRGS---GNPG-DCEAV 9625
            NEC T  HDCD  A C + D  + C C  G+     N     GR C+   +EC     +C   + CT+T   ++C C  GFV  +P        VC + +NEC+   LN   CD NA CI+T   Y C CKPGF      GNPG  CE +
Sbjct: 1610 NECLTGEHDCDRSARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRLNQ--CDRNAHCIDTIEGYSCICKPGFVDMDEFGNPGRRCEQI 1757          

HSP 16 Score: 59.6918 bits (143), Expect = 1.074e-7
Identity = 124/523 (23.71%), Postives = 182/523 (34.80%), Query Frame = -1
Query: 1238 EDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ-------GGYCND--INECLIPN------------------------------------------------SCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDR-CQVLNGADSVCYDLPIG--YACVCPDGFVNDEVFP--QVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQS-----NMKFCNNGKCINTAGGFTCDCPEGFI--------YNNYDCID-VDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTD-INECSNNSQICGPQAAGICINAA-GSFQCKCNVGYENSGGKSYNPCQ----SVNECVKLNIT---CPSNAQCVDRSNGYECICKDGYQEDQIGI-------CRNI-NECQ--IEDSCHYLADCLDTDGSYKCTCKYGY 2521
            ED+      T C    +  C    G   CVCP GF+         G  CN   I  C+ P                                                  C +N  C N  S + C C  G  ++ NG C     C  N    C V          LP G  Y C C     N++  P   +C  +NEC    H C  S + C+DT  S+ C C+ GF  +S           ++ Q+     + +   N  C +T  G+ C C  GF+        +    C + V+EC+  ++    + CD+ N HCI+T+ G+ C C  GF         VD+DE   P    + +                   N KC+   N+C  N++         CI      + C C  G+++    S  P +     + EC    +     P  A C D  +GY C C+ G+ +    I       C+ + NEC   I+D       C D   S+ C C   Y
Sbjct: 1422 EDVCNPRTQTGCDRSLNEHCAVENGRPRCVCPEGFTRHPFTRVCGGDLCNPQLITSCIFPEECQITPYKNFRCSCPEGYNRDYRSGFCVSVKEVQISPQHDANCHNGGVRCSENERCTNDGSDWFCECLPGFERIRNGQCAYPGSCNPNDPMSCDVRKRQQC----LPRGNIYTCQC---GRNEKRHPITDICL-KNECLTGEHDCDRS-ARCIDTDESYICACQSGFIDHSPNPSERPGRVCVALQNECLDGSNRCSPNALCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECTNPRL----NQCDR-NAHCIDTIEGYSCICKPGF---------VDMDEFGNPGRRCEQI-----------------KTNDKCSPGKNDCDRNAR---------CIQIGDDDYSCACPPGFKDKSPSSSRPGRLCIPVIPECDNPTLNDCDSPDRAVCTDTDDGYMCRCRQGFLDISPSISVKPGRLCKPLQNECALGIDDCARDGGICEDNPDSFTCRCAMNY 1895          

HSP 17 Score: 58.9214 bits (141), Expect = 1.820e-7
Identity = 89/308 (28.90%), Postives = 134/308 (43.51%), Query Frame = -1
Query: 7217 DDYGCHCKNGFMGD--------GIMCKD-IDECSNNT-SVCDSNAFCKNTIGSFSCSCKEGFEGN-------GVTCT-NINECY--PLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDD----RNECADTGNL--CDRVSTNCNNTFGSYRCDCKYGFR---PSPIDSFVCTDVNECNLVHE--CDKNYAKCTNTPGSYYCTCDSGY-------QGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPN-EICYLGQ-CFCKHGFQNNVTTNICEDIDE 8020
            + Y C C++G+  +        G +CK  I+EC + + + C S A CK+    ++C C    +         G  C+ ++NEC    L+ C +A  +CFD+  GY CRC+ G+  +             NEC D+ NL  CDR + NC +T G Y C CK  +R   P      +C  +NEC   +   CD+N A C +    Y CTC  G+       Q  GR C +  +    +  +R   T V      E              PC    C K   E+C  G+ C CK G   + +T  C+++ E
Sbjct: 2590 EKYTCKCRDGYTDESPDPLRRPGRICKGLINECLDRSLNDCHSLAVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECANPSLNSC-SAFADCFDEENGYRCRCRNGYHDDDPAHPGHRCSFMINEC-DSSNLNDCDR-NANCIDTAGGYDCACKAPYRDEGPPQSPGRICR-LNECLNPNRNTCDRN-ADCRDLDYGYTCTCRHGFYDQSPNPQEPGRICIEFQQ---EEHIERVKVTTVQSEPRREF-------------PCGRDDCIKARGEVCISGEYCGCKPGEGRSASTGKCQEVQE 2876          

HSP 18 Score: 56.6102 bits (135), Expect = 8.213e-7
Identity = 42/134 (31.34%), Postives = 58/134 (43.28%), Query Frame = -1
Query: 15587 VCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTD---------FNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGAN 15961
             C  N  C+N+  +Y C C+ G++    + T+          NEC S    CS YA C +    Y C C +G+    S  ++ P          CS     +CD+ A CVD  DG +TC C  G F D    AN
Sbjct: 1080 TCDKNAICLNRFDSYTCQCRPGYIDLSADLTNAPGRICKELINECASSDNECSPYARCIDATNGYACQCLDGFIDVSSRYNKPPGRQCTNSNNECSEKSLNTCDENADCVDTPDG-YTCQCY-GGFVDVSSNAN 1211          

HSP 19 Score: 55.8398 bits (133), Expect = 1.618e-6
Identity = 38/130 (29.23%), Postives = 56/130 (43.08%), Query Frame = -1
Query: 9311 PVNSLVIGSLMCSSSKI---DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCID-DDECALLK--CPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADC 9682
            PVNS  I        ++     NEC +  HDCD  A C + +  F C+C  G+     N+    GR C+   DEC   +  C S +DC +    + C C  G+V  +P + +          +C  N DC
Sbjct: 2290 PVNSKDISPSPSFPGRVCLMFINECESGVHDCDPSATCRDNEQSFTCECPSGFVDRSPNKHARPGRVCVKLVDECREGRHTCSSHADCRDLEEGYTCECRDGYVDRSPNLASQPGRVCSAPEVCPPNHDC 2419          

HSP 20 Score: 55.0694 bits (131), Expect = 2.543e-6
Identity = 62/226 (27.43%), Postives = 93/226 (41.15%), Query Frame = -1
Query: 2153 LNP-VENDCVENAICID-TEGSYECRCKSGFK----QLPSGKC---ENINECEEKSDN-CSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPN---------GDCELINECLENIDRCQV-LNGADSV--CYDLPIGYACVCPDGFVN 2764
             NP  +NDC  +  CI+ ++ +Y+C C  G++    Q P  KC      NECE K DN CS N+ C D    + C+C P +                 + +   S+P S+C+ +                 YC+D+N       C  N+ C N      C C  G   +           GD  L    + ++D C + LN    V  C D  +GY C CPDG+++
Sbjct: 3177 FNPCFKNDCDPHGKCIEISKYAYKCECGVGYRDINPQSPGKKCLPVHGFNECERKEDNECSENARCIDLEHLYKCECLPSY----------------YDTSPVGSVPGSLCVLD-----------------YCSDVN------FCPTNTTCKNMEQQAECKCDAGFMDIRKSEKRTALMLGDDTLCMH-VRDVDECALGLNNCSGVAHCIDRAVGYTCKCPDGYID 3362          

HSP 21 Score: 54.6842 bits (130), Expect = 3.006e-6
Identity = 38/132 (28.79%), Postives = 61/132 (46.21%), Query Frame = -1
Query: 9266 FNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCI-----DDDECAL---LKC-PSTSD-CTNTPGSFICNCHVGFVKAAPTVCNDINECS-LNSSICDANADCINTYGSYICNCKPGF 9628
             NEC+   HDC  HA C +   GF C C   ++    + +   G++C+     D  EC +   + C P+  + C     ++ C C  G+ +     C  INEC+    + C  NA+CI+    Y C C+ G+
Sbjct:  763 VNECAEGRHDCSSHATCIDTADGFTCRCKDSYRDESSDTLKHPGKNCVRTVQPDPPECDVSDPMSCDPAKREVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNTCGKNAECIDLAEGYTCQCRSGY 894          

HSP 22 Score: 53.5286 bits (127), Expect = 6.658e-6
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = -1
Query: 9266 NECSTNFHDCDLHAN-CTNLDSGFRCDCIKGWQGLGGNEMYSNGRSC---IDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCND--------INECSLNSSICDANADCINTYGSYICNCKPGF 9625
            NEC+    DC      C +    F C C   +  +  + +   GR C   I++ +     C   + CT+T  S+IC C    +  +P   N         INEC+ N   C  NADCI+T  SY C C+  F
Sbjct: 1864 NECALGIDDCARDGGICEDNPDSFTCRCAMNYLDVSFDRVTRPGRKCKRLINECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTVNRPGRRCLMRINECTSNRHDCSPNADCIDTPESYKCRCRDDF 1995          

HSP 23 Score: 53.5286 bits (127), Expect = 7.549e-6
Identity = 51/180 (28.33%), Postives = 77/180 (42.78%), Query Frame = -1
Query: 15620 CHEYGECFNSTASGESECRCKKGY-EGRADN-------CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN--------CTDFNECESKTANCSAYATCYNTFGSYKCICQNGY--------EGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTE 16087
            C    ECF S   G  +C+C KG+ +  AD           +DEC+ G + C  + DC++    Y C C++G+    L+        C   + C +   +C+A A C  T     C C +GY           G +C  + +      + +CS H        ATC+D ADG FTC C +
Sbjct:  626 CDPVAECF-SEQPGYFQCQCPKGFTDSSADKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRSPGRSCKKADMCSN--IDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPAGRVCRAV-VNECAEGRHDCSSH--------ATCIDTADG-FTCRCKD 792          
BLAST of SMED30010561 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 214.542 bits (545), Expect = 1.441e-54
Identity = 285/996 (28.61%), Postives = 405/996 (40.66%), Query Frame = -1
Query: 2552 CGNHAFCKIENGRADCFCDSGYYG--DGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSES--CATNGECQNTIGSFKCECKDGFIGDGKYDCRI------DSKCEKYGGCHE-DASCIVNVESSIYEC-QCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVC-----GDGAV------------------YVDDI------------------------------CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCE---------CQSGYKGTGWFCIK---QTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSP----DFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRN--ECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCE-DIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGY------------VKIPGTQICLNK-NECLNPVENDCVENAICIDTEGSYECRCKSGFKQ----LPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGF 5236
            CG  A C+   G   C C+ G+ G    + CVDVDEC+ GD +C  ++ CQN  G + C C  GF++ ++     SC DIDEC    S  C  N +C N  G++ CEC++GF+GDG Y C        DS       C E + SC V+      EC +C   +   G   C   N C    K+ C  NA C  +N T+ C C  G++GDG+  C DI+EC  D  H C    +C N  G + C C     GDG                     VD +                              CVDIDEC  ++ N   ++A+C N EG+Y C+CAEG+ G+G +C DIDEC  G+A C   A+CIN+ G+  C+C AG  G+G TC   +E  +PK    A   + + +C+ +    T +         C  G+      C        C   N C  +  C   + +S   C C   F  +   C    EC N    CD E + C      F C C  GF  V   C    +  P       D        SG     TKG       Q       +   P  S     +  +++ E   S+  +     C                      +C + ATC    G  VC C D    D    AC+ ++  +C   P +C D +KC N+  +  C+C  GY  +G  C     +C ++ + C   A C N     +C+C PGFTGDG+  C+      A +  +C   ++C  +G    C C  GY   N + C+ D          +CV     CH  A C  N  +  C C S  +G+G  +C  Q  C  +   C  N + C         L    C C +G+             K P  Q  L+  + C+ P ++      +CI    S EC CKSGF++      S  C +I+EC EKS  C   + C++      C C  G 
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDG----SCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG-YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKV-CEDINECVAE-KAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINEC--DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDS-HFCSCPDGFIGDGMICDDVDEC-NNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLC-------------------STVTCHSLATCEQSTG--VCICRDGFIGD-GTTACSKKSTADCISLPSLCADKAKCDNS--TRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNR----RCQCLPGFTGDGV-KCVSIHE-RASNCSQCDANAHC--VGG-TTCKCNPGYF-GNGLCCVPDPL--------DCVHFTGICHPNAVC--NSESRQCQCSSGFSGNG-VSCFPQKSCRTDKSVCAKN-AIC---------LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSS---TQLCI----SGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH 2318          

HSP 2 Score: 197.593 bits (501), Expect = 1.865e-49
Identity = 306/1117 (27.39%), Postives = 453/1117 (40.56%), Query Frame = -1
Query: 1724 DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSG-DGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDE--CSSNQTNK---CSSNAICQ--NKEGTYSC-QCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQ------------TCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCN-------------QEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTC-QCIEGFQRINGSCVDVD---ECADKIDSCKNNATCNNM-IGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDG------IYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQC---HCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNC-EDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNS-CGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS----DGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCI-DVDE------CSLDQVS-SLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTK 4882
            ++KC     C  DA C    E     C+C   F G     SC+  + C   G  +CHE+A C+     Y C CP GF+      C DIDEC   N+  C +  KCVN  G Y+C C +G +     CV   +  C S Q++K     SN  C+    +G+  C +C  G+   G +C DI+EC    A CS NA C+N  GTF+C C+ G  G+G  C D +EC +         C  +A C N +  + CEC SG++G G   IK+    +  +C+  +            +    N +  ++CEC+P F+ E +  +C+   ECE   +NCD  ++ CV  +  ++CEC  G+   G  C D +ECD      A    +A    C+N  GS  C C              +E+   + ++C   D  +     C+ + + C   ++    C  C+ G   ING+C  +     CA K D C  +A C ++   S+ C CPD    D     C D +EC    M   + +KC NT GS+ C C+ G+K     C  +DE   K  P  +         S     Q   T  G      I    E  + PA        G Y              G E + + E +      +   +   VT    CH  A C  + G  VC C     GDG T C  ++     T  C    S C +     N     +C   +  +GYV  P  Q C+ ++       N C   A+C +      C+C  GF      KC +I+E       C  N+ C     G +C+C PG+  +    L C  D  +C + T     P+++C  N  S +C C  GFS  G  C     C    S C +N++C  T S   C C +G +  P   C              +++   +   DL    +CV P                         C +S   C+    S +C+CK GF +NS       C D DEC  +E+S+ K      C NT G   C CP+G + +   C+  V++      C  D ++  L +      G           YC++ F  + NS K
Sbjct: 1392 NTKCTSSDECGLDALC----ERRTGVCRCEPGFEGAPPKKSCVDVDEC-ATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH------PCHPHAECTNLEGSFKCECHSGFEGDG---IKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECD---RGMAGCDSMAM---CINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTAC--TDEWSR---LCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKND-CNKHAECIDIHPDSHFCSCPDGFIGD--GMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV-VDE---KKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPS--NGGY--------------GEETNQEEEQVTSTTTTEAPSLCSTVT----CHSLATCEQSTG--VCICRDGFIGDGTTACSKKS-----TADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRD-------NLCSPEAVCQN----RRCQCLPGFTG-DGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGN---GLCCVPDPLDCVHFTGI-CHPNAVC--NSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGS---CICRHGFKGDPFYKCS------------SLVSKEPANQQDLSDVSSCVTP-------------------------CDSSTQLCI----SGECICKSGFRRNSTLSGSETCADIDEC--AEKSH-KCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRK 2381          

HSP 3 Score: 184.882 bits (468), Expect = 1.345e-45
Identity = 288/1064 (27.07%), Postives = 421/1064 (39.57%), Query Frame = -1
Query: 1484 GAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQT--PCDVPNACKANQTCTPSN--------ENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSK-CLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQ-------MECIGDVCYKKCSDIDECVTRKSACHKFAECTN-NDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFK---WSDETNLNCEDIDECTN---PTSCSSMP-HSICMNNPGSFECVCPHGFSLQGGYC---NDINECL-IPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS------DGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCI--NTVGGFQCYCNRGFVMIE--NSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY---DLVNGK--CTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSG 4531
            GA   +D  V+  +C+S  +++C  +A+C+ + G   C+C  GF G      C D+DEC  G  NC E+A C N  G +AC C  G    +  +C D DEC +   +     C  NA C NK   Y+CEC++G+ G G+ C+  T  PCD   + K++  C+ SN        + S+   EC   +K     C    EC  +   C    +NCV ++  F C CK G+   G  C D NECD   P     +C        N +GSF C C+     +             G+  C   +E          +C+ +E F      C  VD       SC +    N  + S VC+C    + +    +C D +EC+E+   C   S  C+NT+GSY C+C  GY+  G  C DIDEC      C  +A C N  GSC CKC  G+TGDG  +CI+ +  P  D   C T  +  +        CT   E+  Q          I   C  +   I     +K+ C+K AEC + +  ++ C+CP    GDG   C+D +EC      C+   + CE      N +  F C C  G+ K+   + C+   +     E   ++      +    E     G +  PS                      Q  A+ F+    P      + +ETN   E +   T    P+ CS++  HS+      +  C+C  GF   G          +C+ +P+ C   + C N+    +C C  G      GD  + +   ++      L   ++VC +      C C  GF  D V    C + +E   N   C A N+ CV   G   C C PG+  N         DCV +             C+     N+     C C  GF  N   C     C  D+     +      G CI  +   G   Y     V  E  N     D+  C  P      LC     S EC+C  G+     ++G   C DI+EC+  S  C       C N  GS  C C  G+   G
Sbjct: 1381 GAPQANDSSVENTKCTS--SDECGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC----CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSH--CSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSL-NANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECT-------NLEGSFKCECHSGFEGD-------------GIKKCTNPLE---------RSCEDVEKF------CGRVDHV-----SCLSVRIYNGSL-SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGA-TCIKIEEEPKSDKTAC-TDEWSRLC-ELEKKQCTVDEEEVPQCGACLPGHHPINGTC--QSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDG-MICDDVDECN-NAGMCDDENTKCE------NTIGSFNCVCLEGFKKV--DEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPS---------------------IQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTR--SCECDAGYI----GDGYVCSPHPQDCVLRDNLCSPEAVCQN----RRCQCLPGFTGDGV---KCVSIHERASNCSQCDA-NAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHF----------TGICHPNAVCNSE-SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCI----SGECICKSGFRRNSTLSGSETCADIDECAEKSHKC--DRVATCRNTFGSHVCTCPDGHVGDG 2322          

HSP 4 Score: 166.777 bits (421), Expect = 4.181e-40
Identity = 267/1019 (26.20%), Postives = 401/1019 (39.35%), Query Frame = -1
Query: 1220 TKGSFVC---TCNQEQMNEN---NSSCKPIDSCAMGLDN-CDRKVEDCISSKDSSYTCQCIEGFQRI--NGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQE-NPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDEC------AIKTHPCHDLARCS--NVPGSCKCK-CQPGFTGDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNT-------VNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKW-------------------SDETNLNCE------DIDECTNPTSCSSMP--------------------------HSICMN-NPGSFECVCPHGFSLQGGYCNDINECLIPNSC-GQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQV--------LNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCE--------NQNECEINIHSCQASNSECVDT---------YGSFKCVCKPGF--------SKNSDGDCVDYDECEISEQSNMKFC-NNGKCINTAGGFTCDCPEGFIYNNY-------DCIDVDE-CSLDQV----------------------SSLADNCDQ--VNGHCINTVGGFQCYCNRGFVM-----IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSN-AQCV---DRSNGY----ECICKDGYQEDQI----GICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIV 3784
            TK +F     T    Q N++   N+ C   D C  GLD  C+R+          +  C+C  GF+      SCVDVDECA    +C  +A C N +G Y C CP   +      +C D +EC E N   CG  +KC+N  G+Y C+C  G+  +G  C    +       + K+H       C    V GS +CK C  G+   G   C + + C A +   C   + C NM G F  C+C  GY     M          C+DI+EC  R   CH  AECTN +G++ C C S   GDG   C +  E      +C     +C  +D+         N      C C  G+     +  C++ +EC     N    +A+C++TEGSY C C  G+ +   G C +I+EC+     C   ++C ++     C+C  G+                     +DE +  CE       +DE   P   + +P                          H+ C++ +P S  C CP GF   G  C+D++EC     C  +N+ C NT+  FNC C  G +++ +  C +  +   N ++ ++         +G +        G   + P   +     P            NQ E ++   +   + S C              +  C+C+ GF        SK S  DC+          S    C +  KC N+    +C+C  G+I + Y       DC+  D  CS + V                         A NC Q   N HC   VGG  C CN G+       + +   CV       PN+    +CN+   S +C C+ G+      C     C  +  +C   A  IC+       C C  G++   G  +  C S+      N    S+ + CV   D S       ECICK G++ +        C +I+EC +    C  +A C +T GS+ CTC  G+ GDGI 
Sbjct: 1369 TKDTFALPTTTTGAPQANDSSVENTKCTSSDEC--GLDALCERR----------TGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFR-KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKV-CEDINECVA-EKAPCSLNANCVNMNGTF-SCSCKQGYRGDGFM----------CTDINECDERH-PCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLE-----RSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-EGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKV-DEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCI----------SLPSLCADKAKCDNST--RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNA----VCNSE--SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNA--ICLPTG---SCICRHGFK---GDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2324          

HSP 5 Score: 164.466 bits (415), Expect = 2.200e-39
Identity = 262/976 (26.84%), Postives = 379/976 (38.83%), Query Frame = -1
Query: 5651 CSNDAFCDFKDDDYGCHCKNGFMG--DGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF-EGNGVTCTNINECYPL-SPCDNATEECFDKVPGYECRCQKGFMKN------TTTGNCDD----RNECADTGNLCDRVSTNCNNTFGSYRC-DCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCG-ENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDE------------------------------------CLLGLH-------------------NCSRSHQFCFNVNGGFE-CRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNC------------------------DPQEGLEECGKL----LCPLNALCVNSTCLCKS--GYENSTNQ----CINTDECE-----SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG---DCYDGICHCPSGFVFKSNKC--FDERC---ENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLS--QCNQSCPTGQYCNNGS--CSCLMGLNS-----------QTDDDGNLNCSKNSASCLPG-------------------------------------ICPLNANCEERLFGYICKCKPGYEG----VGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGY 8053
            C  DA C+ +     C C+ GF G      C D+DEC+     C  +A C+N +G ++C C  GF + +  +C +I+EC    S C  A  +C +K   Y C C+ GF+ +      TT   CD     ++ C+++   C+      +   GS  C +C  G++ S     VC D+NEC          A C N  G++ C+C  GY+GDG  CTDI+EC     C  P A C NL GS++C C  G  G DG       +CT P E                     CED+++     +  +    +  N   S  CEC  G+R    +  C +I+EC ++ + C   +A C++T+G Y C+C  G+ G    C DIDEC   +  CDS  A C N +GS  C+C  GY+GDG+ C +I+E                                    CL G H                   +C++ H  C +++     C C  G+  D    C D +EC       D+N  C NT GSF C+C  G+      C                          QE     GK     + P   +         S  GY   TNQ      +T   E     S  +C   A C  + G  +C C +G+IGDG     K +  D   + + C D    D     C C +G++     C    + C   +N+C   A+C       +         + D  +C+ I E   N   C  N+ C    G   CKC P Y   F +G  C+  PL        C     CN+ S  C C  G +            +TD      C+KN A CLP                                      + P +++ +  + G  C CK G+       G ++C DIDEC  K + C     C NT GS  C+C  G+
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCE-----VDTVDGSVECKECMGGYKKS---GKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCH-PHAECTNLEGSFKCECHSGFEG-DG-----IKKCTNPLE-------------------RSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDS-MAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNK-HAECIDIHPDSHFCSCPDGFIGD-GMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTG--VCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPG------FTGDGVKCVSIHERASNCSQCDANAHCV---GGTTCKCNPGY---FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKS---VCAKN-AICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGE-CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH 2318          

HSP 6 Score: 127.487 bits (319), Expect = 3.235e-28
Identity = 131/398 (32.91%), Postives = 177/398 (44.47%), Query Frame = -1
Query: 6359 NCTDIDECSSNKVCQRPDATCVNLPG----SYECRCLDGTPGCDGDNPCN-TVQCTKPNEICYLG--QCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXX---XXXXNLHQCGE-NAEC-IDT-DGGYYC-QCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVD--ENECRFFDNGCD--DNADCI-----NTDGSFLCICRAGYI--GSGRNCDPQEGLEECGKLLCPLNALCVNS----TCLCKSGYENSTNQCINTDECE-SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFK 7462
             CT  DEC  + +C+R    C   PG      +  C+D      GD+ C+ + +C       Y+G   CFC  GF+       C+DIDEC    + C G  AKC N  G+Y CEC  G+       +            +   C E N  C +DT DG   C +C  G+      C DI+EC      C S  A C N  G+F+C C +GY GDG +C++I+EC    H C   H  C N+ G F+C C SG++ D    C +  E  C   +  C   D+  C+     N   S +C C  G+       +C   +  EE      P +A+CVN+     C C  GYE     C + DEC+     CD  A CI+  GS  C C  GY GDG  C K
Sbjct: 1394 KCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN-----YVGGYACFCPTGFR-KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPC-SLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE-RHPC-HPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK 1782          

HSP 7 Score: 121.709 bits (304), Expect = 1.918e-26
Identity = 144/500 (28.80%), Postives = 207/500 (41.40%), Query Frame = -1
Query: 5669 HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS------VCSEIDECLLGLHNCSRSHQFCFNVNGGFEC--RCLSGYKSDTNGSCVDENECRFFD-NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTNQCINTDECESQ-TSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQE-NSICFNRFGSYDC--------KCPPNYLDVFKDGKVCMAVPLSQCNQSCPTG----QYCNNGSCSCLMGL---NSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC 7069
            H C   A+C +T G Y C+C  G+ G+  EC DIDEC+  L +   + + C N  G++ C C +G++  G+       C++I+EC  G HNC  + + C N  G F+C  +C  GY+   +G C D NEC     + CD  ADC+NT G + C C  G+ G G+NC P+    +    +C  +A C  V   C CK+GY      C + +EC+++ T C     C++  G ++C C  G   D   C K   D  A     +C+ G      C +  C C  GF    +K                                      +C+DI+EC EN   C      C N FG + C        +C                   +   +    G    Q  + GS +   GL   + +    G L C+          CP N+ C     G  C+C  GY G  +  C DIDEC  +I N   NE C N  G F C
Sbjct:  140 HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRK-NSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQ--DDATCIK---DQGA-----FCSGGCGDNAICSNATCACIDGFRGDPHK--------------------------------------KCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTS--------YCPPNSEC----VGGYCECVSGYGGNALVGCEDIDECITEICNIEANEWCVNLIGGFVC 575          

HSP 8 Score: 117.472 bits (293), Expect = 3.126e-25
Identity = 144/500 (28.80%), Postives = 200/500 (40.00%), Query Frame = -1
Query: 6764 TCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDK-----VPG-YECRCQKGFMKNTTTGN----CDDRNECADTGNLCDRVSTNCNNTFGSYRC--DCKYGFRPSPIDSFVCTDVNEC--NLVHECDKNYAKCTNTPGSY---------------------------------------YCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCT------KPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH---------QCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNGGFEC 8056
            TCS    C +      C+C +GF G     +D +EC  +   C   A C+NT+GS+ C C  G+EGNG  CT+I+EC      D  T  C +      +PG Y C C +GF      G+    C D NEC    + CD     C N+ GS++C   C  G+    +    C DVNEC    +H+CD   A C NT G Y                                        C C +GY GDG  C DI+EC +          C+NL G Y C C +G      D  C   Q          N IC    C C  GF+ +     C DI+EC    + C G   +C NL G ++C C +G   +       + +    + H         Q  E +  I T  G       G        +D++        C S        +G + C C  GY G+  V C +IDEC+  + N   ++++C N+ GGF C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS-----DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYE---LIDGKCEDVNECGSEKLHKCDVR-ADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNG----QDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIP-----KDVELTTSGRLACTSYCPPNSECVGGY-CECVSGYGGNALVGCEDIDECITEICNI-EANEWCVNLIGGFVC 575          

HSP 9 Score: 115.546 bits (288), Expect = 1.390e-24
Identity = 148/499 (29.66%), Postives = 206/499 (41.28%), Query Frame = -1
Query: 6404 RCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPD-ATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYEC--ECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGF---------------------------------ECRCLSGYKSDTNGSCVDENECRFFDNGCDDNAD-CINTDGSFLC--------------------------------------------ICRAGYIGSGRNCDPQE-GLEECGKLL----CPLNALCVNSTCLCKSGY-ENSTNQCINTDECESQTSCDVNAN--CIDTHGSFIC 7633
            +C C  GF  S  +     D NEC L H C    A+C NT GSY C C  GY+G+G  CTDIDECS     + P+ + C+NLPG+Y C C  G                           F   G Q +   + C DI+EC+T A++C   +  C N  GS++C  +C  GY +    K  +      + LH+C   A+C++T GGY C+C+ GF G    C+    C  +   CD   A+C   I    C C  GY+GDG  C +I+EC      CS   + C N++GG+                                  C C+ G++ D +  CVD NEC   D+ C    D C+N  G F C                                                G I   R   P++  L   G+L     CP N+ CV   C C SGY  N+   C + DEC ++  C++ AN  C++  G F+C
Sbjct:  117 QCYCDSGFSGSACE---LQDKNEC-LEHPCHM-MAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQG---------------------------FTPKGNQGS-GLDKCADINECETGAHNCDADEI-CENSIGSFKCVNKCSPGYELID-GKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDR-HASCH--IVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGR-CLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 10 Score: 110.538 bits (275), Expect = 4.581e-23
Identity = 159/529 (30.06%), Postives = 215/529 (40.64%), Query Frame = -1
Query: 3482 SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCE-KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF-----QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCV--CGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-NDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDK------NECDPTSPDFAAQ-KCLASGGGCLNTKGSFVCTCNQEQMNEN-----------NSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLD 4981
            +C+  G C       +C C  GF G     C +  K E     CH  A C   + S  YEC+C   + G+G   C   + C     S C E++ C  +  TY C C  GF     QG G + C DI+EC     HNC + E C NS G + CV  C  G   +D  C D++EC S + +KC   A C N  G Y C+C EGF GDG  C     C+   A C  +A C        C+C+ G  G+G TC D +EC   K +P    C +   C N D GY C C++G       CIK         C  N  C      S A C C   F+ + +  C+   EC      C      CV L  GFKC C+ G       C D+      +       DF    + +  G G + T      T  +  + ++            S C P   C  G                    C+C+ G+    + G C D+DEC  +I + + N  C N+IG +VC  P N   D
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSA---CELQDKNECLEHPCHMMAQCQNTLGS--YECRCLPGYEGNG-HECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECET-GAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC--HIVLDICDCKTGYTGDGITCHDINECDA-KDTP----CSDGGRCLNLDGGYVC-CKNGQDDA--TCIKDQGAFCSGGCGDNAIC------SNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEA--ECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY-------------------CECVSGYGGNALVG-CEDIDECITEICNIEANEWCVNLIGGFVCCNPTNATHD 584          

HSP 11 Score: 107.842 bits (268), Expect = 2.994e-22
Identity = 84/244 (34.43%), Postives = 117/244 (47.95%), Query Frame = -1
Query: 1214 CDCPEGF--IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSC---LDGLCNNLPGSFECLCNIGYDLVNGKCTDINEC------SNNSQICGPQAAGICINAAGSFQCK-CNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSC 1909
            C C  GF        C+DVDEC+         NC + +  C N VGG+ C+C  GF   ++ + C DIDEC   NS     +  C N PG++ C C  G+     +C    +       S+ S       +       GS +CK C  GY+ SG      C+ +NECV     C  NA CV+ +  + C CK GY+ D   +C +INEC     CH  A+C + +GS+KC C  G++GDGI  C
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGD-----HNCHE-SARCQNYVGGYACFCPTGFRKADDGS-CQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSG----KVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKC 1645          

HSP 12 Score: 104.375 bits (259), Expect = 3.129e-21
Identity = 120/357 (33.61%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 1142 VNDEVFPQVCENQNECEINIHSCQAS---NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENS----TKCVDIDECQ--FPNSCLDGLCNNLPGSFECL--CNIGYDLVNGKCTDINEC-SNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDS-CHYLADCLDTDGSYKCTCKYGYK-----GDGIVSCKAICGPNSCLPGQLCQIVNGNQYD 2158
            ++DEVFP  CE         H CQ++      C+      +C C  GFS  S  +  D +EC +    +M      +C NT G + C C  G+  N ++C D+DECS      L   C + +  CIN  G + C C +GF    N      KC DI+EC+    N   D +C N  GSF+C+  C+ GY+L++GKC D+NEC S     C  +A   C+N  G ++C+C  G+E  G      CQ  + C K +  C  +A C    +   C CK GY  D I  C +INEC  +D+ C     CL+ DG Y C CK G        D    C   CG N+      C  ++G + D
Sbjct:   87 MHDEVFP-YCE---------HKCQSTCSGKGACLYDGAKPQCYCDSGFS-GSACELQDKNEC-LEHPCHMM----AQCQNTLGSYECRCLPGYEGNGHECTDIDECS----DKLTSRCPE-HSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRAD--CVNTIGGYECECEEGFEGDGKN----CQPKSSCRKNSAICDRHASCHIVLD--ICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGD 412          

HSP 13 Score: 104.375 bits (259), Expect = 3.129e-21
Identity = 129/475 (27.16%), Postives = 191/475 (40.21%), Query Frame = -1
Query: 5018 SDSSQCIDIDECNENVDDC-QENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSK---------------NSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEG---------------------------------------------------SFTCSCKRGYSRNSSSGLC-------ETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNEC-QTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDKCKTKALQC--QAGEVCKLSLYGSVCEKISCNSSEILINN--ECLP----VNQVCQNI----------NCGNHAFC-KIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTD 6148
            +D   C DIDEC E+   C   N+ C N+ G+Y C+C   +L    DG  C+      C+ +  +  +C+  + SC +        DG++ C +               N        C LNANC      + C CK GY G G   C DI+EC  + + C  + +C+N EG                                                   S  C C+ G+     S  C       E+ N C+  S  +C     +Y C+C  GYE    G+C D++EC +  + C  +A CIN  GS  C+C   + GD       E++ K+    C  +   +C+L       EK  C   E  +     CLP    +N  CQ++          +C  HA C  I      C C  G+ GDG +C DVDEC+N  +    N+ C+N  GSF+C C  GF++++   V D
Sbjct: 1466 ADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLG---DGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-----DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFM-CTDINECDER-HPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPAS-AVCVNTEGSYRCECAEGYE-GEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCEL-------EKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVD 1921          

HSP 14 Score: 98.9821 bits (245), Expect = 1.293e-19
Identity = 118/357 (33.05%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 2420 DRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIK-THPCHDLARCSNVPGSCKCKCQPGFT-----GDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCN-CTNGYEDSNQMECIGDVCYKKCSDIDECVTRK-SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQI-CLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHG 3460
            D+NEC E+P  C  +++C NT GSYEC+C+ GY+ NG  C DIDEC+ K T  C + ++C N+PG+  C C  GFT     G G+  C + + C       C     C N IG+F   N C+ GYE          +   KC D++EC + K   C   A+C N  G Y C C     GDGK  C+ ++ C   +  C+ + S    LD          C C  GY    G  I C + NEC +  +  C +   C++ +G Y C CK+G       K    ++    S  C  N++C +     +C C  GF+   + +  C DI+EC    S        C+N  G F+C C HG
Sbjct:  133 DKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAH-NCDADEICENSIGSFKCVNKCSPGYE----------LIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGK-NCQPKSSCRKNSAICDRHASCHIVLD---------ICDCKTGYT---GDGITCHDINEC-DAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIK----DQGAFCSGGCGDNAICSNA----TCACIDGFRG--DPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 15 Score: 95.1301 bits (235), Expect = 2.160e-18
Identity = 100/289 (34.60%), Postives = 135/289 (46.71%), Query Frame = -1
Query: 3890 KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGF-----YGDGL-LCHDIDECKFGVANCSENALCINKPGTFAC--ECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA-CKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPG 4729
            +S+C     C    A  +C C  GF G       D +EC     H C  + +C N+ G Y C C  G       C DIDECS   T++C  ++ C N  GTY C C +GF      G GL  C DI+EC+ G  NC  + +C N  G+F C  +C  G       C D +EC    GS    +CD  A C N   GY CEC+ G++G G  C  ++ C   +A C  + +C       L IC+CK  +  +  TC    EC+ K   C  +   C+ LD G+ C CK G
Sbjct:  100 QSTCSGKGACLYDGAKPQCYCDSGFSGSACEL-QDKNECLE---HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNEC----GSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC----HIVLDICDCKTGYTGDGITCHDINECDAKDTPC-SDGGRCLNLDGGYVC-CKNG 374          

HSP 16 Score: 87.8113 bits (216), Expect = 3.269e-16
Identity = 62/174 (35.63%), Postives = 83/174 (47.70%), Query Frame = -1
Query: 15758 TSGCVCNDGFLRSGTTCTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECR-CKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNG 16276
            T  C C +GFL  G  C P  +  C   D+              S+K+ CS +N               C   T  G  EC+ C  GY+     C DI+EC      CS N +CVN  GT++C CK G+ G+G  CTD NEC+ +   C  +A C N  GS+KC C +G+EG+G
Sbjct: 1497 TYSCECENGFLGDGYQCVPTTKKPC---DSTQ------------SSKSHCSESNM-------------SCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHP-CHPHAECTNLEGSFKCECHSGFEGDG 1641          

HSP 17 Score: 85.5001 bits (210), Expect = 1.747e-15
Identity = 115/388 (29.64%), Postives = 164/388 (42.27%), Query Frame = -1
Query: 5441 CLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC--QIENYCTD--------GDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDC--KCPPNYLDVFKDGK-----VCMAVPLSQCNQSC----PTGQYCNNGSCSCLM-GLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN--CGSHGICGPNYICQCKSGYEINPSGMCQDVNEC-QTQSPCHILA-QCINTPGSYKC 6526
            C C SG+  S  +  + +EC  +  C + A C +T GS+ C C  GY G+G  C    TD D C  ++ + C +        G  Y   C+C  GF  K N+                                  S   +C DI+EC     +C  + IC N  GS+ C  KC P Y  +  DGK      C +  L +C+         G Y           G N Q       +C KNSA     IC  +A+C   +   IC CK GY G GI +C DI+EC  K   C+    C N +G + C CK G  ++ ++ + +    C+  CG + IC  N  C C  G+  +P   C D+NEC +  S C  +  +C+N  G +KC
Sbjct:  118 CYCDSGFSGSACELQDKNEC-LEHPCHMMAQCQNTLGSYECRCLPGYEGNGHEC----TDIDECSDKLTSRCPEHSKCINLPGTYY---CNCTQGFTPKGNQ---------------------------------GSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELI--DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKS----SCRKNSA-----ICDRHASC--HIVLDICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNG--QDDATCIKDQGAFCSGGCGDNAICS-NATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 18 Score: 84.7297 bits (208), Expect = 2.841e-15
Identity = 151/590 (25.59%), Postives = 218/590 (36.95%), Query Frame = -1
Query: 1646 DIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV----KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYEC--RCKSGFKQLPSGKCENINEC-EEKSDNCSINSVCQDKADGFS---------------------------------------CQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHG------FSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDE-----------------------------------------------VFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDV------------DECSLDQVSSLADNCDQVNGHCINTVGGF---QCYCNRGFVMI-ENSTKCVDIDECQFPNSCLD----GLCNNLPGSFE 3055
            D +EC+  +  CH  A+C N  G+Y C C     G+G   C D +EC+      +  TS C      +N+   + C+C  G+     +  G   C + NEC     N C  + IC ++ GS++C  +C  G+ +L  GKCE++NEC  EK   C + + C +   G+                                        C CK G+       + C DI+EC    T CS      C+N  G + C C +G         QG +C+          CG N++C+N      C+C +G R  P+  C  INEC+EN   C    G    C +L  G+ C C  G    E                                               + P+  E      +   S    NSECV  Y    C C  G+  N+   C D DEC I+E  N++   N  C+N  GGF C  P    ++  DCI++            +E ++    S     DQ+    +     F   Q    RG V   E  T+  D DE     S  D    G    LP + E
Sbjct:  133 DKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHE-CTDIDECS------DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHN-CDADEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGD---GITCHDINECDAKDTPCSDGGR--CLNLDGGYVC-CKNGQDDATCIKDQGAFCS--------GGCGDNAICSNAT----CACIDGFRGDPHKKCVDINECVENDSVC---GGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY----CECVSGYGGNALVGCEDIDEC-ITEICNIEA--NEWCVNLIGGFVCCNPTNATHD--DCIEITKEKGLHVIGGNEEDTVVATRSNHSTSDQLITQVVQQSRNFSTGQIILTRGKVSSGEAVTQTTDADEFGLEISAADLAGSGSGITLPTTLE 680          

HSP 19 Score: 83.1889 bits (204), Expect = 7.322e-15
Identity = 119/372 (31.99%), Postives = 159/372 (42.74%), Query Frame = -1
Query: 2828 KCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGS----CVDVDECADKIDSCKNNATCNNMIGSYVC--KCPDNLKLDLSKKACTDRNEC-QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENL-DNTVNVLAPFQC 3910
            +C C  GF+      QDKNEC        AQ        C NT GS+ C C       N   C  ID C+  L +   +   CI+    +Y C C +GF  +   GS    C D++EC     +C  +  C N IGS+ C  KC    +L   K  C D NEC  E    C   + C+NT G YEC+C  G++ +G NC+    C   +  C   A C  V   C CK   G+TGDGI +C + + C A+ D  C  G  C N+ G ++ C   NG +D+  ++  G  C   C D              A C+N      C C     GD    C D NEC         N S C  + D  VN+   F+C
Sbjct:  117 QCYCDSGFSGSACELQDKNECLEHPCHMMAQ--------CQNTLGSYECRC-LPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLP-GTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGK--CEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKT--GYTGDGI-TCHDINECDAK-DTPCSDGGRCLNLDGGYVCCK--NGQDDATCIKDQGAFCSGGCGD-------------NAICSN----ATCACIDGFRGDPHKKCVDINECV-------ENDSVCGGVGDRCVNLFGGFKC 446          

HSP 20 Score: 80.8777 bits (198), Expect = 3.880e-14
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = -1
Query: 15632 CRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNEC-ESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC---SQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTC 16036
            CRC+ G+EG     +C D+DEC+ G + C ++  C N +G Y C C TGF   +  +C D +EC E  +  C A A C N  G+Y C C+NG+ G+G  C   ++ P  +    +++CS   + SC+     VD  DGS  C
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCS-ESNMSCE-----VDTVDGSVEC 1549          

HSP 21 Score: 78.9518 bits (193), Expect = 1.682e-13
Identity = 135/502 (26.89%), Postives = 193/502 (38.45%), Query Frame = -1
Query: 1256 CMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNG-DCELINECLENI-DRCQVLNGADSVCYDLPIGYACVCPDGFV---NDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCV--CKPGFSKNSDGDCVDYDECEISEQSNMKFCN-NGKCINTAGGFT---------------------------------------CDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSCLD-GLCNNLPGSFECLCNIGYDL-VNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVG------------------------YENSGGKSYNPCQSVNECVKLNIT-----------------------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLAD--CLDTDGSYKC 2464
            C+ +    +C C  GFS       D NECL  + C   + C NT+  + C C  G     NG +C  I+EC + +  RC       S C +LP  Y C C  GF    N       C + NECE   H+C A +  C ++ GSFKCV  C PG+ +  DG C D +EC       +  C+    C+NT GG+                                        CDC  G+  +   C D++EC         D      G C+N  GG+ C C  G    ++   C+  D+  F    C D  +C+N      C C  G+    + KC DINEC  N  +CG      C+N  G F+C C  G                        +  +G +      S+      +IT                       CP N++CV    GY C C  GY  + +  C +I+EC I + C+  A+  C++  G + C
Sbjct:  109 CLYDGAKPQCYCDSGFSGSACELQDKNECL-EHPCHMMAQCQNTLGSYECRCLPGYEG--NGHECTDIDECSDKLTSRCP----EHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDA-DEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECG---SEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDA------KDTPCSDGGRCLNLDGGYVC-CKNG----QDDATCIK-DQGAFCSGGCGDNAICSNA----TCACIDGFRGDPHKKCVDINECVENDSVCG-GVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECV---GGY-CECVSGYGGNALVGCEDIDEC-ITEICNIEANEWCVNLIGGFVC 575          

HSP 22 Score: 78.1814 bits (191), Expect = 2.803e-13
Identity = 59/173 (34.10%), Postives = 90/173 (52.02%), Query Frame = -1
Query: 7610 LECTNIT--CSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGV-TCTNINECYP------------LSPCDNATEECFDKVPGYECRCQKGFMKNTT---TGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF 8074
            L+C + T  C  +A C+   +   C C +GF G+G+ C     C  + SVC  NA C   + + SC C+ GF+G+    C+++    P            ++PCD++T+ C       EC C+ GF +N+T   +  C D +ECA+  + CDRV+T C NTFGS+ C C  G 
Sbjct: 2156 LDCVHFTGICHPNAVCN--SESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC---LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISG----ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVAT-CRNTFGSHVCTCPDGH 2318          

HSP 23 Score: 77.0258 bits (188), Expect = 6.535e-13
Identity = 42/104 (40.38%), Postives = 56/104 (53.85%), Query Frame = -1
Query: 15740 SECRCKKGY--EGRADNCTDIDECSRGSYVCS-DNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16042
            S C C+ G+  E  +++C DIDEC      C   +  CVN  G+Y C C  G+ G G  CTD +EC+   A C + A C N  GS  C C  GY G+G+ C +I
Sbjct: 1680 SVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKI 1783          

HSP 24 Score: 76.6406 bits (187), Expect = 7.226e-13
Identity = 107/398 (26.88%), Postives = 139/398 (34.92%), Query Frame = -1
Query: 3380 CSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC--ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYV---------------------------------CKCPDNLKLDLSKKACTDRNECQENPMICGDLS-KCLNTDGSYEC 4465
            CS    C        C C  GF G      D +EC      C   A C N  G++ C C  G  GNG  C D DEC     S     C E++ C N    Y C C  G+                         TP       +           D C    ECE    NCD +   C      FKC  +C PG+ ++   C+D NEC          KC      C+NT G +     +E    +  +C+P  SC      CDR    C    D    C C  G+     +C D++EC  K   C +   C N+ G YV                                 C C D  + D  KK C D NEC EN  +CG +  +C+N  G ++C
Sbjct:  103 CSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTS----RCPEHSKCINLPGTYYCNCTQGF-------------------------TPKGNQGSGL-----------DKCADINECETGAHNCDAD-EICENSIGSFKCVNKCSPGYELIDGKCEDVNECG----SEKLHKCDVR-ADCVNTIGGYE-CECEEGFEGDGKNCQPKSSCRKNSAICDRHA-SCHIVLD---ICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 25 Score: 76.2554 bits (186), Expect = 9.448e-13
Identity = 109/362 (30.11%), Postives = 147/362 (40.61%), Query Frame = -1
Query: 5996 YCQCKTGFTGHCDEC---RDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCS-EIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNC--DPQEGLEECGKLLCPLNALCVNST--CLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGI----NCFKKD-------TDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM 7021
             C C+ GF G        +   +C  SL +  +D+A C+NS  S  C C+ GY GDG VCS    +C+L  + CS     C N      C+CL G+  D    CV  +E     + CD NA C+   G   C C  GY G+G  C  DP + +   G  +C  NA+C + +  C C SG+  +   C     C +  S C  NA C+ T GS  C C  G+ GD      +   K+       +D  +C      +   C  G C C SGF   S                                    S S  C DIDEC E    C   + C N FGS+ C CP  ++    DG  C+
Sbjct: 2019 VCICRDGFIGDGTTACSKKSTADC-ISLPSLCADKAKCDNSTRS--CECDAGYIGDGYVCSPHPQDCVLRDNLCS-PEAVCQN----RRCQCLPGFTGD-GVKCVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHFTG--ICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GS--CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTL----------------------------------SGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVG---DGITCV 2326          

HSP 26 Score: 70.8626 bits (172), Expect = 3.803e-11
Identity = 62/197 (31.47%), Postives = 95/197 (48.22%), Query Frame = -1
Query: 9254 GESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD--PVNSLVIGSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECS-LNSSICDANADCINTYGSYICNCKPGFRGSG 9829
            G  +S++   + S ++  SSA       +   T+LP ++   K  P  D   + +   G+   + S ++  +C T+  +C L A C       RC+   G++G          +SC+D DECA     C  ++ C N  G + C C  GF KA    C DI+EC+  NS+ C ANA C+N  G+Y C C+ GF G G
Sbjct: 1328 GTEESTLPPTEGSGESTTSSAP-----TVEPATVLPPQNRNEKPEPTKDTFALPTTTTGAPQANDSSVENTKC-TSSDECGLDALCERRTGVCRCE--PGFEGA------PPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG 1510          

HSP 27 Score: 69.3218 bits (168), Expect = 1.250e-10
Identity = 92/329 (27.96%), Postives = 121/329 (36.78%), Query Frame = -1
Query: 4889 LPGICPLNANCEERLFGYICKCKPGY-----EGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQS--PCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC 5854
            L   CP ++ C      Y C C  G+     +G G+  C DI+EC    +NC  +E C N+ GSF C                                 + +C  GYE+   G C+DVNEC ++    C + A C+NT G Y+C+C E F GD +N             CQ               K SC  +  +                C  HA C I      C C +GY GDG  C D++EC   D  C +   C N DG + C         +N     +C        S  C  N  C N      C C DGF GD    C
Sbjct:  180 LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKC---------------------------------VNKCSPGYELI-DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKN-------------CQP--------------KSSCRKNSAI----------------CDRHASCHIV--LDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC--------CKNGQDDATCIKDQGAFCSGGCGDNAICSNAT----CACIDGFRGDPHKKC 417          

HSP 28 Score: 66.6254 bits (161), Expect = 7.323e-10
Identity = 53/174 (30.46%), Postives = 70/174 (40.23%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLG---------------------------------------------GNEMYSNGRSCIDDDECALLKC---PSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D NEC    H C  HA CTNL+  F+C+C  G++G G                                             G        SC+D DEC   +    P+++ C NT GS+ C C  G+ +    VC DI+EC    + CD+ A CIN  GS  C C  G+ G G
Sbjct: 1606 DINECDER-HPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-EGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG 1777          

HSP 29 Score: 64.6994 bits (156), Expect = 3.120e-9
Identity = 49/179 (27.37%), Postives = 71/179 (39.66%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK---CPSTSDCTNTPGSFICNCHVGFV-------------------------------------------------KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D +EC+T  H+C   A C N   G+ C C  G++        ++  SC D DEC       C + + C N PG++ C C  GF+                                                 K +  VC DINEC    + C  NA+C+N  G++ C+CK G+RG G
Sbjct: 1430 VDVDECATGDHNCHESARCQNYVGGYACFCPTGFR-------KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDG 1601          

HSP 30 Score: 63.1586 bits (152), Expect = 9.589e-9
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = -1
Query: 15575 VCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 15961
             CS  G C+       C C +GF G+     D NEC      C   A C NT GSY+C C  GYEGNG  C+ I           CS    + C + + C++   G++ C+CT+G    G QG+    C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDI---------DECSDKLTSRCPEHSKCIN-LPGTYYCNCTQGFTPKGNQGSGLDKC 218          

HSP 31 Score: 60.077 bits (144), Expect = 7.531e-8
Identity = 49/142 (34.51%), Postives = 69/142 (48.59%), Query Frame = -1
Query: 14024 LPWSERQCNS--SYPGFCEYVNTPCAKDSDCNKDG--ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKT-----DFVRLNNGTCQNKLFCLGDADCAKSGKCFQNLCSCNLGFEGDGKLLC 14422
            +P +++ C+S  S    C   N  C  D+    DG  EC      C  G+K  G   C +INEC+ E  PCS+N NC + NG++SC+CK       F+  +   C  +  C   A+C      F+  C C+ GFEGDG   C
Sbjct: 1514 VPTTKKPCDSTQSSKSHCSESNMSCEVDT---VDGSVECK----ECMGGYKKSGKV-CEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFK--CECHSGFEGDGIKKC 1645          

HSP 32 Score: 58.5362 bits (140), Expect = 2.334e-7
Identity = 71/245 (28.98%), Postives = 96/245 (39.18%), Query Frame = -1
Query: 7613 CYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACG------------CLMSDGTYYANGEQRT---NENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEG------FEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYG 8284
            C N+  S  C  +C      +PGY L +G C     CG            C+ + G Y    E+      +NC  K  C+  +         C   A C    D   C CK G+ GDGI C DI+EC    + C     C N  G + C CK G       +  G  C+    C   + C NAT           C C  GF +      C D NEC +  ++C  V   C N FG ++C C++G
Sbjct:  237 CENSIGSFKCVNKC------SPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSA-------ICDRHASCHIVLDI--CDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCS--GGCGDNAICSNAT-----------CACIDGF-RGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 33 Score: 56.6102 bits (135), Expect = 8.843e-7
Identity = 48/166 (28.92%), Postives = 61/166 (36.75%), Query Frame = -1
Query: 9290 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA---LLKCPSTSDCTNTPGSFICNCHVGFVK-----AAPTVCNDINECSLNSSICDAN--------------------------------------------ADCINTYGSY 9631
            D NEC    H C + A C N    + C C+ G++G        NG  C D DEC+     +CP  S C N PG++ CNC  GF       +    C DINEC   +  CDA+                                            ADC+NT G Y
Sbjct:  133 DKNECLE--HPCHMMAQCQNTLGSYECRCLPGYEG--------NGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGY 288          

HSP 34 Score: 55.8398 bits (133), Expect = 1.356e-6
Identity = 54/200 (27.00%), Postives = 73/200 (36.50%), Query Frame = -1
Query: 15617 GESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN--------------CTD----FNECESKTA-------------------------------------NCSAYATCYNTF-GSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16048
            G   C C +GYEG    CTDIDEC RG   C     C+N++G+  C C  G+ G+G                CTD      E E K                                       +C+ +A C +    S+ C C +G+ G+G IC  +       D+ N        CD   T  ++  GSF C C EG
Sbjct: 1722 GSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV-------DECN----NAGMCDDENTKCENTIGSFNCVCLEG 1910          

HSP 35 Score: 55.4546 bits (132), Expect = 1.729e-6
Identity = 43/141 (30.50%), Postives = 56/141 (39.72%), Query Frame = -1
Query: 15767 CFNSTASGESECRCKKGYEGRADNCTDIDEC-SRGSYVCSDNGDCVNQLGTYN---------------------------------------CLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16069
            C NS  S +   +C  GYE     C D++EC S   + C    DCVN +G Y                                        C CKTG+ G+G+ C D NEC++K   CS    C N  G Y C C+NG +
Sbjct:  237 CENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQD 376          

HSP 36 Score: 55.0694 bits (131), Expect = 2.740e-6
Identity = 70/246 (28.46%), Postives = 91/246 (36.99%), Query Frame = -1
Query: 15575 HAVDSCHLRDTSGCVCNDGFLRSGTT-CTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCT-DIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 16306
            H++ +C  + T  C+C DGF+  GTT C+ K    C            I     C+ K +C                     NST S    C C  GY G    C+    +C     +CS    C N+     C C  GF G+G+ C   +E  S  + C A A C    G   C C  GY GNG  C         PD  +C  H    C   A C      S  C C+ G  G+G+    Q  C
Sbjct: 2008 HSLATCE-QSTGVCICRDGFIGDGTTACSKKSTADC------------ISLPSLCADKAKCD--------------------NSTRS----CECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNR----RCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCV--------PDPLDC-VHFTGICHPNAVCNSE---SRQCQCSSGFSGNGVSCFPQKSC 2197          

HSP 37 Score: 53.9138 bits (128), Expect = 6.177e-6
Identity = 52/177 (29.38%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 13907 FCEYVNTPCAKDSDCNKDGEC----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKL---------FC--LGDADCAKS---GKCFQNLCSCNLGFEGDGKL-LCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDG 14380
             CE +N   A+ + C+ +  C        C CK G++GDG   C++INEC +E +PC  +  C++  GS+ C C + F       C N L         FC  +    C           ++C C  GF  + +   C +++EC     N    SA C +  GSY C+C  G++G+G
Sbjct: 1562 VCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFM-CTDINEC-DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG 1736          

HSP 38 Score: 53.5286 bits (127), Expect = 7.182e-6
Identity = 26/60 (43.33%), Postives = 34/60 (56.67%), Query Frame = -1
Query: 15749 CLCKTGFVGNGL-----NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC 15913
            C+CK+GF  N        C D +EC  K+  C   ATC NTFGS+ C C +G+ G+G  C
Sbjct: 2266 CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2325          

HSP 39 Score: 53.1434 bits (126), Expect = 9.629e-6
Identity = 48/162 (29.63%), Postives = 73/162 (45.06%), Query Frame = -1
Query: 6590 CQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENS---IGSFTCRCNEGYSGD-----GSVCSEIDECLLGLHN-------CSRSHQFCFNVNGGFECRCLSGYKSDTNGS----CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQ 7018
            CQC +GF+G+   C       F   +C +D++ C  +   + + +C C  G+ GD      S+ S+       L +       C  S Q C +     EC C SG++ ++  S    C D +EC    + CD  A C NT GS +C C  G++G G  C P 
Sbjct: 2178 CQCSSGFSGNGVSC-------FPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCIS----GECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPH 2328          
BLAST of SMED30010561 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 203.371 bits (516), Expect = 3.393e-51
Identity = 270/938 (28.78%), Postives = 377/938 (40.19%), Query Frame = -1
Query: 2900 CGNHAFCKIENGRADCFCDSGYYG--DGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSES--CATNGECQNTIGSFKCECKDGFIGDGKYDCRI------DSKCEKYGGCHE-DASCIVNVESSIYEC-QCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVC-----GDGAV------------------YVDDI------------------------------CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCE---------CQSGYKGTGWFCIK---QTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSP----DFAAQKCLASGGGCLNTKGSFVCTCNQEQMNE------------NNSSCKPIDSCAMGLDNC---DRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIG-SYVCKC-PDN--LKLDL-SKKACTDRNECQENPMICGDLSKCLNTD----------------GSYECQCVTGYKWNGTNC-EDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCP------ARDDVKCPTGS---YCNMIGNFIY-CNCTNGYEDSNQM----------------------ECIGDVCYKK---------CSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETH 5236
            CG  A C+   G   C C+ G+ G    + CVDVDEC+ GD +C  ++ CQN  G + C C  GF++ ++     SC DIDEC    S  C  N +C N  G++ CEC++GF+GDG Y C        DS       C E + SC V+      EC +C   +   G   C   N C    K+ C  NA C  +N T+ C C  G++GDG+  C DI+EC  D  H C    +C N  G + C C     GDG                     VD +                              CVDIDEC  ++ N   ++A+C N EG+Y C+CAEG+ G+G +C DIDEC  G+A C   A+CIN+ G+  C+C AG  G+G TC   +E  +PK    A   + + +C+ +    T +         C  G+      C        C   N C  +  C   + +S   C C   F  +   C    EC N    CD E + C      F C C  GF  V   C    +  P       D        SG     TK S                        +  +C  + +C      C   D  + D  ++     T  CI     +   C D  +C +   SC+ +A     IG  YVC   P +  L+ +L S +A      CQ  P   GD  KC++                  G   C+C  GY  NG  C  D  +C   T  CH  A C++   S +C+C  GF+G+G+ SC    SC       A++ +  PTGS        G+  Y C+     E +NQ                       ECI    +++         C+DIDEC  +   C + A C N  G++VCTCP    GDG T     N+  L  +
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDG----SCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG-YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKV-CEDINECVAE-KAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINEC--DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDS-HFCSCPDGFIGDGMICDDVDEC-NNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCI----SLPSLCADKAKCDNSTRSCECDA---GYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSE--SRQCQCSSGFSGNGV-SCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVY 2312          

HSP 2 Score: 193.356 bits (490), Expect = 4.137e-48
Identity = 263/979 (26.86%), Postives = 395/979 (40.35%), Query Frame = -1
Query: 3497 SDSSQCIDIDECNENVDDC-QENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRAD--CFCDSGYYGDGE--LCVDVDECSNGDVSC-PNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSES-CATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEK-YGGCHEDASCIVNVESS--------IYECQC----HTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNA-TYRCICPDGFQGDGYNFCNDIDECAN------DNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQ--------------------------------------------------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLLC---HDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCI----KQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIP-KTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKG-----SFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR---INGS--CVDVDECADKIDSCKNNATCNNMIGSYVCKCPD 6148
            +D   C DIDEC E+   C   N+ C N+ G+Y C+C   +L    DG  C+      C+ +  +  +C+  + SC +        DG++ C +                          C  GY+  G K C DI+EC  +   C++N +C N  G+F+CSCK+GY  +                              G+      MC D+NEC  + PCH  A+C N  GS+KC+C   F GD   KC      T  L+                               C  V + C  ++  +    +I NG     C C+ G+  + E   CVD+DEC     +C P ++ C N +GS+ C C  G++  E  +    CTDIDEC    + C +   C N +GS  C+C  G+ GDG    +I+ + +     C ++ S +  +E          + +C      H   +G    S   + LC    K+ C+++A C  ++  ++ C CPDGF GDG   C+D+DEC N      +NT       KC N+ G +NCVC +G   VD+ CV  ++   N+                                                  T  C S A C+   G   C C +GF GDG          +C    + C++ A C N   T +CEC AG +G+G  C    +    + +  +PE    AVC+N+     C+C  G+ G G  C+    + + C   + C AN  C          C+C P +      C+P   +C + T  C     N V      +C+C  GF+  G +C  +  C       A        G C+   G      + C+    +   N      + SC   +  CD   + CIS +     C C  GF+R   ++GS  C D+DECA+K   C   ATC N  GS+VC CPD
Sbjct: 1466 ADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLG---DGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-----DGSVECKE--------------------------CMGGYKKSG-KVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGD------------------------------GF------MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKC------TNPLE-----------------------------RSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEG-EGGV----CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGT-CQSLQISGLCAQ--KNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENT-------KCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGV--CICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNS--TRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE----AVCQNR----RCQCLPGFTGDGVKCVSIHERASNC---SQCDANAHCVGG-----TTCKCNPGYFGNGLCCVPDPLDCVHFTGICH---PNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSC---VTPCDSSTQLCISGE-----CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPD 2291          

HSP 3 Score: 181.415 bits (459), Expect = 1.630e-44
Identity = 276/1017 (27.14%), Postives = 394/1017 (38.74%), Query Frame = -1
Query: 5414 CSNDAFCDFKDDDYGCHCKNGFMG--DGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF-EGNGVTCTNINECYPL-SPCDNATEECFDKVPGYECRCQKGFMKN------TTTGNCD----DRNECADTGNLCDRVSTNCNNTFGSYRC-DCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDG----DNP----CNTVQ--CTKPNEI------CYLGQ----CFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDE----------------CLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRF--FDNGCDDNADCINTD-GSFLCICRAGYIGSGRNCDPQEGLEECGKL-LC-PLNALCVNST----CLCKSGYENSTNQCI-------NTDECE---------------------------------------------SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG---DCYDGICHCPSGFVFKSNKC--FDERC---ENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLS--QCNQSCPTGQYCNNGS--CSCLMGLNSQTDDDGNLNCSKNSASCLP--------GICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINP----SGMCQDVNECQTQS-PCHILAQCINTPGSYKCQCPENFYGD 8053
            C  DA C+ +     C C+ GF G      C D+DEC+     C  +A C+N +G ++C C  GF + +  +C +I+EC    S C  A  +C +K   Y C C+ GF+ +      TT   CD     ++ C+++   C+      +   GS  C +C  G++ S     VC D+NEC          A C N  G++ C+C  GY+GDG  CTDI+EC     C  P A C NL GS++C C  G  G DG     NP    C  V+  C + + +       Y G     C C+ GF+    +N C DIDEC+ + N+C    A C N +GSY CEC  GY                             + +GG               C DIDEC   +  CDS  A C N +GS  C+C  GY+GDG+ C +I+E                C L    C+   +            CL G+    NG+C            N C+ +A+CI+    S  C C  G+IG G  CD    ++EC    +C   N  C N+     C+C  G++    +C+       N ++ E                                             S  +C   A C  + G  +C C +G+IGDG     K +  D   + + C D    D     C C +G++     C    + C   +N+C   A            C      + D  +C+ I E   N   C  N+ C    G   CKC P Y   F +G  C+  PL        C     CN+ S  C C  G             S N  SC P         +C  NA C   L    C C+ G++G     C  +      ++    N+   +   S    C      +SS+ LC +                 C CKSG+  N     S  C D++EC  +S  C  +A C NT GS+ C CP+   GD
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCE-----VDTVDGSVECKECMGGYKKS---GKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCH-PHAECTNLEGSFKCECHSGFEG-DGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-----------------------------EGEGGV--------------CTDIDECDRGMAGCDS-MAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGA-----CLPGHHP-INGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICD---DVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTG--VCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEA------VCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGY---FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGF------------SGNGVSCFPQKSCRTDKSVCAKNAIC---LPTGSCICRHGFKGDPFYKCSSL------VSKEPANQQDLSDVSSCVTPC------DSSTQLCISGE---------------CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGD 2296          

HSP 4 Score: 179.104 bits (453), Expect = 7.256e-44
Identity = 270/994 (27.16%), Postives = 419/994 (42.15%), Query Frame = -1
Query: 2132 DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSG-DGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDE--CSSNQTNK---CSSNAICQ--NKEGTYSC-QCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQ------------TCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPID--------SCAMGLDN-CDRKVEDCISSKDSSYTC-QCIEGFQRINGSCVDVD---ECADKIDSCKNNATCNNM-IGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPG-FTGDGIYSCIETDSCPARDDVKCPTGSYCNMIG---------NFIYCNCTNGYEDSNQMECIGD---VCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV--KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKC--ENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY---------------CNDINECLIP-NSCGQNSVCANTVSGFNCSCANGARQ---LPNGD-CELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEV--FPQV 4882
            ++KC     C  DA C    E     C+C   F G     SC+  + C   G  +CHE+A C+     Y C CP GF+      C DIDEC   N+  C +  KCVN  G Y+C C +G +     CV   +  C S Q++K     SN  C+    +G+  C +C  G+   G +C DI+EC    A CS NA C+N  GTF+C C+ G  G+G  C D +EC +         C  +A C N +  + CEC SG++G G   IK+    +  +C+  +            +    N +  ++CEC+P F+ E +  +C+   ECE   +NCD  ++ CV  +  ++CEC  G+   G  C D +ECD      A    +A    C+N  GS  C C       + ++C  I+        +C       C+ + + C   ++    C  C+ G   ING+C  +     CA K D C  +A C ++   S+ C CPD    D     C D +EC    M   + +KC NT GS+ C C+ G+K     C  +DE   K  P  +         S     Q    T + + +     +          + S C+ +          +   C C +G+        IGD    C KK +   +C++  S C   A+C N+     C C +   GDG        +C L  + C+   + C+N           +C C  G+    +    I    + C     + C  NA C+   G   C+C  G+    +G C   +  +C   +  C  N+VC   ++   CQC  GF  +    ++C     C T+ + C+   ++IC+    +  C+C HGF     Y                +D++ C+ P +S  Q  +C   +SG  C C +G R+   L   + C  I+EC E   +C  +    + C +    + C CPDG V D +   P V
Sbjct: 1392 NTKCTSSDECGLDALC----ERRTGVCRCEPGFEGAPPKKSCVDVDEC-ATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH------PCHPHAECTNLEGSFKCECHSGFEGDG---IKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECD---RGMAGCDSMAM---CINRMGSCGCKC-MAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKND-CNKHAECIDIHPDSHFCSCPDGFIGD--GMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV-VDE---KKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGF--------IGDGTTACSKKST--ADCISLPSLCADKAKCDNS--TRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE-AVCQNR----------RCQCLPGFTGDGVKCVSIHERASNC-----SQCDANAHCV---GGTTCKCNPGY--FGNGLCCVPDPLDCVHFTGICHPNAVCN--SESRQCQCSSGFSGN---GVSCFPQKSCRTDKSVCAK--NAICLP---TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQ--LC---ISG-ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRV----ATCRNTFGSHVCTCPDGHVGDGITCVPHV 2304          

HSP 5 Score: 157.147 bits (396), Expect = 3.301e-37
Identity = 265/1017 (26.06%), Postives = 394/1017 (38.74%), Query Frame = -1
Query: 1865 GAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQT--PCDVPNACKANQTCTPSN--------ENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG---------------------------------------CLNTK---GSFVCTCNQE---QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC-----------------PDNLKL----------DLSKKACT-DRNECQE--------NPM-----------------ICGDLSKCLNTD-GSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSA-------CHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQC---HCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNC-EDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNS-CGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS----DGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCI 4531
            GA   +D  V+  +C+S  +++C  +A+C+ + G   C+C  GF G      C D+DEC  G  NC E+A C N  G +AC C  G    +  +C D DEC +   +     C  NA C NK   Y+CEC++G+ G G+ C+  T  PCD   + K++  C+ SN        + S+   EC   +K     C    EC  +   C    +NCV ++  F C CK G+   G  C D NECD   P     +C    G                                        CL+ +   GS    C  E   +  + ++SC  ID C    +NCD     C+++ + SY C+C EG++   G C D+DEC   +  C + A C N +GS  CKC                 P + K           +L KK CT D  E  +        +P+                  C   ++C++    S+ C C  G+  +G  C+D+DEC        +  +C N  GS  C C  GF        ++    P R+ ++         I      +  +G E     E +        +         SA       CH  A C  + G  VC C     GDG T C  ++     T  C    S C +     N     +C   +  +GYV  P  Q C+ ++       N C   A+C +      C+C  GF      KC +I+E       C  N+ C     G +C+C PG+  +    L C  D  +C + T     P+++C  N  S +C C  GFS  G  C     C    S C +N++C  T S   C C +G +  P   C              +++   +   DL    +CV P                         C +S   C+    S +C+CK GF +NS       C D DEC  +E+S+ K      C NT G   C CP+G + +   C+
Sbjct: 1381 GAPQANDSSVENTKCTS--SDECGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC----CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSH--CSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSL-NANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNT-EGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIE---------IDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTG--VCICRDGFIGDGTTACSKKS-----TADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRD-------NLCSPEAVCQN----RRCQCLPGFTG-DGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGN---GLCCVPDPLDCVHFTGIC-HPNAVC--NSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGS---CICRHGFKGDPFYKCS------------SLVSKEPANQQDLSDVSSCVTP-------------------------CDSSTQLCI----SGECICKSGFRRNSTLSGSETCADIDEC--AEKSH-KCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2301          

HSP 6 Score: 147.902 bits (372), Expect = 1.949e-34
Identity = 235/839 (28.01%), Postives = 338/839 (40.29%), Query Frame = -1
Query: 1142 CQCVTGYKWN--GTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCT-CPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINE--CEE------KSDNCSINSV-CQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINEC-LIPNSCGQNSVCANTVSGFNCSCANG----------ARQLPNGD-----------CEL------INECLENIDRC-------QVLNGA------------------DSVCYDL-PIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGF----------IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVD---IDECQFPNSCLD-GLCNNLPGSFECLCNIGYDLVNGKCT-DINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSC---------KAICGPNS-CLPGQLCQIVNGNQYD 3382
            C+C  G++      +C D+DECA   H CH+ ARC N  G   C C  GF      SC + D C   +   C   + C        C C NG+   +  +C+     K C       +  S  +   E    DG+  C  C       GK  CED NEC  E   C+LN        N VN+   F C C  GY       +C + NEC     + C  +A C + EGS++C C SGF+     KC N  E  CE+      + D+ S  SV   + +    C+C+PGF++  E+N +C DIDEC    +      ++C+N  GS+ C C  G+  +GG C DI+EC      C   ++C N +    C C  G            + P  D           CEL      ++E  E + +C         +NG                    + C D+ P  + C CPDGF+ D +   +C++ +EC  N   C   N++C +T GSF CVC  GF K  D  CV  DE +   +  ++        + +G       E                        CS     SLA  C+Q  G CI         C  GF+  + +T C      D    P+ C D   C+N   +  C C+ GY      C+    +C     +C P+A  +C N     +C+C  G+   G K    C S++E       C +NA CV    G  C C  GY  + +    +  +C      CH  A C     S +C C  G+ G+G VSC         K++C  N+ CLP   C   +G + D
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFL-GDGYQCV-PTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGK-VCEDINECVAEKAPCSLNA-------NCVNMNGTFSCSCKQGYRG--DGFMCTDINECDE--RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESN-SCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDE--EEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM---ICDDVDECN-NAGMCDDENTKCENTIGSFNCVCLEGF-KKVDEKCV-VDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLA-TCEQSTGVCI---------CRDGFIG-DGTTACSKKSTADCISLPSLCADKAKCDN--STRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEA--VCQNR----RCQCLPGFTGDGVK----CVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVC--NSESRQCQCSSGFSGNG-VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGD 2200          

HSP 7 Score: 127.487 bits (319), Expect = 3.365e-28
Identity = 131/398 (32.91%), Postives = 177/398 (44.47%), Query Frame = -1
Query: 6359 NCTDIDECSSNKVCQRPDATCVNLPG----SYECRCLDGTPGCDGDNPCN-TVQCTKPNEICYLG--QCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXX---XXXXNLHQCGE-NAEC-IDT-DGGYYC-QCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVD--ENECRFFDNGCD--DNADCI-----NTDGSFLCICRAGYI--GSGRNCDPQEGLEECGKLLCPLNALCVNS----TCLCKSGYENSTNQCINTDECE-SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFK 7462
             CT  DEC  + +C+R    C   PG      +  C+D      GD+ C+ + +C       Y+G   CFC  GF+       C+DIDEC    + C G  AKC N  G+Y CEC  G+       +            +   C E N  C +DT DG   C +C  G+      C DI+EC      C S  A C N  G+F+C C +GY GDG +C++I+EC    H C   H  C N+ G F+C C SG++ D    C +  E  C   +  C   D+  C+     N   S +C C  G+       +C   +  EE      P +A+CVN+     C C  GYE     C + DEC+     CD  A CI+  GS  C C  GY GDG  C K
Sbjct: 1394 KCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN-----YVGGYACFCPTGFR-KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPC-SLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE-RHPC-HPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK 1782          

HSP 8 Score: 122.479 bits (306), Expect = 9.305e-27
Identity = 126/413 (30.51%), Postives = 188/413 (45.52%), Query Frame = -1
Query: 1352 NLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLI-PNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVND--EVFPQVCENQNECEINIHSCQASNSEC-VDTY-GSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFV---------MIENSTKCVDIDE-CQFPN--SCLDGLCNNLPGSFECLCNIGYDL--VNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQED 2533
            N  C   DEC     C      +C   PG FE   P         C D++EC    ++C +++ C N V G+ C C  G R+  +G C+ I+EC E+   C    GA++ C + P  Y+C C +GF+ D  +  P   +  +  + +   C  SN  C VDT  GS +C    G  K S   C D +EC ++E++      N  C+N  G F+C C +G+  + + C D++EC               +  C N  G F+C C+ GF           +E S  C D+++ C   +  SCL     N   S  C C  G+     +  C DI+EC  +   C P A+ +C+N  GS++C+C  GYE  GG     C  ++EC +    C S A C++R     C C  GY  D
Sbjct: 1392 NTKCTSSDECGLDALCERR-TGVCRCEPG-FEGAPPKK------SCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC---CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINEC-VAEKAPCSL--NANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-------HPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERS--CEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDP-ASAVCVNTEGSYRCECAEGYEGEGGV----CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGD 1776          

HSP 9 Score: 121.324 bits (303), Expect = 2.502e-26
Identity = 144/500 (28.80%), Postives = 207/500 (41.40%), Query Frame = -1
Query: 5669 HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS------VCSEIDECLLGLHNCSRSHQFCFNVNGGFEC--RCLSGYKSDTNGSCVDENECRFFD-NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTNQCINTDECESQ-TSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQE-NSICFNRFGSYDC--------KCPPNYLDVFKDGKVCMAVPLSQCNQSCPTG----QYCNNGSCSCLMGL---NSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC 7069
            H C   A+C +T G Y C+C  G+ G+  EC DIDEC+  L +   + + C N  G++ C C +G++  G+       C++I+EC  G HNC  + + C N  G F+C  +C  GY+   +G C D NEC     + CD  ADC+NT G + C C  G+ G G+NC P+    +    +C  +A C  V   C CK+GY      C + +EC+++ T C     C++  G ++C C  G   D   C K   D  A     +C+ G      C +  C C  GF    +K                                      +C+DI+EC EN   C      C N FG + C        +C                   +   +    G    Q  + GS +   GL   + +    G L C+          CP N+ C     G  C+C  GY G  +  C DIDEC  +I N   NE C N  G F C
Sbjct:  140 HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRK-NSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQ--DDATCIK---DQGA-----FCSGGCGDNAICSNATCACIDGFRGDPHK--------------------------------------KCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTS--------YCPPNSEC----VGGYCECVSGYGGNALVGCEDIDECITEICNIEANEWCVNLIGGFVC 575          

HSP 10 Score: 117.472 bits (293), Expect = 3.627e-25
Identity = 143/496 (28.83%), Postives = 199/496 (40.12%), Query Frame = -1
Query: 6764 TCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDK-----VPG-YECRCQKGFMKNTTTGN----CDDRNECADTGNLCDRVSTNCNNTFGSYRC--DCKYGFRPSPIDSFVCTDVNEC--NLVHECDKNYAKCTNTPGSY---------------------------------------YCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGT--PGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH---------QCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNGGFEC 8056
            TCS    C +      C+C +GF G     +D +EC  +   C   A C+NT+GS+ C C  G+EGNG  CT+I+EC      D  T  C +      +PG Y C C +GF      G+    C D NEC    + CD     C N+ GS++C   C  G+    +    C DVNEC    +H+CD   A C NT G Y                                        C C +GY GDG  C DI+EC +          C+NL G Y C C +G     C  D           N IC    C C  GF+ +     C DI+EC    + C G   +C NL G ++C C +G   +       + +    + H         Q  E +  I T  G       G        +D++        C S        +G + C C  GY G+  V C +IDEC+  + N   ++++C N+ GGF C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS-----DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYE---LIDGKCEDVNECGSEKLHKCDVR-ADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIP-----KDVELTTSGRLACTSYCPPNSECVGGY-CECVSGYGGNALVGCEDIDECITEICNI-EANEWCVNLIGGFVC 575          

HSP 11 Score: 115.161 bits (287), Expect = 1.783e-24
Identity = 148/499 (29.66%), Postives = 206/499 (41.28%), Query Frame = -1
Query: 6404 RCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPD-ATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYEC--ECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGF---------------------------------ECRCLSGYKSDTNGSCVDENECRFFDNGCDDNAD-CINTDGSFLC--------------------------------------------ICRAGYIGSGRNCDPQE-GLEECGKLL----CPLNALCVNSTCLCKSGY-ENSTNQCINTDECESQTSCDVNAN--CIDTHGSFIC 7633
            +C C  GF  S  +     D NEC L H C    A+C NT GSY C C  GY+G+G  CTDIDECS     + P+ + C+NLPG+Y C C  G                           F   G Q +   + C DI+EC+T A++C   +  C N  GS++C  +C  GY +    K  +      + LH+C   A+C++T GGY C+C+ GF G    C+    C  +   CD   A+C   I    C C  GY+GDG  C +I+EC      CS   + C N++GG+                                  C C+ G++ D +  CVD NEC   D+ C    D C+N  G F C                                                G I   R   P++  L   G+L     CP N+ CV   C C SGY  N+   C + DEC ++  C++ AN  C++  G F+C
Sbjct:  117 QCYCDSGFSGSACE---LQDKNEC-LEHPCHM-MAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQG---------------------------FTPKGNQGS-GLDKCADINECETGAHNCDADEI-CENSIGSFKCVNKCSPGYELID-GKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDR-HASCH--IVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGR-CLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 12 Score: 110.538 bits (275), Expect = 4.383e-23
Identity = 159/529 (30.06%), Postives = 215/529 (40.64%), Query Frame = -1
Query: 3482 SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCE-KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF-----QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCV--CGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-NDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDK------NECDPTSPDFAAQ-KCLASGGGCLNTKGSFVCTCNQEQMNEN-----------NSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLD 4981
            +C+  G C       +C C  GF G     C +  K E     CH  A C   + S  YEC+C   + G+G   C   + C     S C E++ C  +  TY C C  GF     QG G + C DI+EC     HNC + E C NS G + CV  C  G   +D  C D++EC S + +KC   A C N  G Y C+C EGF GDG  C     C+   A C  +A C        C+C+ G  G+G TC D +EC   K +P    C +   C N D GY C C++G       CIK         C  N  C      S A C C   F+ + +  C+   EC      C      CV L  GFKC C+ G       C D+      +       DF    + +  G G + T      T  +  + ++            S C P   C  G                    C+C+ G+    + G C D+DEC  +I + + N  C N+IG +VC  P N   D
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSA---CELQDKNECLEHPCHMMAQCQNTLGS--YECRCLPGYEGNG-HECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECET-GAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC--HIVLDICDCKTGYTGDGITCHDINECDA-KDTP----CSDGGRCLNLDGGYVC-CKNGQDDA--TCIKDQGAFCSGGCGDNAIC------SNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEA--ECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY-------------------CECVSGYGGNALVG-CEDIDECITEICNIEANEWCVNLIGGFVCCNPTNATHD 584          

HSP 13 Score: 104.375 bits (259), Expect = 3.425e-21
Identity = 120/357 (33.61%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 1142 VNDEVFPQVCENQNECEINIHSCQAS---NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENS----TKCVDIDECQ--FPNSCLDGLCNNLPGSFECL--CNIGYDLVNGKCTDINEC-SNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDS-CHYLADCLDTDGSYKCTCKYGYK-----GDGIVSCKAICGPNSCLPGQLCQIVNGNQYD 2158
            ++DEVFP  CE         H CQ++      C+      +C C  GFS  S  +  D +EC +    +M      +C NT G + C C  G+  N ++C D+DECS      L   C + +  CIN  G + C C +GF    N      KC DI+EC+    N   D +C N  GSF+C+  C+ GY+L++GKC D+NEC S     C  +A   C+N  G ++C+C  G+E  G      CQ  + C K +  C  +A C    +   C CK GY  D I  C +INEC  +D+ C     CL+ DG Y C CK G        D    C   CG N+      C  ++G + D
Sbjct:   87 MHDEVFP-YCE---------HKCQSTCSGKGACLYDGAKPQCYCDSGFS-GSACELQDKNEC-LEHPCHMM----AQCQNTLGSYECRCLPGYEGNGHECTDIDECS----DKLTSRCPE-HSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRAD--CVNTIGGYECECEEGFEGDGKN----CQPKSSCRKNSAICDRHASCHIVLD--ICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGD 412          

HSP 14 Score: 98.9821 bits (245), Expect = 1.177e-19
Identity = 118/357 (33.05%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 2420 DRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIK-THPCHDLARCSNVPGSCKCKCQPGFT-----GDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCN-CTNGYEDSNQMECIGDVCYKKCSDIDECVTRK-SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQI-CLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHG 3460
            D+NEC E+P  C  +++C NT GSYEC+C+ GY+ NG  C DIDEC+ K T  C + ++C N+PG+  C C  GFT     G G+  C + + C       C     C N IG+F   N C+ GYE          +   KC D++EC + K   C   A+C N  G Y C C     GDGK  C+ ++ C   +  C+ + S    LD          C C  GY    G  I C + NEC +  +  C +   C++ +G Y C CK+G       K    ++    S  C  N++C +     +C C  GF+   + +  C DI+EC    S        C+N  G F+C C HG
Sbjct:  133 DKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAH-NCDADEICENSIGSFKCVNKCSPGYE----------LIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGK-NCQPKSSCRKNSAICDRHASCHIVLD---------ICDCKTGYT---GDGITCHDINEC-DAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIK----DQGAFCSGGCGDNAICSNA----TCACIDGFRG--DPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 15 Score: 95.1301 bits (235), Expect = 1.983e-18
Identity = 100/289 (34.60%), Postives = 135/289 (46.71%), Query Frame = -1
Query: 3890 KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGF-----YGDGL-LCHDIDECKFGVANCSENALCINKPGTFAC--ECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA-CKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPG 4729
            +S+C     C    A  +C C  GF G       D +EC     H C  + +C N+ G Y C C  G       C DIDECS   T++C  ++ C N  GTY C C +GF      G GL  C DI+EC+ G  NC  + +C N  G+F C  +C  G       C D +EC    GS    +CD  A C N   GY CEC+ G++G G  C  ++ C   +A C  + +C       L IC+CK  +  +  TC    EC+ K   C  +   C+ LD G+ C CK G
Sbjct:  100 QSTCSGKGACLYDGAKPQCYCDSGFSGSACEL-QDKNECLE---HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNEC----GSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC----HIVLDICDCKTGYTGDGITCHDINECDAKDTPC-SDGGRCLNLDGGYVC-CKNG 374          

HSP 16 Score: 87.4261 bits (215), Expect = 4.304e-16
Identity = 62/174 (35.63%), Postives = 83/174 (47.70%), Query Frame = -1
Query: 15758 TSGCVCNDGFLRSGTTCTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECR-CKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNG 16276
            T  C C +GFL  G  C P  +  C   D+              S+K+ CS +N               C   T  G  EC+ C  GY+     C DI+EC      CS N +CVN  GT++C CK G+ G+G  CTD NEC+ +   C  +A C N  GS+KC C +G+EG+G
Sbjct: 1497 TYSCECENGFLGDGYQCVPTTKKPC---DSTQ------------SSKSHCSESNM-------------SCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHP-CHPHAECTNLEGSFKCECHSGFEGDG 1641          

HSP 17 Score: 85.1149 bits (209), Expect = 1.897e-15
Identity = 115/388 (29.64%), Postives = 164/388 (42.27%), Query Frame = -1
Query: 5441 CLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC--QIENYCTD--------GDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDC--KCPPNYLDVFKDGK-----VCMAVPLSQCNQSC----PTGQYCNNGSCSCLM-GLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN--CGSHGICGPNYICQCKSGYEINPSGMCQDVNEC-QTQSPCHILA-QCINTPGSYKC 6526
            C C SG+  S  +  + +EC  +  C + A C +T GS+ C C  GY G+G  C    TD D C  ++ + C +        G  Y   C+C  GF  K N+                                  S   +C DI+EC     +C  + IC N  GS+ C  KC P Y  +  DGK      C +  L +C+         G Y           G N Q       +C KNSA     IC  +A+C   +   IC CK GY G GI +C DI+EC  K   C+    C N +G + C CK G  ++ ++ + +    C+  CG + IC  N  C C  G+  +P   C D+NEC +  S C  +  +C+N  G +KC
Sbjct:  118 CYCDSGFSGSACELQDKNEC-LEHPCHMMAQCQNTLGSYECRCLPGYEGNGHEC----TDIDECSDKLTSRCPEHSKCINLPGTYY---CNCTQGFTPKGNQ---------------------------------GSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELI--DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKS----SCRKNSA-----ICDRHASC--HIVLDICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNG--QDDATCIKDQGAFCSGGCGDNAICS-NATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 18 Score: 85.1149 bits (209), Expect = 2.320e-15
Identity = 151/590 (25.59%), Postives = 218/590 (36.95%), Query Frame = -1
Query: 1646 DIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV----KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYEC--RCKSGFKQLPSGKCENINEC-EEKSDNCSINSVCQDKADGFS---------------------------------------CQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHG------FSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDE-----------------------------------------------VFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDV------------DECSLDQVSSLADNCDQVNGHCINTVGGF---QCYCNRGFVMI-ENSTKCVDIDECQFPNSCLD----GLCNNLPGSFE 3055
            D +EC+  +  CH  A+C N  G+Y C C     G+G   C D +EC+      +  TS C      +N+   + C+C  G+     +  G   C + NEC     N C  + IC ++ GS++C  +C  G+ +L  GKCE++NEC  EK   C + + C +   G+                                        C CK G+       + C DI+EC    T CS      C+N  G + C C +G         QG +C+          CG N++C+N      C+C +G R  P+  C  INEC+EN   C    G    C +L  G+ C C  G    E                                               + P+  E      +   S    NSECV  Y    C C  G+  N+   C D DEC I+E  N++   N  C+N  GGF C  P    ++  DCI++            +E ++    S     DQ+    +     F   Q    RG V   E  T+  D DE     S  D    G    LP + E
Sbjct:  133 DKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHE-CTDIDECS------DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHN-CDADEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGD---GITCHDINECDAKDTPCSDGGR--CLNLDGGYVC-CKNGQDDATCIKDQGAFCS--------GGCGDNAICSNAT----CACIDGFRGDPHKKCVDINECVENDSVC---GGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY----CECVSGYGGNALVGCEDIDEC-ITEICNIEA--NEWCVNLIGGFVCCNPTNATHD--DCIEITKEKGLHVIGGNEEDTVVATRSNHSTSDQLITQVVQQSRNFSTGQIILTRGKVSSGEAVTQTTDADEFGLEISAADLAGSGSGITLPTTLE 680          

HSP 19 Score: 83.5741 bits (205), Expect = 6.838e-15
Identity = 119/372 (31.99%), Postives = 159/372 (42.74%), Query Frame = -1
Query: 2828 KCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGS----CVDVDECADKIDSCKNNATCNNMIGSYVC--KCPDNLKLDLSKKACTDRNEC-QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENL-DNTVNVLAPFQC 3910
            +C C  GF+      QDKNEC        AQ        C NT GS+ C C       N   C  ID C+  L +   +   CI+    +Y C C +GF  +   GS    C D++EC     +C  +  C N IGS+ C  KC    +L   K  C D NEC  E    C   + C+NT G YEC+C  G++ +G NC+    C   +  C   A C  V   C CK   G+TGDGI +C + + C A+ D  C  G  C N+ G ++ C   NG +D+  ++  G  C   C D              A C+N      C C     GD    C D NEC         N S C  + D  VN+   F+C
Sbjct:  117 QCYCDSGFSGSACELQDKNECLEHPCHMMAQ--------CQNTLGSYECRC-LPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLP-GTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGK--CEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKT--GYTGDGI-TCHDINECDAK-DTPCSDGGRCLNLDGGYVCCK--NGQDDATCIKDQGAFCSGGCGD-------------NAICSN----ATCACIDGFRGDPHKKCVDINECV-------ENDSVCGGVGDRCVNLFGGFKC 446          

HSP 20 Score: 80.4925 bits (197), Expect = 4.818e-14
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = -1
Query: 15632 CRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNEC-ESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC---SQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTC 16036
            CRC+ G+EG     +C D+DEC+ G + C ++  C N +G Y C C TGF   +  +C D +EC E  +  C A A C N  G+Y C C+NG+ G+G  C   ++ P  +    +++CS   + SC+     VD  DGS  C
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCS-ESNMSCE-----VDTVDGSVEC 1549          

HSP 21 Score: 78.5666 bits (192), Expect = 1.751e-13
Identity = 135/502 (26.89%), Postives = 193/502 (38.45%), Query Frame = -1
Query: 1256 CMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNG-DCELINECLENI-DRCQVLNGADSVCYDLPIGYACVCPDGFV---NDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCV--CKPGFSKNSDGDCVDYDECEISEQSNMKFCN-NGKCINTAGGFT---------------------------------------CDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSCLD-GLCNNLPGSFECLCNIGYDL-VNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVG------------------------YENSGGKSYNPCQSVNECVKLNIT-----------------------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLAD--CLDTDGSYKC 2464
            C+ +    +C C  GFS       D NECL  + C   + C NT+  + C C  G     NG +C  I+EC + +  RC       S C +LP  Y C C  GF    N       C + NECE   H+C A +  C ++ GSFKCV  C PG+ +  DG C D +EC       +  C+    C+NT GG+                                        CDC  G+  +   C D++EC         D      G C+N  GG+ C C  G    ++   C+  D+  F    C D  +C+N      C C  G+    + KC DINEC  N  +CG      C+N  G F+C C  G                        +  +G +      S+      +IT                       CP N++CV    GY C C  GY  + +  C +I+EC I + C+  A+  C++  G + C
Sbjct:  109 CLYDGAKPQCYCDSGFSGSACELQDKNECL-EHPCHMMAQCQNTLGSYECRCLPGYEG--NGHECTDIDECSDKLTSRCP----EHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDA-DEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECG---SEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDA------KDTPCSDGGRCLNLDGGYVC-CKNG----QDDATCIK-DQGAFCSGGCGDNAICSNA----TCACIDGFRGDPHKKCVDINECVENDSVCG-GVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECV---GGY-CECVSGYGGNALVGCEDIDEC-ITEICNIEANEWCVNLIGGFVC 575          

HSP 22 Score: 77.0258 bits (188), Expect = 6.258e-13
Identity = 107/398 (26.88%), Postives = 139/398 (34.92%), Query Frame = -1
Query: 3380 CSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC--ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYV---------------------------------CKCPDNLKLDLSKKACTDRNECQENPMICGDLS-KCLNTDGSYEC 4465
            CS    C        C C  GF G      D +EC      C   A C N  G++ C C  G  GNG  C D DEC     S     C E++ C N    Y C C  G+                         TP       +           D C    ECE    NCD +   C      FKC  +C PG+ ++   C+D NEC          KC      C+NT G +     +E    +  +C+P  SC      CDR    C    D    C C  G+     +C D++EC  K   C +   C N+ G YV                                 C C D  + D  KK C D NEC EN  +CG +  +C+N  G ++C
Sbjct:  103 CSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTS----RCPEHSKCINLPGTYYCNCTQGF-------------------------TPKGNQGSGL-----------DKCADINECETGAHNCDAD-EICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEK----LHKCDVR-ADCVNTIGGYE-CECEEGFEGDGKNCQPKSSCRKNSAICDRHA-SCHIVLD---ICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 23 Score: 76.6406 bits (187), Expect = 7.525e-13
Identity = 42/104 (40.38%), Postives = 56/104 (53.85%), Query Frame = -1
Query: 15740 SECRCKKGY--EGRADNCTDIDECSRGSYVCS-DNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16042
            S C C+ G+  E  +++C DIDEC      C   +  CVN  G+Y C C  G+ G G  CTD +EC+   A C + A C N  GS  C C  GY G+G+ C +I
Sbjct: 1680 SVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKI 1783          

HSP 24 Score: 75.8702 bits (185), Expect = 1.265e-12
Identity = 109/362 (30.11%), Postives = 147/362 (40.61%), Query Frame = -1
Query: 5996 YCQCKTGFTGHCDEC---RDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCS-EIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNC--DPQEGLEECGKLLCPLNALCVNST--CLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGI----NCFKKD-------TDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM 7021
             C C+ GF G        +   +C  SL +  +D+A C+NS  S  C C+ GY GDG VCS    +C+L  + CS     C N      C+CL G+  D    CV  +E     + CD NA C+   G   C C  GY G+G  C  DP + +   G  +C  NA+C + +  C C SG+  +   C     C +  S C  NA C+ T GS  C C  G+ GD      +   K+       +D  +C      +   C  G C C SGF   S                                    S S  C DIDEC E    C   + C N FGS+ C CP  ++    DG  C+
Sbjct: 1994 VCICRDGFIGDGTTACSKKSTADC-ISLPSLCADKAKCDNSTRS--CECDAGYIGDGYVCSPHPQDCVLRDNLCS-PEAVCQN----RRCQCLPGFTGD-GVKCVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHFTG--ICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GS--CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTL----------------------------------SGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVG---DGITCV 2301          

HSP 25 Score: 70.8626 bits (172), Expect = 4.492e-11
Identity = 62/197 (31.47%), Postives = 95/197 (48.22%), Query Frame = -1
Query: 9254 GESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD--PVNSLVIGSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECS-LNSSICDANADCINTYGSYICNCKPGFRGSG 9829
            G  +S++   + S ++  SSA       +   T+LP ++   K  P  D   + +   G+   + S ++  +C T+  +C L A C       RC+   G++G          +SC+D DECA     C  ++ C N  G + C C  GF KA    C DI+EC+  NS+ C ANA C+N  G+Y C C+ GF G G
Sbjct: 1328 GTEESTLPPTEGSGESTTSSAP-----TVEPATVLPPQNRNEKPEPTKDTFALPTTTTGAPQANDSSVENTKC-TSSDECGLDALCERRTGVCRCE--PGFEGA------PPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG 1510          

HSP 26 Score: 69.3218 bits (168), Expect = 1.238e-10
Identity = 92/329 (27.96%), Postives = 121/329 (36.78%), Query Frame = -1
Query: 4889 LPGICPLNANCEERLFGYICKCKPGY-----EGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQS--PCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC 5854
            L   CP ++ C      Y C C  G+     +G G+  C DI+EC    +NC  +E C N+ GSF C                                 + +C  GYE+   G C+DVNEC ++    C + A C+NT G Y+C+C E F GD +N             CQ               K SC  +  +                C  HA C I      C C +GY GDG  C D++EC   D  C +   C N DG + C         +N     +C        S  C  N  C N      C C DGF GD    C
Sbjct:  180 LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKC---------------------------------VNKCSPGYELI-DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKN-------------CQP--------------KSSCRKNSAI----------------CDRHASCHIV--LDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCC--------KNGQDDATCIKDQGAFCSGGCGDNAICSNAT----CACIDGFRGDPHKKC 417          

HSP 27 Score: 66.6254 bits (161), Expect = 7.438e-10
Identity = 53/174 (30.46%), Postives = 70/174 (40.23%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLG---------------------------------------------GNEMYSNGRSCIDDDECALLKC---PSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D NEC    H C  HA CTNL+  F+C+C  G++G G                                             G        SC+D DEC   +    P+++ C NT GS+ C C  G+ +    VC DI+EC    + CD+ A CIN  GS  C C  G+ G G
Sbjct: 1606 DINECDER-HPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-EGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG 1777          

HSP 28 Score: 64.6994 bits (156), Expect = 3.143e-9
Identity = 49/179 (27.37%), Postives = 71/179 (39.66%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK---CPSTSDCTNTPGSFICNCHVGFV-------------------------------------------------KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D +EC+T  H+C   A C N   G+ C C  G++        ++  SC D DEC       C + + C N PG++ C C  GF+                                                 K +  VC DINEC    + C  NA+C+N  G++ C+CK G+RG G
Sbjct: 1430 VDVDECATGDHNCHESARCQNYVGGYACFCPTGFR-------KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDG 1601          

HSP 29 Score: 62.7734 bits (151), Expect = 1.274e-8
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = -1
Query: 15575 VCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 15961
             CS  G C+       C C +GF G+     D NEC      C   A C NT GSY+C C  GYEGNG  C+ I           CS    + C + + C++   G++ C+CT+G    G QG+    C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDI---------DECSDKLTSRCPEHSKCIN-LPGTYYCNCTQGFTPKGNQGSGLDKC 218          

HSP 30 Score: 62.3882 bits (150), Expect = 1.493e-8
Identity = 95/354 (26.84%), Postives = 136/354 (38.42%), Query Frame = -1
Query: 1220 ACVCPDGFVNDEV-------------FPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQ--VNGHCINTVGGFQCYCNRGFVM-----IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSN-AQCV---DRSNGY----ECICKDGYQEDQI----GICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIV 2182
             C+C DGF+ D                P +C ++ +C+ +  SC+       D Y     VC P        DCV  D     E      C N +C          C  GF  +   C+ + E         A NC Q   N HC   VGG  C CN G+       + +   CV       PN+    +CN+   S +C C+ G+      C     C  +  +C   A  IC+       C C  G++   G  +  C S+      N    S+ + CV   D S       ECICK G++ +        C +I+EC +    C  +A C +T GS+ CTC  G+ GDGI 
Sbjct: 1994 VCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGY-----VCSP-----HPQDCVLRDNLCSPEA----VCQNRRC---------QCLPGFTGDGVKCVSIHE--------RASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNA----VCNSE--SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNA--ICLPTG---SCICRHGFK---GDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2299          

HSP 31 Score: 61.6178 bits (148), Expect = 2.662e-8
Identity = 98/363 (27.00%), Postives = 143/363 (39.39%), Query Frame = -1
Query: 7610 VMAHSQLECQKL------RDKFASCETVMKTFNKSLDEYIESCVYDQCYSSGDLTQMMCKTAESLAQKCLEEYKVKISYRSINFCNMVCNKNMIYSDCA-SPCQPTCYNNTNSMLCTGQCV---ESCICAPGYVLENGNCT--KPEACGCLMSDGTYYANGEQRTNENCSVKCRC-KGETGQ--------LECTNIT--CSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGV-TCTNINECYP------------LSPCDNATEECFDKVPGYECRCQKGFMKNTT---TGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF 8581
            V  HS   C++       RD F    T   +   + D     C+                   SL   C ++ K   S RS       C+   I      SP    C    N  LC+ + V     C C PG+  +   C      A  C   D   +  G           C+C  G  G         L+C + T  C  +A C+   +   C C +GF G+G+ C     C  + SVC  NA C   + + SC C+ GF+G+    C+++    P            ++PCD++T+ C       EC C+ GF +N+T   +  C D +ECA+  + CDRV+T C NTFGS+ C C  G 
Sbjct: 1980 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTAD-----CI-------------------SLPSLCADKAKCDNSTRSCE-----CDAGYIGDGYVCSPHPQDCVLRDN--LCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG--------GTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCN--SESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC---LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISG----ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVAT-CRNTFGSHVCTCPDGH 2293          

HSP 32 Score: 59.6918 bits (143), Expect = 8.823e-8
Identity = 49/142 (34.51%), Postives = 69/142 (48.59%), Query Frame = -1
Query: 14024 LPWSERQCNS--SYPGFCEYVNTPCAKDSDCNKDG--ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKT-----DFVRLNNGTCQNKLFCLGDADCAKSGKCFQNLCSCNLGFEGDGKLLC 14422
            +P +++ C+S  S    C   N  C  D+    DG  EC      C  G+K  G   C +INEC+ E  PCS+N NC + NG++SC+CK       F+  +   C  +  C   A+C      F+  C C+ GFEGDG   C
Sbjct: 1514 VPTTKKPCDSTQSSKSHCSESNMSCEVDT---VDGSVECK----ECMGGYKKSGKV-CEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFK--CECHSGFEGDGIKKC 1645          

HSP 33 Score: 58.5362 bits (140), Expect = 2.391e-7
Identity = 71/245 (28.98%), Postives = 96/245 (39.18%), Query Frame = -1
Query: 7613 CYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACG------------CLMSDGTYYANGEQRT---NENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEG------FEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYG 8284
            C N+  S  C  +C      +PGY L +G C     CG            C+ + G Y    E+      +NC  K  C+  +         C   A C    D   C CK G+ GDGI C DI+EC    + C     C N  G + C CK G       +  G  C+    C   + C NAT           C C  GF +      C D NEC +  ++C  V   C N FG ++C C++G
Sbjct:  237 CENSIGSFKCVNKC------SPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSA-------ICDRHASCHIVLDI--CDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCS--GGCGDNAICSNAT-----------CACIDGF-RGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 34 Score: 56.225 bits (134), Expect = 9.935e-7
Identity = 48/166 (28.92%), Postives = 61/166 (36.75%), Query Frame = -1
Query: 9290 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA---LLKCPSTSDCTNTPGSFICNCHVGFVK-----AAPTVCNDINECSLNSSICDAN--------------------------------------------ADCINTYGSY 9631
            D NEC    H C + A C N    + C C+ G++G        NG  C D DEC+     +CP  S C N PG++ CNC  GF       +    C DINEC   +  CDA+                                            ADC+NT G Y
Sbjct:  133 DKNECLE--HPCHMMAQCQNTLGSYECRCLPGYEG--------NGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGY 288          

HSP 35 Score: 55.8398 bits (133), Expect = 1.629e-6
Identity = 54/200 (27.00%), Postives = 73/200 (36.50%), Query Frame = -1
Query: 15617 GESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN--------------CTD----FNECESKTA-------------------------------------NCSAYATCYNTF-GSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16048
            G   C C +GYEG    CTDIDEC RG   C     C+N++G+  C C  G+ G+G                CTD      E E K                                       +C+ +A C +    S+ C C +G+ G+G IC  +       D+ N        CD   T  ++  GSF C C EG
Sbjct: 1722 GSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV-------DECN----NAGMCDDENTKCENTIGSFNCVCLEG 1910          

HSP 36 Score: 55.4546 bits (132), Expect = 2.042e-6
Identity = 43/141 (30.50%), Postives = 56/141 (39.72%), Query Frame = -1
Query: 15767 CFNSTASGESECRCKKGYEGRADNCTDIDEC-SRGSYVCSDNGDCVNQLGTYN---------------------------------------CLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16069
            C NS  S +   +C  GYE     C D++EC S   + C    DCVN +G Y                                        C CKTG+ G+G+ C D NEC++K   CS    C N  G Y C C+NG +
Sbjct:  237 CENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQD 376          

HSP 37 Score: 54.6842 bits (130), Expect = 3.733e-6
Identity = 70/246 (28.46%), Postives = 91/246 (36.99%), Query Frame = -1
Query: 15575 HAVDSCHLRDTSGCVCNDGFLRSGTT-CTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCT-DIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 16306
            H++ +C  + T  C+C DGF+  GTT C+ K    C            I     C+ K +C                     NST S    C C  GY G    C+    +C     +CS    C N+     C C  GF G+G+ C   +E  S  + C A A C    G   C C  GY GNG  C         PD  +C  H    C   A C      S  C C+ G  G+G+    Q  C
Sbjct: 1983 HSLATCE-QSTGVCICRDGFIGDGTTACSKKSTADC------------ISLPSLCADKAKCD--------------------NSTRS----CECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNR----RCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCV--------PDPLDC-VHFTGICHPNAVCNSE---SRQCQCSSGFSGNGVSCFPQKSC 2172          

HSP 38 Score: 53.5286 bits (127), Expect = 7.803e-6
Identity = 26/60 (43.33%), Postives = 34/60 (56.67%), Query Frame = -1
Query: 15749 CLCKTGFVGNGL-----NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC 15913
            C+CK+GF  N        C D +EC  K+  C   ATC NTFGS+ C C +G+ G+G  C
Sbjct: 2241 CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2300          

HSP 39 Score: 53.5286 bits (127), Expect = 7.935e-6
Identity = 52/177 (29.38%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 13907 FCEYVNTPCAKDSDCNKDGEC----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKL---------FC--LGDADCAKS---GKCFQNLCSCNLGFEGDGKL-LCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDG 14380
             CE +N   A+ + C+ +  C        C CK G++GDG   C++INEC +E +PC  +  C++  GS+ C C + F       C N L         FC  +    C           ++C C  GF  + +   C +++EC     N    SA C +  GSY C+C  G++G+G
Sbjct: 1562 VCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFM-CTDINEC-DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG 1736          
BLAST of SMED30010561 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 181.8 bits (460), Expect = 1.054e-44
Identity = 286/1064 (26.88%), Postives = 421/1064 (39.57%), Query Frame = -1
Query: 1484 GAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYG--DGLLCHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQT--PCDVPNACKANQTCTPSN--------ENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSK-CLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQ-------MECIGDVCYKKCSDIDECVTRKSACHKFAECTN-NDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFK---WSDETNLNCEDIDECTN---PTSCSSMP-HSICMNNPGSFECVCPHGFSLQGGYC---NDINECL-IPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS------DGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCI--NTVGGFQCYCNRGFVMIE--NSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY---DLVNGK--CTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSG 4531
            GA   +D  V+  +C+S  +++C  +A+C+ + G   C+C  GF G      C D+DEC  G  NC E+A C N  G +AC C  G    +  +C D DEC +   +     C  NA C NK   Y+CEC++G+ G G+ C+  T  PCD   + K++  C+ SN        + S+   EC   +K     C    EC  +   C    +NCV ++  F C CK G+   G  C D NECD   P     +C        N +GSF C C+     +             G+  C   +E          +C+ +E F      C  VD       SC +    N  + S VC+C    + +    +C D +EC+E+   C   S  C+NT+GSY C+C  GY+  G  C DIDEC      C  +A C N  GSC CKC  G+TGDG  +CI+ +  P  D   C T  +  +        CT   E+  Q          I   C  +   I     +K+ C+K AEC + +  ++ C+CP    GDG   C+D +EC      C+   + CE      N +  F C C  G+ K+   +  +++ +  N  + +  E        G  +   K                    +         Q  A+ F+    P      + +ETN   E +   T    P+ CS++  HS+      +  C+C  GF   G          +C+ +P+ C   + C N+    +C C  G      GD  + +   ++      L   ++VC +      C C  GF  D V    C + +E   N   C A N+ CV   G   C C PG+  N         DCV +             C+     N+     C C  GF  N   C     C  D+     +      G CI  +   G   Y     V  E  N     D+  C  P      LC     S EC+C  G+     ++G   C DI+EC+  S  C       C N  GS  C C  G+   G
Sbjct: 1381 GAPQANDSSVENTKCTS--SDECGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC----CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSH--CSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSL-NANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECT-------NLEGSFKCECHSGFEGD-------------GIKKCTNPLE---------RSCEDVEKF------CGRVDHV-----SCLSVRIYNGSL-SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGA-TCIKIEEEPKSDKTAC-TDEWSRLC-ELEKKQCTVDEEEVPQCGACLPGHHPINGTC--QSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDG-MICDDVDECN-NAGMCDDENTKCE------NTIGSFNCVCLEGFKKV-DEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTR--SCECDAGYI----GDGYVCSPHPQDCVLRDNLCSPEAVCQN----RRCQCLPGFTGDGV---KCVSIHERASNCSQCDA-NAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHF----------TGICHPNAVCNSE-SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCI----SGECICKSGFRRNSTLSGSETCADIDECAEKSHKC--DRVATCRNTFGSHVCTCPDGHVGDG 2344          

HSP 2 Score: 175.252 bits (443), Expect = 1.107e-42
Identity = 138/392 (35.20%), Postives = 187/392 (47.70%), Query Frame = -1
Query: 4256 CGNHAFCKIENGRADCFCDSGYYG--DGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSES--CATNGECQNTIGSFKCECKDGFIGDGKYDCRI------DSKCEKYGGCHE-DASCIVNVESSIYEC-QCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVC-----GDGAV------------------YVDDI------------------------------CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTC 5236
            CG  A C+   G   C C+ G+ G    + CVDVDEC+ GD +C  ++ CQN  G + C C  GF++ ++     SC DIDEC    S  C  N +C N  G++ CEC++GF+GDG Y C        DS       C E + SC V+      EC +C   +   G   C   N C    K+ C  NA C  +N T+ C C  G++GDG+  C DI+EC  D  H C    +C N  G + C C     GDG                     VD +                              CVDIDEC  ++ N   ++A+C N EG+Y C+CAEG+ G+G +C DIDEC  G+A C   A+CIN+ G+  C+C AG  G+G TC
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDG----SCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG-YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKV-CEDINECVAE-KAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINEC--DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATC 1780          

HSP 3 Score: 169.474 bits (428), Expect = 6.097e-41
Identity = 169/549 (30.78%), Postives = 252/549 (45.90%), Query Frame = -1
Query: 3359 DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSG-DGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDE--CSSNQTNK---CSSNAICQ--NKEGTYSC-QCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQ------------TCTPSNENSLAICECKPDFKLEND--TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCN-------------QEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTC-QCIEGFQRINGSCVDVD---ECADKIDSCKNNATCNNM-IGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYK 4882
            ++KC     C  DA C    E     C+C   F G     SC+  + C   G  +CHE+A C+     Y C CP GF+      C DIDEC   N+  C +  KCVN  G Y+C C +G +     CV   +  C S Q++K     SN  C+    +G+  C +C  G+   G +C DI+EC    A CS NA C+N  GTF+C C+ G  G+G  C D +EC +         C  +A C N +  + CEC SG++G G   IK+    +  +C+  +            +    N +  ++CEC+P F+ E +  +C+   ECE   +NCD  ++ CV  +  ++CEC  G+   G  C D +ECD      A    +A    C+N  GS  C C              +E+   + ++C   D  +     C+ + + C   ++    C  C+ G   ING+C  +     CA K D C  +A C ++   S+ C CPD    D     C D +EC    M   + +KC NT GS+ C C+ G+K
Sbjct: 1392 NTKCTSSDECGLDALC----ERRTGVCRCEPGFEGAPPKKSCVDVDEC-ATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH------PCHPHAECTNLEGSFKCECHSGFEGDG---IKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECD---RGMAGCDSMAM---CINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTAC--TDEWSR---LCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKND-CNKHAECIDIHPDSHFCSCPDGFIGD--GMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFK 1912          

HSP 4 Score: 159.844 bits (403), Expect = 5.523e-38
Identity = 181/611 (29.62%), Postives = 252/611 (41.24%), Query Frame = -1
Query: 6386 CSNDAFCDFKDDDYGCHCKNGFMG--DGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGF-EGNGVTCTNINECYPL-SPCDNATEECFDKVPGYECRCQKGFMKN------TTTGNCD----DRNECADTGNLCDRVSTNCNNTFGSYRC-DCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDG----DNP----CNTVQ--CTKPNEI------CYLGQ----CFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDE----------------CLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRF--FDNGCDDNADCINTD-GSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSC-DVNANCIDTHGSFICYCNEGY 8053
            C  DA C+ +     C C+ GF G      C D+DEC+     C  +A C+N +G ++C C  GF + +  +C +I+EC    S C  A  +C +K   Y C C+ GF+ +      TT   CD     ++ C+++   C+      +   GS  C +C  G++ S     VC D+NEC          A C N  G++ C+C  GY+GDG  CTDI+EC     C  P A C NL GS++C C  G  G DG     NP    C  V+  C + + +       Y G     C C+ GF+    +N C DIDEC+ + N+C    A C N +GSY CEC  GY                             + +GG               C DIDEC   +  CDS  A C N +GS  C+C  GY+GDG+ C +I+E                C L    C+   +            CL G+    NG+C            N C+ +A+CI+    S  C C  G+IG G  CD                                      + DEC +   C D N  C +T GSF C C EG+
Sbjct: 1401 CGLDALCERRTGV--CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCE-----VDTVDGSVECKECMGGYKKS---GKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCH-PHAECTNLEGSFKCECHSGFEG-DGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-----------------------------EGEGGV--------------CTDIDECDRGMAGCDS-MAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGA-----CLPGHHP-INGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICD--------------------------------------DVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 5 Score: 158.303 bits (399), Expect = 1.589e-37
Identity = 172/604 (28.48%), Postives = 253/604 (41.89%), Query Frame = -1
Query: 4115 CPLNANCEERLFGYICKCKPGYEGVGIK-SCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSP--CHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCR--IDSKCE---KYGGCHEDASCI-VNVE----SSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSS--NAICQ--------NKEGTYSC-QCAEGFYGDGLLCHDIDECKFGVA--NCSENALCIN-KPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECD-ENAVCKNKDPGYTCECQSGYKGTGWFCI 5842
            C L+A CE R    +C+C+PG+EG   K SC D+DEC    +NC  +  C N  G                                    Y C C +G+     G CQD++EC   +   C   A+C+N PG+Y C+C   F GD               QC                K  C+S++    + C   N  C+         CK         C  GY   G++C D++EC      C  N+ C N +G+F C+C  G+ R +  +    CTDI+EC     C  + EC N  GSFKCEC  GF GDG   C   ++  CE   K+ G  +  SC+ V +     SS+ EC+    F  +   SC+  + C  +  +    +A+C     +YRC C +G++G+G   C DIDEC +     C S+  C+N  G   C C  G       C+ I+E   +    C+   + +C+        ++E    C  C  G +     C  +          +C+++A CI+  P +  C C  G +G+G  C D DEC        A  CD EN  C+N    + C C  G+K     C+
Sbjct: 1401 CGLDALCERRTG--VCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVG-----------------------------------GYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGD-------------GYQCVP------------TTKKPCDSTQSS-KSHCSESNMSCEVDTVDGSVECK--------ECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGY-RGDGFM----CTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKES-NSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG-GVCTDIDEC-DRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNN------AGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV 1919          

HSP 6 Score: 149.058 bits (375), Expect = 1.020e-34
Identity = 171/553 (30.92%), Postives = 235/553 (42.50%), Query Frame = -1
Query: 6236 CDCKYGFRPSPIDSFVCTDVNECNLV-HECDKNYAKCTNTPGSYYCTCDSGYQ-GDGRNCTDIDECSS-NKVCQRPDATCVNLPGSYECRCLDGTPGCDG-------DNPCNTVQ-----CTKPNEICYL----GQCFCKH---GFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTG----------------------FTGHCDE-------------------------------CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVD-ENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCD-PQEGLEECGKLLC---PLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTH-GSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGD--CYDGI----CHCPSGFVFKSNKC-FDER 7630
            C C+ GF  +P     C DV+EC    H C ++ A+C N  G Y C C +G++  D  +C DIDEC+  N  C   +A CVN PG+Y C C +G  G DG         PC++ Q     C++ N  C +    G   CK    G++   +  +CEDI+EC      C+   A C N++G++ C C  GYR         N  +     H C  +AEC + +G + C+C +G                      F G  D                                C DIDEC  S NNCD   A C N+ GS+ C C EGY G+G VC++IDEC  G+  C  S   C N  G   C+C++GY  D   +C+  E E +     C D       + S LC          + C   +E + +CG  L    P+N  C +   L  SG             C  +  C+ +A CID H  S  C C +G+IGDG+ C     D D C     C D +  C + I    C C  GF     KC  DE+
Sbjct: 1414 CRCEPGFEGAPPKK-SCVDVDECATGDHNCHES-ARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLG-DGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKK--SGKVCEDINECVAEKAPCS-LNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE---RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCD-SMAMCINRMGSCGCKCMAGYTGD-GATCIKIEEEPKSDKTACTD-------EWSRLCELEK------KQCTVDEEEVPQCGACLPGHHPINGTCQS---LQISGL------------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC----DDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEK 1923          

HSP 7 Score: 131.339 bits (329), Expect = 2.392e-29
Identity = 154/505 (30.50%), Postives = 213/505 (42.18%), Query Frame = -1
Query: 6707 CSNDAFCDFKDDDYGCHCKNGFM-GDGIMCKDIDECS-NNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEEC-----------FDKVPG-YECR-CQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG---------RNCTDIDECSSNKVCQRPD-ATCVNLP---GSYE--CRCLDGTPGCDGDNPCNTVQ--------CTKPNEICYLGQ----CFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL-------HQCGENAECIDTDGGYYCQCKTGFTGH------CDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECL-LGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENE 8053
            C   A C      Y C C  GF   D   C+DIDEC+ +N++ C +NA C N  G++SC C+ GF G+G  C    +     PCD+                 D V G  EC+ C  G+ K+     C+D NEC      C  ++ NC N  G++ C CK G+R    D F+CTD+NEC+  H C   +A+CTN  GS+ C C SG++GDG         R+C D++     K C R D  +C+++    GS    C C  G       N C  +         C   + +C   +    C C  G++      +C DIDECD     C    A C N  GS  C+C+ GY       I        D           C    +    D     QC     GH      C   +    CA   N+C+      +    S  C C +G+ GDG +C ++DEC   G+  C   +  C N  G F C CL G+K       VDE +
Sbjct: 1442 CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTK----KPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKV--CEDINECVAEKAPC-SLNANCVNMNGTFSCSCKQGYRG---DGFMCTDINECDERHPCHP-HAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVE-----KFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGE--GGVCTDIDECDRGMAGCDSM-AMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCA-QKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGM--CDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKK 1924          

HSP 8 Score: 127.487 bits (319), Expect = 2.884e-28
Identity = 157/538 (29.18%), Postives = 225/538 (41.82%), Query Frame = -1
Query: 1235 SDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHGF-SLQGGYCNDINECLIPNS--CGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDR-CQVLNGADSVCYDLPIGYACVCPDGFVN-------DEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDG-DCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYD-CIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQ---CYCNRGFVMIENSTKCVDIDECQ-FPNSC--LDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGG---------------------------------------------KSYNP----CQSVN---ECVKLNITCPSNAQCVD-RSNGYECICKDGYQEDQIGICRNINECQIEDSCH-YLADCLDTDGSYKCTCKYGYK 2626
            SD C ++++C+ +     C+C+PGF+ +     +C D+DEC T   +C       C N  G + C CP GF     G C DI+EC   NS  CG N+ C N    ++C C NG   L +G      +C+    + C     + S C +  +       DG V         +   +VCE+ NEC      C   N+ CV+  G+F C CK G+    DG  C D +EC+     +     + +C N  G F C+C  GF  +    C +  E S + V       D V+   +    G     C C  GF   + S  CVDIDEC+   N+C     +C N  GS+ C C  GY+   G CTDI+EC      C   A  +CIN  GS  CKC  GY   G                                                ++P    CQS+     C + N  C  +A+C+D   + + C C DG+  D + IC +++EC     C      C +T GS+ C C  G+K
Sbjct: 1398 SDECGLDALCERRTG--VCRCEPGFEGAPPKK-SCVDVDECATGDHNCHESAR--CQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGF--LGDG-----YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSL-NANCVNMNGTFSCSCKQGY--RGDGFMCTDINECDERHPCHP----HAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMA--MCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKN-DCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFK 1912          

HSP 9 Score: 122.479 bits (306), Expect = 1.105e-26
Identity = 126/413 (30.51%), Postives = 188/413 (45.52%), Query Frame = -1
Query: 1352 NLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLI-PNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVND--EVFPQVCENQNECEINIHSCQASNSEC-VDTY-GSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFV---------MIENSTKCVDIDE-CQFPN--SCLDGLCNNLPGSFECLCNIGYDL--VNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQED 2533
            N  C   DEC     C      +C   PG FE   P         C D++EC    ++C +++ C N V G+ C C  G R+  +G C+ I+EC E+   C    GA++ C + P  Y+C C +GF+ D  +  P   +  +  + +   C  SN  C VDT  GS +C    G  K S   C D +EC ++E++      N  C+N  G F+C C +G+  + + C D++EC               +  C N  G F+C C+ GF           +E S  C D+++ C   +  SCL     N   S  C C  G+     +  C DI+EC  +   C P A+ +C+N  GS++C+C  GYE  GG     C  ++EC +    C S A C++R     C C  GY  D
Sbjct: 1392 NTKCTSSDECGLDALCERR-TGVCRCEPG-FEGAPPKK------SCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC---CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINEC-VAEKAPCSL--NANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-------HPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERS--CEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDP-ASAVCVNTEGSYRCECAEGYEGEGGV----CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGD 1776          

HSP 10 Score: 121.324 bits (303), Expect = 2.073e-26
Identity = 144/500 (28.80%), Postives = 207/500 (41.40%), Query Frame = -1
Query: 5669 HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS------VCSEIDECLLGLHNCSRSHQFCFNVNGGFEC--RCLSGYKSDTNGSCVDENECRFFD-NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTNQCINTDECESQ-TSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQE-NSICFNRFGSYDC--------KCPPNYLDVFKDGKVCMAVPLSQCNQSCPTG----QYCNNGSCSCLMGL---NSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC 7069
            H C   A+C +T G Y C+C  G+ G+  EC DIDEC+  L +   + + C N  G++ C C +G++  G+       C++I+EC  G HNC  + + C N  G F+C  +C  GY+   +G C D NEC     + CD  ADC+NT G + C C  G+ G G+NC P+    +    +C  +A C  V   C CK+GY      C + +EC+++ T C     C++  G ++C C  G   D   C K   D  A     +C+ G      C +  C C  GF    +K                                      +C+DI+EC EN   C      C N FG + C        +C                   +   +    G    Q  + GS +   GL   + +    G L C+          CP N+ C     G  C+C  GY G  +  C DIDEC  +I N   NE C N  G F C
Sbjct:  140 HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRK-NSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQ--DDATCIK---DQGA-----FCSGGCGDNAICSNATCACIDGFRGDPHK--------------------------------------KCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTS--------YCPPNSEC----VGGYCECVSGYGGNALVGCEDIDECITEICNIEANEWCVNLIGGFVC 575          

HSP 11 Score: 117.472 bits (293), Expect = 3.055e-25
Identity = 144/500 (28.80%), Postives = 200/500 (40.00%), Query Frame = -1
Query: 6764 TCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDK-----VPG-YECRCQKGFMKNTTTGN----CDDRNECADTGNLCDRVSTNCNNTFGSYRC--DCKYGFRPSPIDSFVCTDVNEC--NLVHECDKNYAKCTNTPGSY---------------------------------------YCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCT------KPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH---------QCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNGGFEC 8056
            TCS    C +      C+C +GF G     +D +EC  +   C   A C+NT+GS+ C C  G+EGNG  CT+I+EC      D  T  C +      +PG Y C C +GF      G+    C D NEC    + CD     C N+ GS++C   C  G+    +    C DVNEC    +H+CD   A C NT G Y                                        C C +GY GDG  C DI+EC +          C+NL G Y C C +G      D  C   Q          N IC    C C  GF+ +     C DI+EC    + C G   +C NL G ++C C +G   +       + +    + H         Q  E +  I T  G       G        +D++        C S        +G + C C  GY G+  V C +IDEC+  + N   ++++C N+ GGF C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS-----DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCD-ADEICENSIGSFKCVNKCSPGYE---LIDGKCEDVNECGSEKLHKCDVR-ADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNG----QDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIP-----KDVELTTSGRLACTSYCPPNSECVGGY-CECVSGYGGNALVGCEDIDECITEICNI-EANEWCVNLIGGFVC 575          

HSP 12 Score: 115.546 bits (288), Expect = 1.239e-24
Identity = 151/538 (28.07%), Postives = 230/538 (42.75%), Query Frame = -1
Query: 1355 CHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNC-SINSVCQDKADGFSCQCKPGFKWS-----DETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECV-CPHGFSLQGGYCNDINECLIPNS-CGQNSVCANTVSGFNCSCANGARQLPNGD---CELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSC-QASNSECVDTY---GSFK--CVCKPGFS-KNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGF-------VMIE-----NSTKCVD--------------IDECQFPN--SCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQE 2830
            C C  G+   P  + C++ +EC    +++C E+A C +  G Y C C +GF++   G C++I+EC E +  C   N+ C +K   +SC+C+ GF          T   C+      +  S S+M   +   + GS EC  C  G+   G  C DINEC+   + C  N+ C N    F+CSC  G R    GD   C  INEC E    C       + C +L   + C C  GF  D +       +  CE     C +  +  C+      GS    C C+PGF  +     CVD DECE  E  N     +  C+NT G + C+C EG+      C D+DEC           CD +   CIN +G   C C  G+       + IE     + T C D              +DE + P   +CL G  + + G+ + L       ++G C   N+C+ +++        I I+    F C C  G+   G      C  V+EC    +    N +C +    + C+C +G+++
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECAT-GDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVD-GSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYR----GDGFMCTDINECDER-HPCH----PHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECE--ESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMA-----GCDSM-AMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGH-HPINGTCQSL------QISGLCAQKNDCNKHAEC-------IDIHPDSHF-CSCPDGFIGDG----MICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKK 1913          

HSP 13 Score: 115.546 bits (288), Expect = 1.381e-24
Identity = 148/499 (29.66%), Postives = 206/499 (41.28%), Query Frame = -1
Query: 6404 RCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPD-ATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYEC--ECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGF---------------------------------ECRCLSGYKSDTNGSCVDENECRFFDNGCDDNAD-CINTDGSFLC--------------------------------------------ICRAGYIGSGRNCDPQE-GLEECGKLL----CPLNALCVNSTCLCKSGY-ENSTNQCINTDECESQTSCDVNAN--CIDTHGSFIC 7633
            +C C  GF  S  +     D NEC L H C    A+C NT GSY C C  GY+G+G  CTDIDECS     + P+ + C+NLPG+Y C C  G                           F   G Q +   + C DI+EC+T A++C   +  C N  GS++C  +C  GY +    K  +      + LH+C   A+C++T GGY C+C+ GF G    C+    C  +   CD   A+C   I    C C  GY+GDG  C +I+EC      CS   + C N++GG+                                  C C+ G++ D +  CVD NEC   D+ C    D C+N  G F C                                                G I   R   P++  L   G+L     CP N+ CV   C C SGY  N+   C + DEC ++  C++ AN  C++  G F+C
Sbjct:  117 QCYCDSGFSGSACE---LQDKNEC-LEHPCHM-MAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQG---------------------------FTPKGNQGS-GLDKCADINECETGAHNCDADEI-CENSIGSFKCVNKCSPGYELID-GKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDR-HASCH--IVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGR-CLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 14 Score: 110.538 bits (275), Expect = 4.706e-23
Identity = 159/529 (30.06%), Postives = 215/529 (40.64%), Query Frame = -1
Query: 3482 SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCE-KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF-----QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCV--CGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-NDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDK------NECDPTSPDFAAQ-KCLASGGGCLNTKGSFVCTCNQEQMNEN-----------NSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLD 4981
            +C+  G C       +C C  GF G     C +  K E     CH  A C   + S  YEC+C   + G+G   C   + C     S C E++ C  +  TY C C  GF     QG G + C DI+EC     HNC + E C NS G + CV  C  G   +D  C D++EC S + +KC   A C N  G Y C+C EGF GDG  C     C+   A C  +A C        C+C+ G  G+G TC D +EC   K +P    C +   C N D GY C C++G       CIK         C  N  C      S A C C   F+ + +  C+   EC      C      CV L  GFKC C+ G       C D+      +       DF    + +  G G + T      T  +  + ++            S C P   C  G                    C+C+ G+    + G C D+DEC  +I + + N  C N+IG +VC  P N   D
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSA---CELQDKNECLEHPCHMMAQCQNTLGS--YECRCLPGYEGNG-HECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECET-GAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC--HIVLDICDCKTGYTGDGITCHDINECDA-KDTP----CSDGGRCLNLDGGYVC-CKNGQDDA--TCIKDQGAFCSGGCGDNAIC------SNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHGSTEA--ECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY-------------------CECVSGYGGNALVG-CEDIDECITEICNIEANEWCVNLIGGFVCCNPTNATHD 584          

HSP 15 Score: 107.842 bits (268), Expect = 2.925e-22
Identity = 84/244 (34.43%), Postives = 117/244 (47.95%), Query Frame = -1
Query: 1214 CDCPEGF--IYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSC---LDGLCNNLPGSFECLCNIGYDLVNGKCTDINEC------SNNSQICGPQAAGICINAAGSFQCK-CNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSC 1909
            C C  GF        C+DVDEC+         NC + +  C N VGG+ C+C  GF   ++ + C DIDEC   NS     +  C N PG++ C C  G+     +C    +       S+ S       +       GS +CK C  GY+ SG      C+ +NECV     C  NA CV+ +  + C CK GY+ D   +C +INEC     CH  A+C + +GS+KC C  G++GDGI  C
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGD-----HNCHE-SARCQNYVGGYACFCPTGFRKADDGS-CQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSG----KVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKC 1645          

HSP 16 Score: 104.375 bits (259), Expect = 3.031e-21
Identity = 120/357 (33.61%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 1142 VNDEVFPQVCENQNECEINIHSCQAS---NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENS----TKCVDIDECQ--FPNSCLDGLCNNLPGSFECL--CNIGYDLVNGKCTDINEC-SNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDS-CHYLADCLDTDGSYKCTCKYGYK-----GDGIVSCKAICGPNSCLPGQLCQIVNGNQYD 2158
            ++DEVFP  CE         H CQ++      C+      +C C  GFS  S  +  D +EC +    +M      +C NT G + C C  G+  N ++C D+DECS      L   C + +  CIN  G + C C +GF    N      KC DI+EC+    N   D +C N  GSF+C+  C+ GY+L++GKC D+NEC S     C  +A   C+N  G ++C+C  G+E  G      CQ  + C K +  C  +A C    +   C CK GY  D I  C +INEC  +D+ C     CL+ DG Y C CK G        D    C   CG N+      C  ++G + D
Sbjct:   87 MHDEVFP-YCE---------HKCQSTCSGKGACLYDGAKPQCYCDSGFS-GSACELQDKNEC-LEHPCHMM----AQCQNTLGSYECRCLPGYEGNGHECTDIDECS----DKLTSRCPE-HSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRAD--CVNTIGGYECECEEGFEGDGKN----CQPKSSCRKNSAICDRHASCHIVLD--ICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGD 412          

HSP 17 Score: 104.375 bits (259), Expect = 3.057e-21
Identity = 129/475 (27.16%), Postives = 191/475 (40.21%), Query Frame = -1
Query: 5018 SDSSQCIDIDECNENVDDC-QENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSK---------------NSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEG---------------------------------------------------SFTCSCKRGYSRNSSSGLC-------ETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNEC-QTQSPCHILAQCINTPGSYKCQCPENFYGDPQN-KCFEDKCKTKALQC--QAGEVCKLSLYGSVCEKISCNSSEILINN--ECLP----VNQVCQNI----------NCGNHAFC-KIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTD 6148
            +D   C DIDEC E+   C   N+ C N+ G+Y C+C   +L    DG  C+      C+ +  +  +C+  + SC +        DG++ C +               N        C LNANC      + C CK GY G G   C DI+EC  + + C  + +C+N EG                                                   S  C C+ G+     S  C       E+ N C+  S  +C     +Y C+C  GYE    G+C D++EC +  + C  +A CIN  GS  C+C   + GD       E++ K+    C  +   +C+L       EK  C   E  +     CLP    +N  CQ++          +C  HA C  I      C C  G+ GDG +C DVDEC+N  +    N+ C+N  GSF+C C  GF++++   V D
Sbjct: 1466 ADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLG---DGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-----DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFM-CTDINECDER-HPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPAS-AVCVNTEGSYRCECAEGYE-GEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCEL-------EKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVD 1921          

HSP 18 Score: 98.9821 bits (245), Expect = 1.362e-19
Identity = 118/357 (33.05%), Postives = 168/357 (47.06%), Query Frame = -1
Query: 2420 DRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIK-THPCHDLARCSNVPGSCKCKCQPGFT-----GDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCN-CTNGYEDSNQMECIGDVCYKKCSDIDECVTRK-SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQI-CLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHG 3460
            D+NEC E+P  C  +++C NT GSYEC+C+ GY+ NG  C DIDEC+ K T  C + ++C N+PG+  C C  GFT     G G+  C + + C       C     C N IG+F   N C+ GYE          +   KC D++EC + K   C   A+C N  G Y C C     GDGK  C+ ++ C   +  C+ + S    LD          C C  GY    G  I C + NEC +  +  C +   C++ +G Y C CK+G       K    ++    S  C  N++C +     +C C  GF+   + +  C DI+EC    S        C+N  G F+C C HG
Sbjct:  133 DKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAH-NCDADEICENSIGSFKCVNKCSPGYE----------LIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGK-NCQPKSSCRKNSAICDRHASCHIVLD---------ICDCKTGYT---GDGITCHDINEC-DAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIK----DQGAFCSGGCGDNAICSNA----TCACIDGFRG--DPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 19 Score: 95.1301 bits (235), Expect = 2.200e-18
Identity = 100/289 (34.60%), Postives = 135/289 (46.71%), Query Frame = -1
Query: 3890 KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGF-----YGDGL-LCHDIDECKFGVANCSENALCINKPGTFAC--ECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA-CKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPG 4729
            +S+C     C    A  +C C  GF G       D +EC     H C  + +C N+ G Y C C  G       C DIDECS   T++C  ++ C N  GTY C C +GF      G GL  C DI+EC+ G  NC  + +C N  G+F C  +C  G       C D +EC    GS    +CD  A C N   GY CEC+ G++G G  C  ++ C   +A C  + +C       L IC+CK  +  +  TC    EC+ K   C  +   C+ LD G+ C CK G
Sbjct:  100 QSTCSGKGACLYDGAKPQCYCDSGFSGSACEL-QDKNECLE---HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNEC----GSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASC----HIVLDICDCKTGYTGDGITCHDINECDAKDTPC-SDGGRCLNLDGGYVC-CKNG 374          

HSP 20 Score: 89.7373 bits (221), Expect = 8.784e-17
Identity = 115/346 (33.24%), Postives = 151/346 (43.64%), Query Frame = -1
Query: 3758 SCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSL-----EKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTC-GDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDV-PNACKANQTCTPSNENSLAICECKPDFKLEND---TCIPKTECENKTDNCDRETSNCV-------QLDPGFKCECKPGFN----MVGN-TCQDKNECDPTSPDFAAQKC--LASGGGCLNTKGSFVCTC 4723
            +CH  A CEQ  +T  CIC DGF GDG   C      +  +T +C SL     +K    N   +C C  G +    +C    +    + N CS  A+CQN+     CQC  GF GDG+ C  I E     + C  NA C+   G   C+C  G  GNG  C  D  +C    G      C  NAVC ++     C+C SG+ G G  C  Q  C    + C  N  C P+       C C+  FK +     + +   E  N+ D  D   S+CV       QL    +C CK GF     + G+ TC D +EC   S      KC  +A+   C NT GS VCTC
Sbjct: 2028 TCHSLATCEQ--STGVCICRDGFIGDGTTAC------SKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRR----CQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGI-----CHPNAVCNSES--RQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGS-----CICRHGFKGDPFYKCSSLVSKEPANQQDLSD--VSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKS-----HKCDRVAT---CRNTFGSHVCTC 2336          

HSP 21 Score: 87.8113 bits (216), Expect = 3.357e-16
Identity = 62/174 (35.63%), Postives = 83/174 (47.70%), Query Frame = -1
Query: 15758 TSGCVCNDGFLRSGTTCTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECR-CKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNG 16276
            T  C C +GFL  G  C P  +  C   D+              S+K+ CS +N               C   T  G  EC+ C  GY+     C DI+EC      CS N +CVN  GT++C CK G+ G+G  CTD NEC+ +   C  +A C N  GS+KC C +G+EG+G
Sbjct: 1497 TYSCECENGFLGDGYQCVPTTKKPC---DSTQ------------SSKSHCSESNM-------------SCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHP-CHPHAECTNLEGSFKCECHSGFEGDG 1641          

HSP 22 Score: 85.5001 bits (210), Expect = 1.779e-15
Identity = 115/388 (29.64%), Postives = 164/388 (42.27%), Query Frame = -1
Query: 5441 CLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDAC--QIENYCTD--------GDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDC--KCPPNYLDVFKDGK-----VCMAVPLSQCNQSC----PTGQYCNNGSCSCLM-GLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCN--CGSHGICGPNYICQCKSGYEINPSGMCQDVNEC-QTQSPCHILA-QCINTPGSYKC 6526
            C C SG+  S  +  + +EC  +  C + A C +T GS+ C C  GY G+G  C    TD D C  ++ + C +        G  Y   C+C  GF  K N+                                  S   +C DI+EC     +C  + IC N  GS+ C  KC P Y  +  DGK      C +  L +C+         G Y           G N Q       +C KNSA     IC  +A+C   +   IC CK GY G GI +C DI+EC  K   C+    C N +G + C CK G  ++ ++ + +    C+  CG + IC  N  C C  G+  +P   C D+NEC +  S C  +  +C+N  G +KC
Sbjct:  118 CYCDSGFSGSACELQDKNEC-LEHPCHMMAQCQNTLGSYECRCLPGYEGNGHEC----TDIDECSDKLTSRCPEHSKCINLPGTYY---CNCTQGFTPKGNQ---------------------------------GSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELI--DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKS----SCRKNSA-----ICDRHASC--HIVLDICDCKTGYTGDGI-TCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNG--QDDATCIKDQGAFCSGGCGDNAICS-NATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 23 Score: 84.7297 bits (208), Expect = 2.868e-15
Identity = 151/590 (25.59%), Postives = 218/590 (36.95%), Query Frame = -1
Query: 1646 DIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV----KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYEC--RCKSGFKQLPSGKCENINEC-EEKSDNCSINSVCQDKADGFS---------------------------------------CQCKPGFKWSDETNLNCEDIDEC-TNPTSCSSMPHSICMNNPGSFECVCPHG------FSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDE-----------------------------------------------VFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDV------------DECSLDQVSSLADNCDQVNGHCINTVGGF---QCYCNRGFVMI-ENSTKCVDIDECQFPNSCLD----GLCNNLPGSFE 3055
            D +EC+  +  CH  A+C N  G+Y C C     G+G   C D +EC+      +  TS C      +N+   + C+C  G+     +  G   C + NEC     N C  + IC ++ GS++C  +C  G+ +L  GKCE++NEC  EK   C + + C +   G+                                        C CK G+       + C DI+EC    T CS      C+N  G + C C +G         QG +C+          CG N++C+N      C+C +G R  P+  C  INEC+EN   C    G    C +L  G+ C C  G    E                                               + P+  E      +   S    NSECV  Y    C C  G+  N+   C D DEC I+E  N++   N  C+N  GGF C  P    ++  DCI++            +E ++    S     DQ+    +     F   Q    RG V   E  T+  D DE     S  D    G    LP + E
Sbjct:  133 DKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHE-CTDIDECS------DKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHN-CDADEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGD---GITCHDINECDAKDTPCSDGGR--CLNLDGGYVC-CKNGQDDATCIKDQGAFCS--------GGCGDNAICSNAT----CACIDGFRGDPHKKCVDINECVENDSVC---GGVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGY----CECVSGYGGNALVGCEDIDEC-ITEICNIEA--NEWCVNLIGGFVCCNPTNATHD--DCIEITKEKGLHVIGGNEEDTVVATRSNHSTSDQLITQVVQQSRNFSTGQIILTRGKVSSGEAVTQTTDADEFGLEISAADLAGSGSGITLPTTLE 680          

HSP 24 Score: 83.1889 bits (204), Expect = 7.645e-15
Identity = 119/372 (31.99%), Postives = 159/372 (42.74%), Query Frame = -1
Query: 2828 KCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--QRINGS----CVDVDECADKIDSCKNNATCNNMIGSYVC--KCPDNLKLDLSKKACTDRNEC-QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENL-DNTVNVLAPFQC 3910
            +C C  GF+      QDKNEC        AQ        C NT GS+ C C       N   C  ID C+  L +   +   CI+    +Y C C +GF  +   GS    C D++EC     +C  +  C N IGS+ C  KC    +L   K  C D NEC  E    C   + C+NT G YEC+C  G++ +G NC+    C   +  C   A C  V   C CK   G+TGDGI +C + + C A+ D  C  G  C N+ G ++ C   NG +D+  ++  G  C   C D              A C+N      C C     GD    C D NEC         N S C  + D  VN+   F+C
Sbjct:  117 QCYCDSGFSGSACELQDKNECLEHPCHMMAQ--------CQNTLGSYECRC-LPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLP-GTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGK--CEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKT--GYTGDGI-TCHDINECDAK-DTPCSDGGRCLNLDGGYVCCK--NGQDDATCIKDQGAFCSGGCGD-------------NAICSN----ATCACIDGFRGDPHKKCVDINECV-------ENDSVCGGVGDRCVNLFGGFKC 446          

HSP 25 Score: 80.8777 bits (198), Expect = 3.852e-14
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = -1
Query: 15632 CRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFV-GNGLNCTDFNEC-ESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC---SQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTC 16036
            CRC+ G+EG     +C D+DEC+ G + C ++  C N +G Y C C TGF   +  +C D +EC E  +  C A A C N  G+Y C C+NG+ G+G  C   ++ P  +    +++CS   + SC+     VD  DGS  C
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCS-ESNMSCE-----VDTVDGSVEC 1549          

HSP 26 Score: 79.7221 bits (195), Expect = 9.684e-14
Identity = 106/335 (31.64%), Postives = 140/335 (41.79%), Query Frame = -1
Query: 4256 CGNHAFCKIENGRADCFCDSGYYGDGELCV-DVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLS-ESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGG-CHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-----CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTC 5236
            C + A C  +N    C CD+GY GDG +C     +C   D  C   + CQN+     C C  GF    + +    C  I E   +   C  N  C   +G   C+C  G+ G+G         C  + G CH +A C  N ES   +CQC + FSG+G+ SC     C  + KS C +NAIC     T  CIC  GF+GD +              + CSSL     +N Q                 D+ + SS  T   SS  +C + E    C C  GF  +  L     C DIDEC      C   A C N  G+  C C  G +G+G TC
Sbjct: 2071 CADKAKC--DNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNR----RCQCLPGFTG--DGV---KCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVC--NSES--RQCQCSSGFSGNGV-SCFPQKSCRTD-KSVCAKNAICL---PTGSCICRHGFKGDPF--------------YKCSSLVSKEPANQQ-----------------DLSDVSSCVTPCDSSTQLCISGE----CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2347          

HSP 27 Score: 78.9518 bits (193), Expect = 1.656e-13
Identity = 135/502 (26.89%), Postives = 193/502 (38.45%), Query Frame = -1
Query: 1256 CMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNG-DCELINECLENI-DRCQVLNGADSVCYDLPIGYACVCPDGFV---NDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCV--CKPGFSKNSDGDCVDYDECEISEQSNMKFCN-NGKCINTAGGFT---------------------------------------CDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSCLD-GLCNNLPGSFECLCNIGYDL-VNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVG------------------------YENSGGKSYNPCQSVNECVKLNIT-----------------------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLAD--CLDTDGSYKC 2464
            C+ +    +C C  GFS       D NECL  + C   + C NT+  + C C  G     NG +C  I+EC + +  RC       S C +LP  Y C C  GF    N       C + NECE   H+C A +  C ++ GSFKCV  C PG+ +  DG C D +EC       +  C+    C+NT GG+                                        CDC  G+  +   C D++EC         D      G C+N  GG+ C C  G    ++   C+  D+  F    C D  +C+N      C C  G+    + KC DINEC  N  +CG      C+N  G F+C C  G                        +  +G +      S+      +IT                       CP N++CV    GY C C  GY  + +  C +I+EC I + C+  A+  C++  G + C
Sbjct:  109 CLYDGAKPQCYCDSGFSGSACELQDKNECL-EHPCHMMAQCQNTLGSYECRCLPGYEG--NGHECTDIDECSDKLTSRCP----EHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDA-DEICENSIGSFKCVNKCSPGY-ELIDGKCEDVNECG---SEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDA------KDTPCSDGGRCLNLDGGYVC-CKNG----QDDATCIK-DQGAFCSGGCGDNAICSNA----TCACIDGFRGDPHKKCVDINECVENDSVCG-GVGDRCVNLFGGFKC-CQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECV---GGY-CECVSGYGGNALVGCEDIDEC-ITEICNIEANEWCVNLIGGFVC 575          

HSP 28 Score: 76.6406 bits (187), Expect = 6.653e-13
Identity = 42/104 (40.38%), Postives = 56/104 (53.85%), Query Frame = -1
Query: 15740 SECRCKKGY--EGRADNCTDIDECSRGSYVCS-DNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 16042
            S C C+ G+  E  +++C DIDEC      C   +  CVN  G+Y C C  G+ G G  CTD +EC+   A C + A C N  GS  C C  GY G+G+ C +I
Sbjct: 1680 SVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKI 1783          

HSP 29 Score: 76.6406 bits (187), Expect = 7.174e-13
Identity = 107/398 (26.88%), Postives = 139/398 (34.92%), Query Frame = -1
Query: 3380 CSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC--ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYV---------------------------------CKCPDNLKLDLSKKACTDRNECQENPMICGDLS-KCLNTDGSYEC 4465
            CS    C        C C  GF G      D +EC      C   A C N  G++ C C  G  GNG  C D DEC     S     C E++ C N    Y C C  G+                         TP       +           D C    ECE    NCD +   C      FKC  +C PG+ ++   C+D NEC          KC      C+NT G +     +E    +  +C+P  SC      CDR    C    D    C C  G+     +C D++EC  K   C +   C N+ G YV                                 C C D  + D  KK C D NEC EN  +CG +  +C+N  G ++C
Sbjct:  103 CSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECL--EHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTS----RCPEHSKCINLPGTYYCNCTQGF-------------------------TPKGNQGSGL-----------DKCADINECETGAHNCDAD-EICENSIGSFKCVNKCSPGYELIDGKCEDVNECG----SEKLHKCDVR-ADCVNTIGGYE-CECEEGFEGDGKNCQPKSSCRKNSAICDRHA-SCHIVLD---ICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKK-CVDINECVENDSVCGGVGDRCVNLFGGFKC 446          

HSP 30 Score: 76.2554 bits (186), Expect = 8.995e-13
Identity = 109/362 (30.11%), Postives = 147/362 (40.61%), Query Frame = -1
Query: 5996 YCQCKTGFTGHCDEC---RDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCS-EIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNC--DPQEGLEECGKLLCPLNALCVNST--CLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGI----NCFKKD-------TDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM 7021
             C C+ GF G        +   +C  SL +  +D+A C+NS  S  C C+ GY GDG VCS    +C+L  + CS     C N      C+CL G+  D    CV  +E     + CD NA C+   G   C C  GY G+G  C  DP + +   G  +C  NA+C + +  C C SG+  +   C     C +  S C  NA C+ T GS  C C  G+ GD      +   K+       +D  +C      +   C  G C C SGF   S                                    S S  C DIDEC E    C   + C N FGS+ C CP  ++    DG  C+
Sbjct: 2041 VCICRDGFIGDGTTACSKKSTADC-ISLPSLCADKAKCDNSTRS--CECDAGYIGDGYVCSPHPQDCVLRDNLCS-PEAVCQN----RRCQCLPGFTGD-GVKCVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGNGLCCVPDPLDCVHFTG--ICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GS--CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTL----------------------------------SGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVG---DGITCV 2348          

HSP 31 Score: 72.0182 bits (175), Expect = 2.048e-11
Identity = 80/245 (32.65%), Postives = 110/245 (44.90%), Query Frame = -1
Query: 7457 CSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTN--------INECYPLSPCDNATEEC-----FDK-----VPGYECRCQKGF-MKNTT---TGNCDDRN----------------ECADTGNLCDRVS--TNCNNTFG---SYRCDCKYGFRPSPI--DSFVCTDVNEC-NLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNC 8053
            CS +A C  +     C C  GF GDG+ C  I E ++N S CD+NA C   +G  +C C  G+ GNG+ C             C+P + C++ + +C     F        P   CR  K    KN     TG+C  R+                E A+  +L D  S  T C+++     S  C CK GFR +     S  C D++EC    H+CD+  A C NT GS+ CTC  G+ GDG  C
Sbjct: 2111 CSPEAVCQNRR----CQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDR-VATCRNTFGSHVCTCPDGHVGDGITC 2347          

HSP 32 Score: 70.8626 bits (172), Expect = 3.970e-11
Identity = 62/197 (31.47%), Postives = 95/197 (48.22%), Query Frame = -1
Query: 9254 GESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD--PVNSLVIGSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECS-LNSSICDANADCINTYGSYICNCKPGFRGSG 9829
            G  +S++   + S ++  SSA       +   T+LP ++   K  P  D   + +   G+   + S ++  +C T+  +C L A C       RC+   G++G          +SC+D DECA     C  ++ C N  G + C C  GF KA    C DI+EC+  NS+ C ANA C+N  G+Y C C+ GF G G
Sbjct: 1328 GTEESTLPPTEGSGESTTSSAP-----TVEPATVLPPQNRNEKPEPTKDTFALPTTTTGAPQANDSSVENTKC-TSSDECGLDALCERRTGVCRCE--PGFEGA------PPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDG 1510          

HSP 33 Score: 69.3218 bits (168), Expect = 1.251e-10
Identity = 92/329 (27.96%), Postives = 121/329 (36.78%), Query Frame = -1
Query: 4889 LPGICPLNANCEERLFGYICKCKPGY-----EGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQS--PCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC 5854
            L   CP ++ C      Y C C  G+     +G G+  C DI+EC    +NC  +E C N+ GSF C                                 + +C  GYE+   G C+DVNEC ++    C + A C+NT G Y+C+C E F GD +N             CQ               K SC  +  +                C  HA C I      C C +GY GDG  C D++EC   D  C +   C N DG + C         +N     +C        S  C  N  C N      C C DGF GD    C
Sbjct:  180 LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKC---------------------------------VNKCSPGYELI-DGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKN-------------CQP--------------KSSCRKNSAI----------------CDRHASCHIV--LDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCC--------KNGQDDATCIKDQGAFCSGGCGDNAICSNAT----CACIDGFRGDPHKKC 417          

HSP 34 Score: 66.6254 bits (161), Expect = 7.148e-10
Identity = 53/174 (30.46%), Postives = 70/174 (40.23%), Query Frame = -1
Query: 9254 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLG---------------------------------------------GNEMYSNGRSCIDDDECALLKC---PSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9631
            D NEC    H C  HA CTNL+  F+C+C  G++G G                                             G        SC+D DEC   +    P+++ C NT GS+ C C  G+ +    VC DI+EC    + CD+ A CIN  GS  C C  G+ G G
Sbjct: 1606 DINECDER-HPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGY-EGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG 1777          

HSP 35 Score: 65.4698 bits (158), Expect = 1.921e-9
Identity = 91/365 (24.93%), Postives = 139/365 (38.08%), Query Frame = -1
Query: 4109 ENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCE---KYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCI------------------------NKPG-----------------------TFACECQAG-----TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQ 5038
            E  + + + T+      + +C +   C+ + G   C C+DGFIGDG   C   S  +       C + A C    ++S   C+C   + GDG         C +   + C   A+C+      RC C  GF GDG   C  I E A+    NCS  +   +  G   C C  G       CV       + T  C  NA+C ++  +  CQC+ GF G+G+ C     C+   + C++NA+C+                         +P                        +  C C++G     TL    TC D DEC +      + +CD  A C+N    + C C  G+ G G  C+  
Sbjct: 2009 EEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGV--CICRDGFIGDGTTACSKKSTADCISLPSLCADKAKC----DNSTRSCECDAGYIGDGYVCSPHPQDCVLR-DNLCSPEAVCQN----RRCQCLPGFTGDGVK-CVSIHERAS----NCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSE--SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEK-----SHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPH 2350          

HSP 36 Score: 65.0846 bits (157), Expect = 2.071e-9
Identity = 73/261 (27.97%), Postives = 107/261 (41.00%), Query Frame = -1
Query: 2900 CQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC-PDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDG-----SYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSC---IETDSCPARD--DVK-----CPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETH 3634
            CQC+ GF      CV + E A     C  NA C   +G   CKC P      L          C  +P+ C   +   + +      S +CQC +G+  NG +C     C      C   A C  +P +  C C+ GF GD  Y C   +  +    +D  DV      C + +   + G    C C +G+  ++ +        + C+DIDEC  +   C + A C N  G++VCTCP    GDG T     N+  L  +
Sbjct: 2122 CQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLC---------CVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC--LP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGE---CICKSGFRRNSTLSG-----SETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVY 2359          

HSP 37 Score: 64.6994 bits (156), Expect = 3.149e-9
Identity = 49/179 (27.37%), Postives = 71/179 (39.66%), Query Frame = -1
Query: 9254 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK---CPSTSDCTNTPGSFICNCHVGFV-------------------------------------------------KAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSG 9634
            +D +EC+T  H+C   A C N   G+ C C  G++        ++  SC D DEC       C + + C N PG++ C C  GF+                                                 K +  VC DINEC    + C  NA+C+N  G++ C+CK G+RG G
Sbjct: 1430 VDVDECATGDHNCHESARCQNYVGGYACFCPTGFR-------KADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDG 1601          

HSP 38 Score: 63.1586 bits (152), Expect = 9.924e-9
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = -1
Query: 15575 VCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 15961
             CS  G C+       C C +GF G+     D NEC      C   A C NT GSY+C C  GYEGNG  C+ I           CS    + C + + C++   G++ C+CT+G    G QG+    C
Sbjct:  102 TCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHP--CHMMAQCQNTLGSYECRCLPGYEGNGHECTDI---------DECSDKLTSRCPEHSKCIN-LPGTYYCNCTQGFTPKGNQGSGLDKC 218          

HSP 39 Score: 62.3882 bits (150), Expect = 1.353e-8
Identity = 95/354 (26.84%), Postives = 136/354 (38.42%), Query Frame = -1
Query: 1220 ACVCPDGFVNDEV-------------FPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQ--VNGHCINTVGGFQCYCNRGFVM-----IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSN-AQCV---DRSNGY----ECICKDGYQEDQI----GICRNINEC-QIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIV 2182
             C+C DGF+ D                P +C ++ +C+ +  SC+       D Y     VC P        DCV  D     E      C N +C          C  GF  +   C+ + E         A NC Q   N HC   VGG  C CN G+       + +   CV       PN+    +CN+   S +C C+ G+      C     C  +  +C   A  IC+       C C  G++   G  +  C S+      N    S+ + CV   D S       ECICK G++ +        C +I+EC +    C  +A C +T GS+ CTC  G+ GDGI 
Sbjct: 2041 VCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGY-----VCSP-----HPQDCVLRDNLCSPEA----VCQNRRC---------QCLPGFTGDGVKCVSIHE--------RASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNA----VCNSE--SRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNA--ICLPTG---SCICRHGFK---GDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2346          

HSP 40 Score: 60.077 bits (144), Expect = 7.412e-8
Identity = 49/142 (34.51%), Postives = 69/142 (48.59%), Query Frame = -1
Query: 14024 LPWSERQCNS--SYPGFCEYVNTPCAKDSDCNKDG--ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKT-----DFVRLNNGTCQNKLFCLGDADCAKSGKCFQNLCSCNLGFEGDGKLLC 14422
            +P +++ C+S  S    C   N  C  D+    DG  EC      C  G+K  G   C +INEC+ E  PCS+N NC + NG++SC+CK       F+  +   C  +  C   A+C      F+  C C+ GFEGDG   C
Sbjct: 1514 VPTTKKPCDSTQSSKSHCSESNMSCEVDT---VDGSVECK----ECMGGYKKSGKV-CEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFK--CECHSGFEGDGIKKC 1645          

HSP 41 Score: 58.5362 bits (140), Expect = 2.415e-7
Identity = 71/245 (28.98%), Postives = 96/245 (39.18%), Query Frame = -1
Query: 7613 CYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACG------------CLMSDGTYYANGEQRT---NENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEG------FEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYG 8284
            C N+  S  C  +C      +PGY L +G C     CG            C+ + G Y    E+      +NC  K  C+  +         C   A C    D   C CK G+ GDGI C DI+EC    + C     C N  G + C CK G       +  G  C+    C   + C NAT           C C  GF +      C D NEC +  ++C  V   C N FG ++C C++G
Sbjct:  237 CENSIGSFKCVNKC------SPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSA-------ICDRHASCHIVLDI--CDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQDDATCIKDQGAFCS--GGCGDNAICSNAT-----------CACIDGF-RGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKC-CQHG 450          

HSP 42 Score: 56.6102 bits (135), Expect = 8.559e-7
Identity = 48/166 (28.92%), Postives = 61/166 (36.75%), Query Frame = -1
Query: 9290 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA---LLKCPSTSDCTNTPGSFICNCHVGFVK-----AAPTVCNDINECSLNSSICDAN--------------------------------------------ADCINTYGSY 9631
            D NEC    H C + A C N    + C C+ G++G        NG  C D DEC+     +CP  S C N PG++ CNC  GF       +    C DINEC   +  CDA+                                            ADC+NT G Y
Sbjct:  133 DKNECLE--HPCHMMAQCQNTLGSYECRCLPGYEG--------NGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGY 288          

HSP 43 Score: 55.8398 bits (133), Expect = 1.403e-6
Identity = 54/200 (27.00%), Postives = 73/200 (36.50%), Query Frame = -1
Query: 15617 GESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN--------------CTD----FNECESKTA-------------------------------------NCSAYATCYNTF-GSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 16048
            G   C C +GYEG    CTDIDEC RG   C     C+N++G+  C C  G+ G+G                CTD      E E K                                       +C+ +A C +    S+ C C +G+ G+G IC  +       D+ N        CD   T  ++  GSF C C EG
Sbjct: 1722 GSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV-------DECN----NAGMCDDENTKCENTIGSFNCVCLEG 1910          

HSP 44 Score: 55.4546 bits (132), Expect = 1.730e-6
Identity = 43/141 (30.50%), Postives = 56/141 (39.72%), Query Frame = -1
Query: 15767 CFNSTASGESECRCKKGYEGRADNCTDIDEC-SRGSYVCSDNGDCVNQLGTYN---------------------------------------CLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE 16069
            C NS  S +   +C  GYE     C D++EC S   + C    DCVN +G Y                                        C CKTG+ G+G+ C D NEC++K   CS    C N  G Y C C+NG +
Sbjct:  237 CENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVC-CKNGQD 376          

HSP 45 Score: 55.0694 bits (131), Expect = 2.378e-6
Identity = 117/450 (26.00%), Postives = 173/450 (38.44%), Query Frame = -1
Query: 1724 CHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQC---HCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNC-EDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNS-CGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS----DGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCI-DVDE------CSLDQVS-SLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTK 3022
            CH  A C  + G  VC C     GDG T C  ++     T  C    S C +     N     +C   +  +GYV  P  Q C+ ++       N C   A+C +      C+C  GF      KC +I+E       C  N+ C     G +C+C PG+  +    L C  D  +C + T     P+++C  N  S +C C  GFS  G  C     C    S C +N++C  T S   C C +G +  P   C              +++   +   DL    +CV P                         C +S   C+    S +C+CK GF +NS       C D DEC  +E+S+ K      C NT G   C CP+G + +   C+  V++      C  D ++  L +      G           YC++ F  + NS K
Sbjct: 2029 CHSLATCEQSTG--VCICRDGFIGDGTTACSKKS-----TADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRD-------NLCSPEAVCQN----RRCQCLPGFTG-DGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGN---GLCCVPDPLDCVHFTGIC-HPNAVC--NSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGS---CICRHGFKGDPFYKCS------------SLVSKEPANQQDLSDVSSCVTP-------------------------CDSSTQLCI----SGECICKSGFRRNSTLSGSETCADIDEC--AEKSH-KCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRK 2403          

HSP 46 Score: 55.0694 bits (131), Expect = 2.860e-6
Identity = 70/246 (28.46%), Postives = 91/246 (36.99%), Query Frame = -1
Query: 15575 HAVDSCHLRDTSGCVCNDGFLRSGTT-CTPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCT-DIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGDGLQGANQTGC 16306
            H++ +C  + T  C+C DGF+  GTT C+ K    C            I     C+ K +C                     NST S    C C  GY G    C+    +C     +CS    C N+     C C  GF G+G+ C   +E  S  + C A A C    G   C C  GY GNG  C         PD  +C  H    C   A C      S  C C+ G  G+G+    Q  C
Sbjct: 2030 HSLATCE-QSTGVCICRDGFIGDGTTACSKKSTADC------------ISLPSLCADKAKCD--------------------NSTRS----CECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNR----RCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC---VGGTTCKCNPGYFGNGLCCV--------PDPLDC-VHFTGICHPNAVCNSE---SRQCQCSSGFSGNGVSCFPQKSC 2219          

HSP 47 Score: 54.299 bits (129), Expect = 4.032e-6
Identity = 82/261 (31.42%), Postives = 107/261 (41.00%), Query Frame = -1
Query: 5147 ICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH-GICGPNYIC-------QCKSGYEINPSGMCQDVNECQT-QSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNEC-----------LPVNQVCQNIN--------CGNHAFCKIENGRADCFCDSGYYGDGELCV 5845
            +C   A C+ R     C+C PG+ G G+K C  I E     + C  N  C    G  TC C  GY  N   GLC   +  +C    GIC PN +C       QC SG+  N    C     C+T +S C   A C+ T GS  C C   F GDP  KC     K  A Q    +V       S C     +S+++ I+ EC           L  ++ C +I+        C   A C+   G   C C  G+ GDG  CV
Sbjct: 2110 LCSPEAVCQNRR----CQCLPGFTGDGVK-CVSIHERASNCSQCDANAHCV---GGTTCKCNPGYFGN---GLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGN-GVSCFPQKSCRTDKSVCAKNAICLPT-GS--CICRHGFKGDPFYKCSSLVSKEPANQQDLSDV-------SSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2348          

HSP 48 Score: 53.5286 bits (127), Expect = 6.446e-6
Identity = 52/177 (29.38%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 13907 FCEYVNTPCAKDSDCNKDGEC----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKL---------FC--LGDADCAKS---GKCFQNLCSCNLGFEGDGKL-LCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDG 14380
             CE +N   A+ + C+ +  C        C CK G++GDG   C++INEC +E +PC  +  C++  GS+ C C + F       C N L         FC  +    C           ++C C  GF  + +   C +++EC     N    SA C +  GSY C+C  G++G+G
Sbjct: 1562 VCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFM-CTDINEC-DERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG 1736          

HSP 49 Score: 53.5286 bits (127), Expect = 7.068e-6
Identity = 26/60 (43.33%), Postives = 34/60 (56.67%), Query Frame = -1
Query: 15749 CLCKTGFVGNGL-----NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSIC 15913
            C+CK+GF  N        C D +EC  K+  C   ATC NTFGS+ C C +G+ G+G  C
Sbjct: 2288 CICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2347          

HSP 50 Score: 53.1434 bits (126), Expect = 9.636e-6
Identity = 48/162 (29.63%), Postives = 73/162 (45.06%), Query Frame = -1
Query: 6590 CQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENS---IGSFTCRCNEGYSGD-----GSVCSEIDECLLGLHN-------CSRSHQFCFNVNGGFECRCLSGYKSDTNGS----CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQ 7018
            CQC +GF+G+   C       F   +C +D++ C  +   + + +C C  G+ GD      S+ S+       L +       C  S Q C +     EC C SG++ ++  S    C D +EC    + CD  A C NT GS +C C  G++G G  C P 
Sbjct: 2200 CQCSSGFSGNGVSC-------FPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCIS----GECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPH 2350          
BLAST of SMED30010561 vs. Ensembl Fly
Match: dpy (gene:FBgn0053196 transcript:FBtr0332344)

HSP 1 Score: 330.487 bits (846), Expect = 3.150e-89
Identity = 496/1833 (27.06%), Postives = 705/1833 (38.46%), Query Frame = -1
Query: 1130 YLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS--------------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLC-FVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG---LLCHDIDECKFGVAN--CSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDT-----CIPKTECE---NKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT-CQDKNECDPTSPDFAAQKCLASGGGCLNTK-GSFVCTCNQEQMNENNSS--CKPIDSCAMGLD-------------------------------NCDRKVEDCISSKDSSYTCQCIEGF---QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNEC---QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTN--CEDIDECAIK--THPCHDLARCSNVPGSCKCKCQPGFTGDGIYSC--IETDSCPARDDVK----------------CPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKF-AECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEN-DCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQ-VLNGADSVCYDLPIGYACVCPDGFVNDEVFP------------------QVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDE-------------CEISEQSNMKFCN--------------------------NGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRG---------------FVMIENSTKCVDIDECQFPNSCLDGLCNNL-------PGSF----ECLCNIGY-----DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGY----QEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCV 6031
            YL +F   K+C                   +G+  C +G +  + +    N C K+   C  G C LN          +C C  GY G    +C D DE   K   C +   C+NT GSFTC+C  GY  N               ++   E    CN  +H      ++C+CK GYE +   +C DV+EC+    C   A C NTPG+Y C CP+ + G+                         + Y   C+ +          +EC   N       CG  A C    G   C C  GY GDG     CVD DEC+     C  N+ C N DGSF C C  G+    +    + C D+DEC  +  C    EC N  GSF+C C  GF+ +  +D   D   +            +       +   +   SG G+ +C+  + C   +G + C  NA C     +YRC+CP GFQG GY  C +I+EC ++    C     C ++ G + C C     Y  D    CVDIDEC++     C  +A+C+N    Y+C+C +G+ G     + C  +D      +N  C+ NA CI       C C  G    G++C D DEC+       A  C  +A C N    Y CEC++GY G+      + PC DV   C A+  C P    +  +CE   D    N +     C+   EC+       +C  + + C     GF C C PGF+   ++ C D +EC        A KC A G  C+N   G + C C    + + + S  C PI SC+   D                               NC    +  +++  +   C C  G+     + G C D+DEC  + + C   A C+N  G Y+C+CP     D  ++ C           NP   G+     +  G+  C C  GY+ N  N  C+D+DEC+++     C   A C N+PGS +C+C  G  G+    C    T  C  +   K                CP+G+ C ++ G   YC C  GY+      C+         D+DEC  R +    F A+C N  G+Y C CP    GD          CAL    C  +     N       + P +C C   Y   P      + N+C +P E   C  NA C  ++   +C C++GFK  P   C + +EC      C+  + C +K  G+ C C P     D     C  I E       S  P S C++N       C    +   G C      L+   CG N+ C        C C  G  +  +GDC         + +CQ V+ G  ++C     G  C CP G + +  FP                  Q+C N   +  CE  +    A+   C    G  KC+C+P F  N D  C+   E             CE     +   CN                          N +C       +C CP+GF  N Y  C DVDEC        A+    +N  C+N  GGF+C C  G               F    N  +C +  EC    SC  G C NL       P +      C+C +GY     D V+G C+   +C N++          C+++   FQ           GK    C  V+ C K  I C  NA CV   +   CIC DG+       Q+G        + ED C    DC      Y C        +GI  C  +C    C P +LC+I       C C 
Sbjct:   64 YLQLFNLSKLC-------------------DGTQDCFLGADELSKELKCTNDCDKDGTKCTHGAC-LNG---------VCHCNDGYGGC---NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAH------FLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN-------------------------NPYREGCQDV----------DECSYPNV------CGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECAR--TPCGRNADCLNTDGSFRCLCPDGY----SGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLE--HDPHADQLPQPLNTQQ------LGYGPGATDIAPYQRTSGAGL-ACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDN---PCGENAICTDTVGSFVCTCKPD--YTGDPFRGCVDIDECTA-LDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN----QCFCLDGFEPIGSSCVDIDECRT-----HAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV--RCGAHAYCKPDQNEAYCVCE---DGWTYNPSDVAAGCVDIDECDVMHGPFGSCG-QNATCTNSAGGFTCACPPGFSGDPHSKCVDVDEC-----RTGASKCGA-GAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQ--CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCV---------DVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAY-----NGLCALAQRKCAADRECAANE----KCIQPGECVCPPPYFLDP-----QDNNKCKSPCERFPCGINAKCTPSDPP-QCMCEAGFKGDPLLGCTDEDECSHLP--CAYGAYCVNKKGGYQCVC-PKDYTGDPYKSGC--IFE-------SGTPKSKCLSNDD-----CASNLACLEGSCVSPCSSLL---CGSNAYCETEQHAGWCRCRVGYVKNGDGDC---------VSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNP-FPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGAT---CDRNNG--KCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHG-CSIRGQCGNDAD---------CLHSEICFQL----------GKGLRKC--VDACSK--IQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDC---SRGYGCQASV----NGIKECINLCSNVVCGPNELCKINPAGHAICNCA 1673          

HSP 2 Score: 309.686 bits (792), Expect = 5.133e-83
Identity = 414/1421 (29.13%), Postives = 571/1421 (40.18%), Query Frame = -1
Query: 4415 GQLECTNI-------TCSNDAFCDFKDDDYGCHCKNGFMGDGIM---CKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT---CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF----------RPSPIDS----------------------FVCTDVNECNL---VHECDKNYAKCTNTPGSYYCTCDSGYQGDG-----------------------------------------RNCTDIDECSS-NKVCQRPDATCVNLPGSYECRC---LDGTPGCDGDNPCNTV----------QCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE----CRDIDECAFSLNNCDS--DRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRSHQFCFNV-NGGFECRCLSGYKSDTNGS--CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCV----NSTCLCKSGYENST---NQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDG--ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN--ENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGY-ICKCKPGYEGVGIKSCRDIDECGGK-INNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-----------------------------------ETNNVCN-------CGSHGICGPN--YICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYY--GDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCA-----TNGECQNT-------IGSF------KCECKDGFIGDGKYDCRIDSKCEK-YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSC--IKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQ 8080
            G++ CT++        C  +A C     +Y C C +G++G+      C+D+DECS   +VC   A C N  GS+ C C  G++G+G +   C + +EC   +PC     +C +    + C C  G+  +   G C+D +ECA T N C  +   C N  GS++C C  GF           P P+++                        C D++ECN    V +C  N AKC N PGSY C C SG+QG G                                         R C DIDEC++ +K C +  A C N    Y C+C    DG P  D    C  V           CT  N  C   QCFC  GF+   ++  C DIDEC T A  C G  A+C N  GSY CEC  GY  S     C+   E +    +CG +A C       YC C+ G+T +  +    C DIDEC        S    ATC NS G FTC C  G+SGD  S C ++DEC  G   C    + C NV  GG+ CRC     +D + S  CV    C   ++ C  N+ C   D +  C+C    IG+       +    C  L C  +A C+     + CLC  GY  ++     C + DEC +   C   A C +T G ++C C  G  GD        + T  C   N C  G     D Y G  +C C  G+         ER                            +S++ QC D+DEC+       C  N++C N  GSY+C+CP  +     +G      P   C       + CN   C C        +      CS   A      CP  A C     G   C C  GY+     SC D+DEC  +    C     C N  GS++C C  GY  ++ +GLC                                   + NN C        CG +  C P+    C C++G++ +P   C D +EC +  PC   A C+N  G Y+C CP+++ GDP       +  T   +C + + C  +L    C + SC S               C ++ CG++A+C+ E     C C  GY   GDG+    V +C   DV C + + C        C C  G  +L N     SC+  D+C  +  C       NG C+         IG+       KC C+  F+G+    C    +  K   GC E+A C   +  S   C C+    G+    C     N+C  N   SC  NA C  V     C+CP GF G+ Y  C D+DECAN     C     C+N  G + C+C  G A      C  I+       NKC  N   +  EG YSCQ
Sbjct:  206 GEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA-RTPCGR-NADCLNTDGSFRCLCPDGYSGDPMNG-CEDVDECA-TNNPCG-LGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTN-AKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQ-HAVCENTVPGYNCKCPQGYDGKP--DPKVACEQVDVNILCSSNFDCTN-NAECIENQCFCLDGFEPIGSS--CVDIDECRTHAEVC-GPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV----RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAE-CVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANED-CPGNSIC---DATKRCLCPEPNIGN-------DCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN-PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGY---------ER----------------------------NSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGH-----NGN-----PFIMC-------EICNTPECQCQSPYKLVGNSCVLSGCSSGQA------CPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDEC-SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNL---ACLEGSCVSP--------------CSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQ--DVICGDGALCIPTSEGPTCKCPQG--QLGNPFPGGSCS-TDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQS--RCACNPGTFGNPYEGCGAQSKNVCQPN---SCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECAN---KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEG-YSCQ 1500          

HSP 3 Score: 295.049 bits (754), Expect = 1.414e-78
Identity = 427/1505 (28.37%), Postives = 591/1505 (39.27%), Query Frame = -1
Query: 3707 ECNLVHECDKN----------------------------------------YAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQR--PDATCVNLPGSYECRCLDGTPGCDGDNPCNTV-QCTK-----PNEICYLGQ----CFCKHGFQ-NNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTG-HCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY-----------------------------------SGDGSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIG-----------------------------SGRNC----------DPQEGLEEC-------GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGINCF-KKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNK----CFD-ERCENV------CPKNAXXXXXXXXXXXXXXXXXSLSSDS-SQCIDIDECNENVDDCQENSICFN-RFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGN----LNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS--CRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP-----------NYICQCKSGYEINP-SGMCQDVNECQTQ---SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFC-KIENGRADCFCDSGY--YGDGELCVDVDEC-SNGDVSCPNNSFCQNKDGSFHCACNVGFQRLEN----ALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCG--DEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA---CKAN------QTCTPSNENSLAICECKP--------DFKLENDTCI--------PKTECENKTDNCDRETS-----NCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDS 7567
            E    ++CDK+                                        +A CTNT GS+ CTC  GY+G+G +C DIDEC    +  R   +A C NLP  + C+C DG  G DG+  C  V +C       PN +C        C C  G+  NN     C+D+DEC +  N C G  A C NL+GSY C+C  GY     ++      +       CG NA+C++TDG + C C  G++G   + C D+DECA   NN     A C N  GSF CRC  G+                                   SG G  C +IDEC    G+  C  ++  C N  G + C C SG++      C + NEC+  DN C +NA C +T GSF+C C+  Y G                              G NC          DP+   E+            C  NA C+ + C C  G+E   + C++ DEC +    C  +A C++T GS+ C C  GY+G       K+  +   C    YC   D  +  C C  G+ +  +     C D + C+ +      C +NA  + ++ +   +C+     S D  S+C+D+DEC      C   + C N   G Y C+CP N +        C+ +     N+ CP    C + +  CL    +  +D  +    LNC  ++   L       AN + +     C C PGY G    +  C DIDEC  + N C     CSNT G + C C  G S +     C T+    C     C             N +C C+ GYE N  +G CQDV+EC  Q     C + A C N PGSY+C+CP+   G+P   C  + C T   QCQ+       L G+ C    C+S +                  C + A C  I  G + C C  GY    DG  CVDVDEC   G   C   + C NK GS+ C C  G+Q        AL    C    EC  +E C   GEC          C   +  D + + +  S CE++  C  +A C     S   +C C   F GD +  C   + C       C   A C      Y+C+CP  + GD Y     I E     +  C S + C +     N  C +G+         +  CSS     C SNA C+ ++    C+C  G+   GDG     + +C+  +  C + ALCI       C+C  G LGN    G    D+C        A  C E  +C N      CE        G  C     CD  N    C+ N        C P  E +    +C P        ++ L    C         P   C  ++ N  +  S      C  +     C C  GF+  GN    CQD +EC        A K       CLN  G F C C         SSC+PI+S
Sbjct:   90 ELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEG-DGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDEC-SYPNVC-GPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECART-PCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECA--TNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCG-TNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ--DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKP-DQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNA--TCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSIC-DATKRCLCPEPNIGNDCRHPCEALNCGAHAQCML-------ANGQAQ-----CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMC--EICNTPECQCQS----PYKLVGNSCVLSGCSSGQA-----------------CPSGAECISIAGGVSYCACPKGYQTQPDGS-CVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECV---------CPPPYFLDPQDNNKCKSPCERF-PCGINAKC---TPSDPPQCMCEAGFKGDPLLGCTDEDEC---SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKS-GCIFESGTPKS-KCLSNDDCAS-----NLACLEGSC--------VSPCSS---LLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQDVI--CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCS------AARPCGERQICINGRCKERCE--------GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQA----KCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFS--GNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIES 1476          

HSP 4 Score: 294.278 bits (752), Expect = 2.582e-78
Identity = 405/1435 (28.22%), Postives = 578/1435 (40.28%), Query Frame = -1
Query: 4268 CHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATE--ECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRN---CTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLG----------QCFCKHGF---------------------------------QNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS---VCSEIDECLLGLHN--CSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEE-CGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQT----SCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCP-PNYLDVFKDGKVCMAV---PLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS-CRDIDECG-GKINNCTINEDC--SNTEGSFTCSCKRGYSRNSSSGLCETNNVCN-------CGSHGIC---GPNYICQCKSGYEINPSGMCQ--DVNECQTQSPCHIL------------------AQCINTPGSYK-CQCPENFYGDPQNKCFE-DKCKTKALQ----------------CQAGEVCKLSLYGSVC---EKISCNSSEILINNECLPVNQ-------------------VCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL-CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQ--RLENALVTDSCTDIDECLLSESCATN-----GECQNTIGSFK---------------CECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYEC---QCHTEFSG--------DGITSCIKNNLCFVNGK-------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGN 8008
            CHC +G+ G   + KD +EC      CD  A C NT+GSF+C+C  G+ GNG  C +I+EC   +      E  EC +    + C+C+ G+  +     C D +EC +  N     +  C NT G+Y C C  G+  +      C DV+EC+  + C    A CTN  GSY C C  GY GDGR+   C D DEC+    C R +A C+N  GS+ C C DG  G D  N C  V     N  C LG          QC C  GF                                 + +     C DIDEC+        G  AKC N  GSY C C  G++                  + CGENA C DT G + C CK  +TG     C DIDEC  +L+      A CEN++  + C+C +GY G       C ++D  +L   N  C+ + +   N     +C CL G++     SCVD +ECR     C  +A C+NT GS+ C C AGY+GS     P+   ++ C  + C  +A C      + C+C+ G+     +    C++ DEC+       SC  NA C ++ G F C C  G+ GD      K  D D           +C  G   C +G    +       C   CP N I                     S +C+ I  C+ N +DC  NSIC     +  C CP PN  +  +    C A+     +QC  +   GQ      C C  G    +   G  N   +   C    C   A C     GY+C+C  G  G   +  C      G    N C   E C   +  G+  C C++GY RNS +G C+  + C+       CG + +C     +Y C+C  G+  NP  MC+  +  ECQ QSP  ++                  A+CI+  G    C CP+ +   P   C + D+C+ +  Q                C   E  +   Y  +C   ++      E   N +C+   +                    C+   CG +A C   +    C C++G+ GD  L C D DECS+  + C   ++C NK G + C C   +     ++  + +S T   +CL ++ CA+N     G C +   S                 C C+ G++ +G  DC   S+C+    C + A CI   E    +C   Q    F G             C +  +C +NG+         C   A C++ N   +CIC   F G+    C    E A   +  C     C    GQ  C C  G              +  Q N C  NA C+      SC C +GF G+  + C D+DEC      C  NA C+N+ G F C C +G  GN
Sbjct:  114 CHCNDGYGGCNCVDKDENECKQRP--CDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEV-LCTDVDECRNPENC--GPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPG-AICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTP-CGR-NADCLNTDGSFRCLCPDGYSG-DPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQD---NPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECT-ALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN-----QCFCLDGFEP-IGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS----PPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDP---HSKCVDVD-----------ECRTGASKCGAGAECVNVPGGGYTCR--CPGNTIAD----------------PDPSVRCVPIVSCSAN-EDCPGNSIC---DATKRCLCPEPNIGNDCR--HPCEALNCGAHAQCMLA--NGQ----AQCLCAPGYTGNSALAGGCN---DIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDP-PQCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV--SQCQDV-ICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQIC-INGRCKERCEGVVCGIGATCDRNNG--KCICEPNFVGNPDLICMPPIEQAK-CSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--ANKPCGLNAACLNRAGGFECLCLSGHAGN 1466          

HSP 5 Score: 289.271 bits (739), Expect = 7.755e-77
Identity = 412/1436 (28.69%), Postives = 558/1436 (38.86%), Query Frame = -1
Query: 3443 YCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECL-LGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKL-LCPLNALCVN----STCLCKSGYE---NSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-DCYD----GICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN-------------------------------------ENVDDCQ-----ENSICFNRFGSYDCKCPPNYL-DVFK---DGKVCMAVPLSQCNQSCPTGQYCNNG----SCSCLMGLNSQTDD-------DGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETN-NVCNCGSHGICGPNY---ICQCKSGYEINPSGM---CQDVNECQTQ----SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYG-----------------------------------SVCEKIS-CNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVG-------------------------------------------FQRLENALVTDSCTDIDECLLSE---SCATNGECQNTIGSFKCECKDGFIGDGKYDCRI--------------------DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDE--CANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSN-QTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPK-----------------GSPGAP----ECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDR-----ETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNE---CDPT---------SPDFAAQKCLASGG---GCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ-RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC-------PDNLKLDLSKKACTDRNECQ 7021
             C C  G+ G C+ C D DE       CD   A C N++GSFTC C  GY G+G  C +IDEC    +      +  C N+   F C+C  GY+ D    C D +ECR  +N C  NA C NT G++ C C  GY+G+    +  + ++EC    +C   A+C N      C C  GY+    S + C++ DEC ++T C  NA+C++T GSF C C +GY GD +N  +   D D C   N C  G +C +      C CPSGFV + +   D+  +   P N    +  G      +     S     C+DIDECN                                     EN+++CQ     EN+IC +  GS+ C C P+Y  D F+   D   C A+     ++ C     C N     +C C  G + + D        D N+ CS N        C  NA C E      C C  G+E +G  SC DIDEC      C  +  C NT GS+ C C+ GY  +     C+       CG+H  C P+     C C+ G+  NPS +   C D++EC         C   A C N+ G + C CP  F GDP +KC + D+C+T A +C AG  C     G                                   S+C+    C   E  I N+C      C+ +NCG HA C + NG+A C C  GY G+  L   C D+DEC      C   + C N  G + C C  G                                            Q  E       C D+DEC +     +C  N  C+N  GS++C C  G  G+    C I                     S C     C   A CI ++   +  C C   +      SC+  + C   G   C   A C     +Y C CP+G+QGD YN    + +  CA D    C++ EKC+       CVC     ++D    D ++C S  +   C  NA C   +    C C  GF GD LL C D DEC      C+  A C+NK G + C C     G+    G   E   PK                 GS  +P     C  NA C+ +     C C+ GY   G   C+ Q   DV   C     C P++E     C+C P  +L N    P   C   TD C       E   C+      +CE   G    +G TC   N    C+P           P     KC    G    C    G   C CN          C          ++C    E    +  +  +C C +GF       C DVDECA+K   C  NA C N  G + C C       P +    +  K C D N+CQ
Sbjct:  113 VCHCNDGY-GGCN-CVDKDENECKQRPCDV-FAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC-ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE---DVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQ---PLNT-QQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTAL-----DKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFD------CTNNAECIENQ----CFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDC---RHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN--PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAAD--RECAANEKCIQPG---ECVC-PPPYFLDP--QDNNKCKSPCERFPCGINAKCTPSDPP-QCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQ-DV--ICGDGALCIPTSEG--PTCKC-PQGQLGNP--FPGGSC--STDQCSAARPCGERQICINGRCKERCE---GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAE--CRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQ 1486          

HSP 6 Score: 288.5 bits (737), Expect = 1.302e-76
Identity = 536/2042 (26.25%), Postives = 753/2042 (36.88%), Query Frame = -1
Query: 1160 NALCVNSTCLCKSGYENSTNQCINTDECE-SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL--DVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GS--CSCLMGLNSQTDDDGNLNCS-KNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRG--------------------------------YSRNSSSGLC--------ETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSL--YGSVCEKISCNSSEILINNECLPVNQVC-QNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGF----------QRLENAL----------------------------VTDSCTDIDECLLSE----SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGG-CHEDASCIVNVESSIYECQC--HTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQG-DGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG----------LLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGT--TCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF---------CIKQTPCD------VPNACKANQTCTPSNENSLAI------CECKPDFKLEND-TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN---------MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKAC-----TDRNECQEN-------------------PMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMI--GNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIP----GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKW--------------SDETNLNCEDIDECTNPTSC------------SSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQV-CENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKC-INTAGGFTCDCPEGFIYN----------------NYDCIDVDECSLDQVSSL--ADNCD----QVNGHCINTVGGFQCYCNRGFVMIENST---------KCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNP---CQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI--VSC--KAICGPNSCLPGQLCQIV 6550
            +  C+N  C C  GY      C++ DE E  Q  CDV A+C +T GSF C C  GY G+G +C   D   D         + +C    C+ P+ F+ K    ++   E +                              C D+DEC  N ++C  N++C N  G+Y C CP  Y+  + +++G  C  V        C  G  C N  GS  C C  G     D DG       +   C    C  NA+C      + C C  GY G  +  C D+DEC    N C +  +C N  GSF C C  G                                Y R S +GL         + + V  CG++  C     +Y C C SG++      C+++NECQ  +PC   A C +T GS+ C C  ++ GDP   C + D+C      C    VC+ ++  Y   C +      +  +  E + VN +C  N +C N+A C IEN    CFC  G+   G  CVD+DEC      C  ++ C N  GS+ C C  G+          Q  E+                              V   C DIDEC +      SC  N  C N+ G F C C  GF GD    C    +C      C   A C VNV    Y C+C  +T    D    C+    C  N    C  N+IC+   AT RC+CP+   G D  + C  +         NC +  +C+ +NGQ  C+C  G      +   C DIDEC   + N C+  AIC N  G Y CQC  G  GD           + C D + C  G   C +++      G   C C+ G   N     C D DEC   +G P    C  NA+CKN    Y C C  G+ G  +          C  Q+P        V + C + Q C PS    ++I      C C   ++ + D +C+   ECE +        + CV     + C C  G+          +    C    EC       A +KC+   G C+     F+         +NN    P +    G++        C  S      C C  GF+   + G C D DEC+     C   A C N  G Y C CP +   D  K  C     T +++C  N                    ++CG  + C     +  C+C  GY  NG                          G C  +CQ    GDG   CI T   P     KCP G   N    G+     C+       +  CI   C ++C  +         C   A C  N+G   C C     G+    C    E A  +  C  N ++CE        L   +C C  G    P    G Q   +KN C     N C  NA C        C C  GF   P   C++++EC  K   C +N+ C ++A GF C C  G                  D     C +  EC    SC            S  P +IC     +  C+CP G+   G   + ++ C I   CG ++ C ++   F         QL  G    + +C++   + Q   G +++C       +C+C DGF  +    QV C+ +         C+ S+ +C   YG     C+   S N   +C++         SN+    N  C IN AG   C+C E +++N                + +C D   C  D +  L     CD      N  C+      +C C  GFV   N            C +  ECQ   +C+        G     C    D V                CGP+A  +C+      QC+C  G     G  Y+P   CQSV  CV  N  CP +  C    N     C D        +C        E+SC   A CL  D    C C  G+KGD +  V+C  +  C   +C P  +C++ 
Sbjct:  106 HGACLNGVCHCNDGYGGC--NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAEC----CNLPAHFLCKCKDGYEGDGEVL------------------------------CTDVDEC-RNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGY----DGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ-DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC-IEN---QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAEC-VNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSAN--EDCPGNSICD---ATKRCLCPEPNIGNDCRHPCEAL---------NCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDEC---RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATG-ETCVQDSYT----GNSVCICRQGYERNSENGQCQDVDECSVQRGKPA---CGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQAC-PSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADREC------AANEKCIQP-GECVCPPPYFL------DPQDNNKCKSPCERFPCGIN------AKCTPSDPPQ--CMCEAGFKGDPLLG-CTDEDECSHL--PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGD-------------------------GDCVSQCQDVICGDGAL-CIPTSEGPT---CKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGV--------VCGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGEN-AHCEYG------LGQSRCACNPGTFGNPYEGCGAQ---SKNVCQ---PNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKP--CGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAIC----DAGNCICPMGYI--GDPHDQVHGCSIRGQCGNDADCLHSEICF---------QLGKG----LRKCVDACSKIQC--GPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCK-SDQDCSRGYG-----CQ--ASVNGIKECINL-------CSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLG-----CRPACDTVK---------------CGPRA--VCVTNNHQAQCQCPPG--PFAGDPYDPFNGCQSV-PCV-YNHDCPPSQMC----NRMTHTCFD--------VCD-------EESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVT 1912          

HSP 7 Score: 287.73 bits (735), Expect = 2.280e-76
Identity = 655/2712 (24.15%), Postives = 944/2712 (34.81%), Query Frame = -1
Query: 1136 TNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGN-------------------------------------------GVTCTNINEC----YPLSPC-DNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKN-------------------------------YAKCTNTPGSYYCTCDSGYQGDGR---NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDG--------------TPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGY------------------RMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGY-YCQCKTGFTGHCD-ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFN---VNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEG---LEECGKLLCPLNALCVNST----CLC---------KSG--YENST--NQCINTDECESQTSCDVNANCIDTHGSFIC----YCNEGYIGDGINC---FKKDTDTDACQIENYCTDGDCYDG----------ICHCPSGFV---FKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDD--CQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM-AVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSAS-CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS-------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILIN-----NECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG-----------------ELCVDVDECSNG------------------DVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTD-------------SCTDIDECLL-------------SESCATNGECQNTIGSFKCECKDGFIGDG--KYDCRIDSK--CEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDG-FQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDI-DECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL---LCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQ-LDPG----FKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL-----ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMG--LDNCDRK---VEDCISSKDSSYT-CQCIEGFQ----------RINGSCVDVDECAD--------------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTD--GSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYS---CIETDSCPARDD------------------VKCPTGSYCNMIGNFIYCNCTNGY-EDSN-------QMECIGDVCYKKCSDIDECVTRKSACHKFAECTN--------NDGAYVCTCPS--YLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDET----NLNCED---------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY-CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSEC-------VDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYN------NYDCIDVDECSLD--------QVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAA-----GI-----------------CINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKD---GYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI-------VSCKAICGPNSCLPGQLCQIVNGNQYDCG 8065
            +N  C+N+A C     +  C C +GF   G  C DIDEC  +  VC  +A C NT GS+ C C+ G+ G+                                              C +I+EC     P   C  NAT  C +   G+ C C  GF  +  +  C D +EC    + C   +   N   G Y C C       P  S  C  +  C+   +C  N                               +A+C    G   C C  GY G+      C DIDEC +N   ++  A C N  G Y C+C  G              T GC   NPC T +    +       C C+ G++ N     C+D+DEC       A G  A C NL GSYEC C  G+                  +          +     +   C   AECI   GG  YC C  G+    D  C D+DEC        +  A C N  GS++C C EGY GD    +    C L    C+   +   N   +  G EC C   Y  D   +   ++ C  F   C  NA C  +D    C+C AG+ G     DP  G    +EC  L C   A CVN      C+C         KSG  +E+ T  ++C++ D+C S  +C +  +C+    S +C    YC          C   + K+ D D     + C D  C DG           C CP G +   F    C  ++C    P                        +   CI+   C E  +   C   + C    G   C C PN+  V     +CM  +  ++C+  C    +C  G        N  T  +    C   S + C P  C  NA C        C C  G+ G     C+D+DEC  K   C +N  C N  G F C C  G++ N         S  C+  N C C     C   Y CQ          G C+++    +Q+ C   A C     +  C CP  + GDP +                 +V   S+ G       C  SEI         +C+     C  I CG +A C  E+ R+ C C  G++G+                  + C    +CS G                  +V C  N  C+  + + H  CN     + N +V+              +C D   C               + +C  N  C       +C+C +GF+G+   +  C+   K  C  +  C E  +CI +  +    C+     + D +                C   A+C   N   +C CP G F GD Y+  N          H+C   + C                 +   C D+ DE        C  NAIC  ++    CQC  GF GD L    C     C  G   C  +A+C   P    C+C    +G+  + G                C  +  C N D     +C +     G  C  Q PCD  NAC +N  C   N     +C C   F+  +DT           D C R  S C+  +D G    +  +C+    +     QD ++ +    +     CL     ASG  C+    +  C  N+E        CK   SC     L+ C        + + S D  ++ C C EGF+          R+   C+  ++C                K  SC     C   +   VC   +N    L+ + C     CQ     C   + C  T+   + +C+C TG+      C DIDEC     PCH  ARC N+PG+ +C C  G  GDG YS   C +   C   DD                    C   + C   G+   C+C  G+  D N       ++ECI  V    C+    C    + C K  + T+         D    C C     L  D    CED NEC   +  C+ +T++C NL  +      + C C  G +  P    C + NECL+  + DC  +A C ++      RC+S                 E+ + C +N+ CQ +A    C C P     D T    ++ C D               ID C+ P +C ++      N+ G   C C  G +      C  +  C     C Q S+C++ +    CS         N DC     CL+ +  CQ    ++S C              F ++     +C  + EC         S+SEC        D YG  KC          +  C+    C            N +C+  +    C C EGF  +        +C   D+CS D        +++ L       N  C        C+C  GF   +   +C  ID C+         C N  GS++C C  G   D  N  C    EC  N + C P AA     G+                 C+      QC C  GY+         C+ +    ++   CP+N  C D      C+       ++  Q G C   N C    +C   A+C+  +   +C C  G+ GD         V+C   CGP       +C  V  N  +C 
Sbjct:  550 SNFDCTNNAECI----ENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNAT--CTNSAGGFTCACPPGFSGDPHS-KCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEK--AICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGD----AYNGLCALAQRKCAADRECAANEKCIQPG-ECVCPPPYFLDPQDNNKCKSPCERFP--CGINAKCTPSDPP-QCMCEAGFKG-----DPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLAC-LEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV---SQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARP----------------------CGERQICIN-GRCKERCEGVVCGIGATCDRNNG--KCICEPNF--VGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ---------KGQCKNLC---SQASCGPRAIC----DAGNCICPMGYIGDPHD-----------------QVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCV---DACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCK-INPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCR----PACDTV---------------KCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNR---------------MTHTCFDVCDE------ESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGT--CHPSAICEVTPEGPVCKCPPLFVGDAKSGG----------------CRPDGQCPNGD----ADCPANTICAGGVC--QNPCD--NACGSNAECKVINRK--PVCSCPLRFQPISDT---------AKDGCARTISKCLTDVDCGGALCYNGQCR----IACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKE--------CKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNC---LAGEICNSDRTCQPG---CDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECT--EQPCHASARCENLPGTYRCVCPEGTVGDG-YSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV---DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVND---VCEDINECL--SQPCH-STAFCNNLPGS------YSCQCPEGLIGDPLQAGCRDPNECLS--DADCPASASCQNS------RCRSPC---------------ERQNACGLNANCQAQAHQAICTC-PLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGV--CSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCST--------NRDCISEQLCLQGV--CQGTCKSNSSCPQF----------QFCSN----NICTKELECR--------SDSECGEDETCLSDAYGRAKC----------ESVCLGRAACG----------RNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSG-DPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQC--FNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECA 2974          

HSP 8 Score: 238.424 bits (607), Expect = 1.899e-61
Identity = 342/1313 (26.05%), Postives = 508/1313 (38.69%), Query Frame = -1
Query: 1229 GTYSCQCAEG-----FYGDGLLCHDIDECKFGVANCSEN---------------------------------------------------ALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET-----SNCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--------------------------------QRING---SCVDVDEC--ADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTG--DGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCY---------KKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPS-YLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPG--TQICLNKNEC--LNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQD-KADGFSCQCKPGFKWSD-ETNLNCEDIDECTNPTSCSS------------------------------MPHSICMNNPGSFECVCPHGF---SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGA-----------------------------------------------RQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDG-----FVNDEV--FPQVCENQNECEINIHSC--------QA--SNSECVDTYGSFK-CVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNG-KCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVM-IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYEN---------SGGKSYNPCQSVNECVK-------------LNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGD 4432
            G + CQ  E       +    LC    +C  G    S+                                                    A C N  G+F C C  G  GNG  C D DEC+ P     A  C ENA C N    + C+C+ GY+G G   C     C  P  C  N  CT  N      C C PD  + N+   P  E     D C         + C  L+  ++C+C PG++  G +   C D++EC        A+        CLNT GSF C C      +  + C+ +D CA   + C    E C+ +   S+ C+C  GF                                QR +G   +C+D+DEC   D +  C  NA C N  GSY C CP   +       C + NECQ+NP  CG+ + C +T GS+ C C   Y  +    C DIDEC     PC   A C N      CKC  G+ G  D   +C + D                N++       C++ ++ +N  ECI + C+           C DIDEC T    C   A+C N  G+Y C C + Y+    +  C+       E   C  + +YC+   N         C C +G+   P      C++ +EC  ++     C +NA C ++ G + C C  GF   P  KC +++EC   +  C   + C +    G++C+C PG   +D + ++ C  I  C+    C                                  H+ CM   G  +C+C  G+   S   G CNDI+EC   N C + ++C+NT  G+ C C  G+                                               R   NG C+ ++EC  ++ R +   G +++C +LP  Y C CP G     F+  E+   P+ C+ Q+  ++  +SC        QA  S +EC+   G    C C  G+    DG CVD DEC   E+   + C  G +C+N  G ++C CPEG+  + Y+ +    C+L Q    AD     N  CI      +C C   + +  +++ KC    E +FP   ++  C       +C+C  G+  D + G CTD +ECS+     G      C+N  G +QC C   Y             G   + C S ++C                ++ C SNA C    +   C C+ GY ++  G C  +++CQ +  C   A C+ T     C C  G  G+
Sbjct:   52 GYFGCQVNESTEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPA---IAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCT--NTPGNYTCSC-PDGYVGNN---PYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC--------ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAE-CV-NLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQ-GQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV---------------NIL-------CSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQ----PCEDVRCGAH-AYCKPDQNEA------YCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRC-PGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRA-NPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDEC--SVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPE-CQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDEC---EERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGL----CALAQRKCAADRECAANEKCIQP---GECVCPPPYFLDPQDNNKCKSPCE-RFPCG-INAKCTPS-DPPQCMCEAGFKGDPLLG-CTDEDECSHLPCAYG----AYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC--VSQCQ-DVICGDGALCIPTSEGPTCKCPQGQLGN 1282          

HSP 9 Score: 137.502 bits (345), Expect = 4.818e-31
Identity = 524/2364 (22.17%), Postives = 776/2364 (32.83%), Query Frame = -1
Query: 1154 CGENAECIDTDGGYYCQCKTGFTGHCDECRD-------------------IDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRS-----HQFCFNVNGGFECRCLSGYKSDT----------------NGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIG-----------SGRNCDPQEGLEECGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQTSC-------------DVNANCIDTHGSFICYCNEGYIGDG-INCFKKDTDT-------DACQIENYCTDGDCY------DGICHCPSGFVFKSNKCFDE-RCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKD--GKVCMAVPLSQ-CNQS-CPTGQYCNN----GSCSCLMGLNSQTDDD------GNLNCSKNSASCL--------PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINE-----DCSNTEGSFTCSCKRGYSRN--------SSSGLCETNNVC-----------NCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQ----------SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP----VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGD--------VSCPNNSFCQNKDGSFHCACNVGFQ-------RLENALVTDSCTD--------IDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCR----------------IDSKCEKYGGC-----HEDASCIVNVESSIYECQCHTEFSGDGITSC-IKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI--DECANDNTHN------CSSLEKCVNSNGQYNCVC----------------GDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL----LCHDI---DECKFG--VANCSENALCINKPGTFACECQAGTLGNGTT-----CGDEDECKKPKG---------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGW--------FCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG---CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSK----------DSSYTCQCIEGF----QRINGSCVDVDECADKID------------SCKNNATCNNMIGSYVCKCPDNLKLD-------LSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG--------TNCEDIDEC-AIK-------THPCH----DLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR-----DDVKCPTGSYCNMIGNFIYCNCTNGYEDSN---QMECIGDVCYKKCSDIDECVTRK------SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE------DQNECALETHTCNLNT----SYCENLDNTVNVLAPFQCHCFNGYVKIP--------------GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQ--DKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLEN--IDRCQVLN-GADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQA-SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLA-DNCDQ----VNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRN---------------INECQIEDSCHYL----ADCLDTDGSYKCTCKYGYKGDGIVSCKAI-----------CGPNSCLPGQLCQIVNG 7063
            CG N++C  +  G  C C T + G    CR                     D C  S  N     A C  S+ +  C C  GYSGD  S C +I E  + +    R      +  C   N    C+CL  Y  D                 + +CV++         C  NA C   + +  C C  GY G           S R  DP      C    C L + C     ++ C C   Y     N   +C+++ EC    SC               NA C   + + IC C+ G+ GD  + CF ++          D C       + +C         +C C   +V ++  C  E   ++ CP N                          CI++   +  V  C   + C        C+C   Y  D F +   K+ + V ++Q CN S C     C      GSCSCL   N     +       N +CSKN A CL        PG+C ++A C        C C  G+ G   + CR+I      +  C  +       C    G   CSC   Y           S S  C  +  C            CG+  IC     N IC C +GY  +P   C    E   Q          SPC   +QC     +  C C  NF G             +A  C+                      E  IN EC      +N+ CQ+    +CG +AFC + N    C CDSGY GD     +    +  D          C  N+ C+ ++G+  C C   +        R E  + +D   D        +D C     C  N +C+ +     C C  G+ G+    CR                  S C  Y  C     H   SC+     S   C+     S D   +   +N  C      +C   A C+ +N    C C  GF GD +N C  I  +    + + N      C    KC++  G   C C                       +  CV+   CS+     C  +++C   +   +C+C  G+ GD      +   I   DE +     + C  NA+C  + G  +C C     G+  +     C   D+C + +           PGA  C  NA C+  + G  C C  GY G             I+  PC  P+ C     C   + NS A+C C   +     +C P+                CV        EC      +   C+D               C  S G    C     + +CTC      +  S C+P+           + VE+ C+ S            +   C C  G+          C + DEC + +             SC +NA C  +  + VC C D  + +       +     T+       P  CG  ++C   +G+  C C  G++ N           CE+ D+C A++         PC+    D A C+       C C PG+TGD  +SC      P       +   C   S C  + N   C+C  G+ +     + EC   V   +C+    CV +K        C   A CT  + + +CTCP  +TGD    C       D    +    +C  +     + C+ + N+        C C   ++  P               T+ C+N+ +C +P    C   A C        C C  G++  P  +C    E           +       AD F+ +C+    +       C    ECT    C       CM N     CV P                  P  CG N+VC        CSC  G    P  +C  +   +E+  I+ C     G++S C D+     C C +G++     P  C  +        + QA  N +CVD   +                C     CE+   S +                C CP G   + +  C+ +   ++  V S   D C       N  C N   G  C C   F         +C+   +CQ   +C++  C+N                   C +   C  N++         C     +  C C  GY  +      P Q           C  NA+C++R+    C C D YQ +    CR                 N+CQ  D C  +    A C   +    C C  GY GD   SC+ +           C P+ C     C++ NG
Sbjct: 10129 CGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGN----NALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLA------------------------CINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRA-CLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVG-------------RAPNCRP---------------------ECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPC--PGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVN-QRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGA--CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK-PSPCGPYSQCL--DTNSHAVCSCLEGYIGAPPSCKPE----------------CV-----VSSECPQNRACINQKCED--------------PCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV--------KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPEC---VVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSP------ACSCLPNFIGAPPRCRPECVLNSECGPTEACINQ-KCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCR--PECTLSADCPR--DKACMRN----RCVDP-----------------CPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCR-VKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIG---APPQCRPECVVSSECSALQACVNKKCVDPCAAA---------------CGLEARCEVINHSPI----------------CGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSN------------------PCPE--SCGTNAE---------CRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQ--DPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANG 12277          

HSP 10 Score: 120.939 bits (302), Expect = 5.171e-26
Identity = 556/2406 (23.11%), Postives = 781/2406 (32.46%), Query Frame = -1
Query: 1190 CGENAECIDTDGGYYCQCKTGFTGHC-------DECRDIDECAFSL----NNCDSD-----RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE-NECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVN-----STCLCKSGYENSTNQ---CINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN-CFKKDTDTDACQIENYCTDGDCYDG----ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXX----XSLSSDSSQCIDIDECNENVD-DCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC----NNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD-------------------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYS-------------RNSSSGLCETNNVCNCGSHGICGP--NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINT------PGS---------YK----CQCPENFYGDPQNKC-------FEDKCKTKALQCQAGEVCKLSLYGSVC---------EKISCNSSEILINNECLPVNQVCQNIN--------CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCP-------NNSFCQ-NKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTI----------GSFKCE---------CKDGFIGDGKYDCR----------------IDSKCEKYGGCHEDA-----SCIVN-VESSIY---ECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCN-DIDECANDN-----THNCSSLEKCVNSNGQYNCVC-----GDG-AVYVDDICVDIDECSSNQ-----------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVA----------NCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCD--------VPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTD-----NCDRET--SNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSP---------DFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC---------------PDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCIETDSCPARDD--------VKCPTG--SYCNMIGNFIYCNCTNGYEDSNQMECIGDV--CYKKCSDIDECVTRKS------------ACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALET------HTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV---------------KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGF-----------SCQCKPGFKWSDET-NLNCEDIDECTNPTSCSSMP-----------HSICMNNPGSFECVCPHGFS-----------LQGGYCNDINECLIPNSCGQNSVCANTVSGFN----CSCANG-ARQLPN--GDCELINECLENI--------DRCQVLNGADSVCYDLPIGYACVCPDGFVND---EVFPQV-CENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEI-SEQSNMKFCNNGKCINTAGGF--------------TCDCPEGFIYNNYD--------CIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENS--TKCVDIDECQFPNSCLDGLCNNL-PGS-------------FECLCNIGYD---LVNGKCTDINE----CSNNSQICGPQAAGI---CINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDR--------SNGYE-----------CICKDGYQEDQIGIC---------RNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNS 7063
            CGENAECI  + G  C+C  GF G+          CR   EC  S       C S       A C+       C+C  GY+G+  V     +     + C   +  C   NG   C C  G   +   +C+ E +EC    N C  N+ C    G+ +C C   Y G   +   +     C    C  N  C       S C C   Y  S N    C+          C   A C D+    +CYC +  IG+    C K     + CQ      + +CY       C+C SG+V  + +   E    VC  N     ++                LS D +  I        VD DC  +  C   +  YD                        C  +C  G +C    ++  CSC  GL                  C+P  C  N+ C+      +C C PGY G     C+                    +D C G I  C IN  C+  + +  C C  G+              +N S   C  +    CG H +C    + +  C   +  N     +   EC   S C     C+        PGS         Y+    C CP   +G+P  +C          +     L C A   CK    G  C           I C   E ++N++C P  + C N          CG +A C++ N    C C  GY GD  +  +       +   P        NS C+   DG   C+C   F+               EC++S  CA N  C N            G  +CE         C+  F GD    C                 + S C     C         SC+ N + S  Y   EC   +E   D   +CI N  C     + C  NA C  +  +  C C + ++GD +  C+  I E   D+      + C+    C   N    C C     GD  +      C+   EC S+            T  C +NA C       SC C  GF G+       D CK  V            C  N++C +  G   C CQ G  G    C  E     EC +           P    C  NA C+  +    C C + Y+G  +      P +        +P+ C +N  C   N N+ A C C P        C P  EC    D      C R+     C+ +  GF   C    +    +C +  E DP +          D     C  S  G    C    G+  C+C Q    +   +C+P                +C+ + D      C      IN  C   D CA   ++C  NA C       VC C               P N+ L L K  C         P  CG  S C        C C+  Y     NC+   EC        D A    RC +  PG+C              C C  G+TGD  + C+     P   D        V  P G  S C +  +   C+C   Y        IG    C  +CS   EC  R +            +C   A C  +  A VC C    +GD  + C    E  +E         C LN + CE  +          C C   Y                  P ++ C+N+ +C++P    C  NA+C     +  C C  G+   P   C  + E     D     + CQ    G             C C P +  S       C    EC    SC +             +++C     +  C C  GFS            +    +D  +  +P+ CG NS C   VS  N    CSC      + PN   +C   +EC  N+        D C    G  + C        C C DG+  D   E  P++    Q     N   C A N+ C +  G   C C P ++ +   +C    EC + S+ S  + C N KC +   G               +C CP GF  N              V+ C        +  C +VNGH +       C C   ++    +   +C    EC    +C++  C +  PG+               C C  GY     V  +C    E      +N   C P   G    C     +  C C     N  G++ N C+   EC  +N  CP+N  C++         S G+            C C  GY  D    C           +  CQ    C   A+C + +G+  CTC   Y GD    C+  C  NS
Sbjct: 8642 CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGL-NALCELDNGNPICYCPKGLTGNPFKNCIPEGDEC--TPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAIC-DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMG-YRCYD-----------------------PCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAI--CGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPS---PCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR-PECVLNSDC-PAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQ-------PECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSD--KACI-NEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF-----DGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSIC--RNVNNRAECSCAPGMFGAPPNCRP--ECVINQDCPSNRACIRQRCEDPCIGIC-GFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP----------------ECVQNSD------CPNNRACINMKC--RDPCA---NACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPC--------RPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCK--PECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNY--------IGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLN-ALCEERNQAA------ACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQ-KCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECR--VSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGA-NAVCKERNGVGSCSCLPEYNGDPYTEC--RPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYS-QCREVNGHAV-------CSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFV--RCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSC---LPNFVGRAPN-CRP--ECT-INTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQ-PSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNS 10916          

HSP 11 Score: 112.464 bits (280), Expect = 1.796e-23
Identity = 448/1887 (23.74%), Postives = 639/1887 (33.86%), Query Frame = -1
Query:  455 CHILAQCINTPGSYKCQCPENFYG----DPQNKCFEDKCKTKALQCQAGEVCKLSLYG--SVCEKISCNSSEILINNECL------------PVNQV-------CQNINCGNHAFCKIENGRADCFCDSGYYGDGEL--CVDVDECSNGDVSCPNNSFC-----QNK--------------DGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCAT----NGECQNTIGSFKCECKDG---FIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNN-LCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTN-KCSSNAICQNKEGTYSCQCAEGFYGD-----GLLCHDIDECKFGV---ANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET----SNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTK--GSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQ--------------------ENPMICGDLSKC------------LNTDGSYECQCVTGYKWNGTNCED---------IDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSY----CE-----------NLDNTVNVLAPFQCHCFNGY----------VKIPGTQICLNKNECLNP-------VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNG-------ADSVC-----YDLPIGYACVCPDGF-VNDEVFPQVCENQNECEINIHSCQ---------ASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTC----DCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNN----SQICGPQAAGICINAAGSFQC-KCNVGYENSGGKSYNPCQSVNECVKLNIT--------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA---ICGPNS-CLPGQLCQIVNGNQYDCGCVCQGPRCRDN--------------GPVCDTQGITYQS---EKQMFETTCKQNI---VGEVEYYNECQKSCATV-TCPGIEKCSMVNDRPSCTCQNCTQAELTPRLFCSNNGIEFHSICQMKTWICNTK---SEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKASMFNGNCEDPLFETQQCYNGPCPGDACENITCAPGSFCESGKCICPDCSDQRIPDPVCGKIGDLESGTYRTFC 5488
            C   A C+      +CQCP   +     DP N C    C      C   ++C    +    VC++ SC  + I +  +              P+ +V       C    C   A C++      C C   + GD +   C    +C NGD  CP N+ C     QN               +    C+C + FQ + +         I +CL    C      NG+C+    + + +C DG           C   S+C     C E   C +        C+ + E   D   SCI+N  L      +SC  NA+C       +C CP+GF+G                           N   +  CV         + C     C  NQ N  C+  A C   E  Y   C +  Y       G +C+    C+ G    A+C    LC+    T  C+C  G +G    C D DEC +         C  +A C+N    Y C C  G  G G+    Q  C  P  C                   KPD    N  CI   +C   TD C        +NC        C C  GF  +G    D N+               +G GC   +      C  ++    E N   KP D  + G  NC          +D   TC C EG+Q +N  C D++EC  +   C + A CNN+ GSY C+CP+ L  D  +  C D NEC                     E    CG  + C            LN+ G    +CV     +  +C           ID C++    C  LARCS       C C+ G TGD    C++   C  + D +C  GS C+       C+ TN    S Q+ C+  VC   C          S+C +F  C+NN    +CT         +  C   +EC  E  TC L+ +Y    CE           N +      AP  C C  G+          ++      C N   C N        +   C ENA+C        C C+ GF   P  +C+ I+ C +    C   + C++    + C C PG    D  N  C    EC     C   PH+ C    G  +C              D+   L    CG N+ C        C+C +G    P    + +  C      CQV          +DSVC      D   G   VC  G   N  + PQ C    EC +  H  Q          S  ECV    +    C PG++      C D   C     ++++  +N KC+  +   TC    DC  G +  +  C  V  C +D   S +++C   N  C+N      C  N    +  +   C          SCL+ +  N      C+ +   +     C +  +C N       +C P    +C + AG     +C  G      +  N C     C+ LN          CP    CV    G +C+                + C    +C   A C   D   +C C  G  G+  V+CK     CG N  C   QLC   +         CQG +CR++                VC+T     Q    E +M +T C+ ++     E     +CQ  C T   C     C +VN    C C         P  F   +G+   + CQ+    C+      E        C R+ DC   +  +   C   CG  R                        Q C  G C      N  CA    C +GKC  P C++++     CG+        +R  C
Sbjct: 1795 CGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPC-VYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQ-DCSDGESCLKNVCVVACLDHSQCASGLACVE-GHCTIG-------CRSNKECKQD--QSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEG---------------------------NPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCL----TGKCKCATGFIGTPFGCSDIDECTEQP-------CHASARCENLPGTYRCVCPEGTVGDGY---SQPGCSQPRQCH------------------KPDDCANNLACI-HGKC---TDPCLHTVCGINANCQSEGHEALCSCPAGF--LG----DPND---------------TGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQ--------VRDHKATCACYEGYQLVNDVCEDINECLSQ--PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNA-CGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYC--QQDGQCAQGSICSHGICSPLCS-TNRDCISEQL-CLQGVCQGTCKS-------NSSCPQFQFCSNN----ICT--------KELECRSDSECG-EDETC-LSDAYGRAKCESVCLGRAACGRNAECVARSHAP-DCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAP--CGPGARCRNARGSYKCTCPPGL-VGDPYNEGCRSSVECETNEDCP--PHAACTKTNGVAKC-------------RDVCAQL---QCGPNAECVPKGHVAQCACRSGYDGQPA---DRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYT------CRD-SMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKC--VYGCHVDDDCSASESCR--NDKCVNPCLENPCGPNAACSVSNHRASC----------SCLESMVPNPTPQVGCVRSPPLE-----CRENRDCGNGLACFESVCRP----LCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCV----GQQCV----------------DPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGS---------CQG-KCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQC---------PAAF-MGDGL---TGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTV-------------------GQLCERGACIAGCKSNGDCAADQSCVNGKCSDP-CANEK----ACGRNALCTVSEHRMLC 3427          

HSP 12 Score: 106.686 bits (265), Expect = 9.513e-22
Identity = 517/2272 (22.76%), Postives = 738/2272 (32.48%), Query Frame = -1
Query: 2141 TCSNDAFCDFKDDDYGCHCKNGFMGDGIM-CKDIDECSNN-----TSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTC----TNINECYPLSPCDNATEECFDKVPG--------------YECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVS-------TNCNNTFGSYRCDCKYGFRPSPIDS-----FVCTDVNECNLVHECDK------------NYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYL----GQCFCKHGFQNN--------VTTNICEDIDEC------DTAANDCAGRKAKCANLDGSYECECLYGY---------RMSSXXXXXXXXXXXXXNL-HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRA--------TCENSIG----------SFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNG---GFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VN--STCLCKSGYE-----NSTNQCINTD---ECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENV-------CPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKV-CMAVPLSQCNQSC-------PTGQYCNNG----------SCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTP-----------GSYKCQCPENFYGDPQN---------------KCFEDKC-----KTKALQCQAGEV-------CKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG----ELCVDVDECSNG------------DVSCPNNSFCQNKDGSFHCACNVG---------FQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND--NTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI----CVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGV--------ANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-CIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-----NDTCIPKTECENKT--------DNCD---RETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLK----------LDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALET-----HTCNLNT-------SYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNK-----NECLNPVE-NDCVENAICIDTEGSYECRCKSGFKQLPS---GKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDE---CTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP---NGDCELINECLENI--------DRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVF 8056
            +C N+A C   + +  C C+ G  GD I  C+ + E  N       S C  N+ C+      +CSC  G+ G   TC    TN +EC     C    E C D  PG                C C  G+      G C        T +               C    G+  C C  GF  +P D+       C + ++C  V  C +            +YA CT       C C  GY GD         C    V  RP                         NPCN   C  PN  C        C C+ GF N         V +  C     C      D   + C G +A C   + S  C C             R++  N            +   CG NA+C        C C   F G    CR   EC  + + C    A         C  S G             C C EGY GD  V C++ +E           +      N      ECRC + Y+ +    C  E         C  +ADC           R       R  DP  G+  CG      NA+C  +N    C C  GYE     N   + +  D   E  S + C  N+ C D +G  +C C EGYIG    C  +   +  C     C +  C D  C    G         + RCE +       CP            V        + S        D C  +   C  NSIC N      C+C P +     + +  C+  P  Q  Q+C       P  + C             SCSC  G              +    C P  C  NA C ER     CKC   Y+G   + CR           C ++ DC   +     +C R   ++   G+C  N  C   +H    PN  C C  GY  +P   C+ V   +  +P  +   CI +P           G   C C E F G P N                C + +C     KT  L  +   +       C L + G    +            +  PV + CQ   CG ++ C++ + +A C C   + G        CV   +CS              D SC  +S C+ ++    C C  G         F+ +E    +   T  D C L + C +N EC+N I    C C   + GD    CR   +C     C    +C+                          N  C       C +N+ C+  N    C C  G+ GD +  C      A D    + C     C  S     C C  G +         C+   ECS +               C   A CQ      SC C  G+ GD       +E K           + C  N+ C    G  AC C A  +G   +C  E     EC   K         P    C  NA C   +    C C  GY G  +  C K+    + + C  +  C P+ + +  +C C P++  +        CI   +C  +         D C       + C  L+    C C  G+N  GN      +C PT P    Q C  S  G    C       VC+C    +      C+P                +C S+ +      C+     +N  C   D C     SC  NA C+ +  +  C C               ++  ++    ++ C+ +P  CG  S+C     +  C C+  +  +   C+   EC   +    +LA C N     KC+                D CP      C + + C ++ +   C C  G       +C   V  +    I+ C  + S C   AEC   +GA  C C +   G+    C  + EC L +       C           S  +N +  V    P  C+CF G++  P  + C        +E +NP + + C  N+ C +      C C+S F+  P     +C + +EC   S+   IN  C D   G   Q              CE  +    C  PT+    P   C+  P     + P        Y    + CL P+ CG  + C N  +   CSC       P     +C +  EC  ++        D C    G  + C  +    +CVC  G+V D   
Sbjct: 11364 SCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQ--ERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFG-CQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGD-----PFFSCKPVPVTPRPPL-----------------------NPCNPSPC-GPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTC-GIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRP--ECVLN-SECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPE---------CTLSADCP----------RDKACMRNRCVDPCPGI--CGN-----NAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDP-CAAACG--------LEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQ-----DPCVPS--PCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRP---------ECVLSSDCPTDK-----TCIRNKCQDPCPGICGLNAQCYAVNH---VPN--CVCNDGYTGDPFASCRRV---EVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQ-DPCDL-QPCGSNAECRNGI----CSCLADYQGDPYTGCR--PECTLSTDCAPTKACL--------------------------NKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNPSP-CGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYN--GNA---FVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIG-TPPLCRP----------------ECTSNSE------CLSHLACVNQKC--NDPCP---GSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSP--CGPNSECRAAGETATCTCLGDFVGSPPYCK--PECVANSECPSNLA-CINQ----KCR----------------DPCPGL----CGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIV--QDVEIINPC--QPSPCGANAECIQRNGAGACQCLTDYFGNPYEGC--RPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPM-CNCFAGFIGDP-YRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSEC--ASNRACINQKCVDPCPGVCGQ-----------QAICEVRNHSPICRCPTAMIGDPFVRCIPRPT----IAPPPLRDVAPY---RDPCL-PSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFL 13409          

HSP 13 Score: 97.4413 bits (241), Expect = 5.735e-19
Identity = 475/2027 (23.43%), Postives = 661/2027 (32.61%), Query Frame = -1
Query: 2294 RCDCKYGFRPSPIDSFVCTDV-------NECNLVHECDKNYAKCTNTPGSYYCTCDSG---YQGDGR-------NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYG-----YRMSSXXXXXXXXXX--------------XXXNLHQ-CGENAECIDTDGGYYCQCKTGFTGHCD---------ECRDIDECAFSLNNCDSD--------------RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDT-NGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNAL------CVNSTCL----CKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDG-INCFKKDTDTDACQIENYCTDGD-CYDGICHCPSGFVFKSNKCFDER------CENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENV-------------DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSC--SCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLY--GSVCEK-----ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECK---DGFIGDG------KYDCRIDSKCEKYGGCHEDA--------SCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI-------DECANDNTHNCSSLEKCVNSNGQYNCVCG---DGAVYVDDICVD---IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGA--------PECDENAVCKNKDPGYTCECQSGYK-----GTGWFCIK---QTPCDVPNACKANQTCTPSNENSLAICECKPDF--------KLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNT-KGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ------------RINGSCVDVDECAD--------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCV---TGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPG-SCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKK--CSDIDECV--------TRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEE--KSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCE----------------DIDECTNPTSCSS------------------MPHSICMNNPGSFEC-VCPHGF----------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGAR 7633
            +C C  GF  +P     C  V       N+C   H C  N     N P +   +C  G   YQ   R       NC   + C+S++ CQ                     PGCD D  C       P E+C  G+C C  GF    T   C DIDEC      C    A+C NL G+Y C C  G     Y     ++  +                      LH  CG NA C        C C  GF G  +         EC D  +CA     CD++              +  C+      TC C EGY     VC +I+ECL        S  FC N+ G + C+C  G   D     C D NEC   D  C  +A C N+     C  R    G   NC  Q     C    CPLN+       CV+  C     C        ++CI  D C    +C   A C   +   +C C  G  GD  + C +       CQ +  C  G  C  GIC   S     +  C  E+      C+  C  N+ C          C+      SDS +C + + C  +                C  N+ C  R  + DC C   +    K G  C  +  +  +  C   + C+N  C  +CL+G                        C  NA C       +C C+PG+ G     C  ID C  +   C     C N  GS+ C+C  G   +       SS  CETN   +C  H  C            + N    C+DV     Q  C   A+C+      +C C   + G P ++     CK     CQ    C  + Y   SVC+        C + E+    +C   N   Q   CG +A C ++N    C C  G+ GD        EC    V+C         DG     C  G+    +++    C +  EC  +E C          GS    C+   D F+G         Y C +D  C     C  D          C  N   S+   +         + +      C  +    C EN  C    A +  +C      D     N+          C +DN   C   E C+      NCV G   D     +  CV    +D C+      C +NA CQ  +    C C EG  G+  +      CK     C  N  C +    +A  CQ G   N   C  ++ C +     G           C +  +C+N+       CQ+G +      T   C+    Q PC  P  C     C   N      C+C   F        +L  + C P  EC+     C  + S       G +C          N C  K +C         Q C    G C+   K +  C  +Q  +N   S     D CA     C R     +S  +    C C +G++            R++  C     C          +  +C  NA C  +     C CP +   + + +       C   P  CG+ SKC    G YEC C+    G    G  C      A +  PC   A C  +     +C C   F  GD    C  T   P +D         C  +G  +      GYE   Q +   + CY    C     C+        T +  C   A C        C+CPS   G  +  C+   +C  E    + +    E +  + +              + P T  C    +C +P  N    C  N  C        C CKSGF     G+     +  E  + D+C+ N  C D      C    G       N +CE                 I  C     C +                   P+S C+       C  CP GF          +  GG C    +C   + CG +  C +       SCA G +
Sbjct: 2107 QCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQC---NLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQ---------------------PGCDSDADC------PPTELCLTGKCKCATGFIG--TPFGCSDIDEC--TEQPCHA-SARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGD-RACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECL---SQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNEC-LSDADCPASASCQNSRCRSPCE-RQNACGLNANCQAQAHQAIC---TCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCI--DPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQ----LQYCQQDGQCAQGSICSHGIC---SPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDS-ECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSG--CRKIECTS-DDDCSNDKSCDNHMCKIACLIGQP----------------------CGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFC--RDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNE--DCPPHAAC-----------TKTNGVAKCRDVC---AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVA--GCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCF--NPCLQPQACGQNAECVMQNHLKQCHCPEGFTGD-----SAKECVRVPVAC---------DGE----CGPGYT-CRDSMCLPVCHNDLECASNEKCLK--------GSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN--ECGHGELCLG----LNCVPGCRSDQGCPPELSCVGQQCVDPCA--DPTACGTNAHCQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQ-GKCRNDQNCLADERCMR-----GTCRTVCNTDEACAQGQICENR------MCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHG--VQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQC----ARGKCRNKCGPKRQCT------VGQLC--ERGACIAGCKSNGDCAADQSCVNGKCS-----DPCA-NEKACGRNALCTVS--EHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKP--CGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTT--PKQD---------CRTLGCEVGGCVRQGYEYVCQQD--TEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAE----DTDPKTKEQIPCSTDS-------------ECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLT---SCAGGVK 3923          

HSP 14 Score: 95.9005 bits (237), Expect = 1.630e-18
Identity = 201/864 (23.26%), Postives = 290/864 (33.56%), Query Frame = -1
Query: 4238 TSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKS---NKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNE-NVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--------GSC--SCLMGLNSQTD----DDGNLN-----CSKNSAS--------CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQD----------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP-----------VNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCH---EDASCIVNVESSIYECQCHTEFSGDGITS----------CIKNNLCFVNGK------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND-------NTHNCSSLEKCVNSNGQYNCVCGDGAV----------YVDDICVDIDECSSNQ-----TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDI----------DECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DEC 6457
            T C  N+ C   H   ICYC   +IG    C  + T    C ++ YC +  C D    CP     ++    +     C  VCP +   +                       ++ DE N      C  NS C    G   C C P Y      G      P    +  CP  + C N        GSC  S L  + + +      +G +      CS+   S        C P  C +NA C+      +C+C PGY G   + CR           CT+N DC +     +  C     R+   G+C  N +C   +H     + +C+C +G+  NP   C+           VN CQ  SPC   +QC  + G   C C   F G P +                C   KC+      C     C +  +  +C      + + L    CLP           +   C    CG ++ C++ NG A C C   Y G    C    EC+  +  CP+N  C N+     C    GF                            +C     +  C C  G+ GD    CR+              + + C  N   +  +C C  E+ GD  T           C +N  C VN K        C  NA+C+ VN    C CP+   G+ +  C  I +               C +  +C+  NG   C C  G            Y    C  +  C +N+       KC  NA+CQ  +    C+C   + G+  + C+ I          D C+   + C  N+ C N  G   C C     G    C  E    DEC
Sbjct: 17545 TPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRD---PCPGACGIRAICHVQNHGPLC--VCPPHLTGNPLLACQPIVIPP-----------VERDEVNPCQPSPCGPNSECQATSGGARCSCLPQY-----HGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP---------ECTVNSDCPSHRACMSEKC-----RDPCPGVCGLNALCQVINH-----SPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQ-PSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAL--TRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNC--RPECTI-NAECPSNLACINEKCRDPCPGACGFA--------------------------AQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRAC-VNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQ--PSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDEC 18333          

HSP 15 Score: 90.5077 bits (223), Expect = 7.428e-17
Identity = 439/1941 (22.62%), Postives = 634/1941 (32.66%), Query Frame = -1
Query: 1901 CDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN-CFKKDTDTDA----------------CQIENYCTDGDCYDG-------ICH--------CPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDE--CNENVDDCQE-----NSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINN----------CTINEDCSNTEGSFTCSCKRGYSRNS-------------SSGLCETNNVCNCGSHGICG---------PNYICQCKSGYEINPSGMCQDV----------NECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE------DKCKTKALQCQ------AGEVCKLSLYGSVCEKISCNSSEILINN---ECLPVN---------QVCQNINCGNHAFCKIENGRADCFCDSGYYGD----------GELCVDVDECSNGDV--SCPN----NSFCQNKDGSFHCACNV-----GFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCR---------------IDSKCEK--YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNL------------CFVNGKSSCHENAICEQVNATYRCICPD-GFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNC--VCGDGAVYVDDICVDIDECSSNQTN----------------------KCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAP--ECDENAVCKNKDPGYTCECQSG-----YKGTG----------------WFCIKQTPCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCEC---------KPGFNMV-GNTCQDKNECDPTSP---DFAAQKCLASGGGCLNT-KGSFVCTCNQEQMNENNSSC---KPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR------INGSCVDVDECADKIDSCKNNA---TCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPG----SCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDG----------KTTCEDQNECALETH--------TCNLNTSYCENLDNTVNVLAPF-----------QCHCFNGYVKI----PGTQICLNKNECLNPVEN---DCVENAICIDTEGSYECRCKSGFKQLP-----SGKCENINECEEK---------------SDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCE---DIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ-------------------GGYCNDINECLIP-------NSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVF---------PQV----CENQNEC--------EINIHSCQASN----SECVDTYGSFKCVCKPGFSKNSDGDCV-DYDECEISEQSNMKFCNNGKCINTAGGFTCDC 6685
            C  N++C  T G   C C   Y G+   C P    E      CP +  C N  C+               D C    SC  +A C     S +CYC EGY+G+    C + +    A                CQ  N  +   C  G       IC         CPS     S KC D  C  VC  NA+C + + SPVC C  G   +   S  I   E    E V+ CQ      NS C    G   C C P ++      +     P    +  CP  + C N  C                          PG C LNA C  R    +C C+PG+ G  +  C  +       +N          C     C    G  +CSC   Y   +              S L   N  C     G CG             C C +GY  +P   C+ +          + CQ  SPC   A C N     +C C   ++GDP   C        D  + +A   Q       G     +L  +V     C+  E +  N    C P+            CQ   CG +A C   NG A C C +GY+G              C  V  C N      CP     N+ CQ      HC C        F +     V      + +      C  N +C N  G  +C C   F G    +CR               ++ KC     G C + A C V++   I  CQC    +GD    C+                C+    S C  NA+C      Y C C    + G+ Y  C    EC  ++   C + + C+ S  Q  C  VCG  A+   +  + I  C    T                        C  N+IC+ +     C+C  GF+G+ L      EC    ++C+++  CIN     AC  + G      T      C  P    G P  +C+E    +  DP     C+S      Y G                    C+ Q  C  P  NAC  N  C   N    A+C C P+F        P  +C  +              +P  K EC         K   N V  N C+  N C P +          C+ + G   N  +  ++  C  +     N +C   + +D C  G   C      C +  +    C C++G++           C   DECA  + +C+N      CN  IG+         +++  +  C        NP +  DL        + + +C +     G  C+  + C + THPC   A C  V      +  C C PG+ G+    C +    P RD                    CT+  +  +   C G  C   C D        S C + A+C       +C+CP    GD           KT C   +EC   T          C        N +  V    P            Q  C+    KI    P  + CLN+N C++P  +    C   A C+       C C +G +  P     +G C+   +C +                 + C++N++C  +     C+C+PG++ +     +        +C     C S     C+N   +  C  PH  + Q                   G    DI+   +P       + C  NS CANT    N +C +  R                ++RC    G ++ C        C CP GF  +            P++    C   ++C        EI I  C A +    + C        C C PG++ N    C+   D   +  +S+    +N  CINT     C+C
Sbjct: 17654 CGPNSECQATSGGARCSCLPQYHGTPPFCRP----ECVNSADCPADKACRNYKCI---------------DPCPG--SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDP-CPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCR-----PECVISAECPADRACINQKCQ----------------------DPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQ-PSPCGANALCNNG----QCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPP-NCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLH--IPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCY---PSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCR--PECVGNS--ECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLS-SDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQK-CRDPCLNACGINAICRAINHK--AVCSCPPEFYGS-----PYAQCLRQLP------------EPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPC--GFTQCGTGA-ICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHL-ACRNERCEDPCNCGIGA-------QCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECK--NPCDV-THPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKE---PPRDQ------------------GCTSHDQCQDTEACRGGNCVNPCLD-------ASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNEN-CVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPS--KLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACR----------------LERC----GVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNC 19444          

HSP 16 Score: 87.4261 bits (215), Expect = 6.579e-16
Identity = 344/1590 (21.64%), Postives = 497/1590 (31.26%), Query Frame = -1
Query: 3983 QLECTNI---TCSNDAFCDFKDDDYGCHCKNGFMGDG-IMCK----DIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTC-----TNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNY--------------AKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPG-CDGDNPCNTVQCTKPNEICYLGQCFCKHGFQN--------NVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQ---------------CGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKD-----GKVCMAVPL-SQCNQS-CPTGQYCNNGSCSCLMGLNS------QTDDDGNLNCSKNSA----SCL---PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD---------------------------------IDECGGKINN----CTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC----------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVC---------EKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSK--CEKY------GGCHEDASCIVNVESSIYECQCHTEFSGDG-------ITS--CIKNNLCFVNG-----KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDN---------THNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQ-----------------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDI-----------DECKFGVANCSENALCINKPGTFACECQAGTLGNGTT-----CGDEDECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-CIKQTPCDV--------PNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK 8077
            Q +CT+    TC  +A CD  +    CHC +   G+  + C     D+     N S C S A C+   G   CSC   + G   +C     TN  +C P   C N  + C D  PG                 C    EC    +              S  C C+ G+  +PI         +C+++ E  ++               ++C     +  C+C S + G   NC    EC SN  C +      N       RC D  PG C  D  C  +         +   C+C+ G+          ++     E +  C+   N C G  A+C   +G   C+CL  Y  +             D   Q               CG+NAEC   +    C C +G+ G          C+                I  +   C     G  S C E +    G+  CS   +F      G    C    + + + +CV           C  +A+C   + + LC C+AGY G     DP      C  +  P   +           ++ + + C         + C  NA C  + G  IC C   Y G   NC  + T +  C                         S  C ++RC + CP +                                       C  N+IC  R     C+CP  Y+ D F +           V L   CN S C     C NG CSC+           + +   N +C +N A     C+   PG C  NA C+      +C+C     G     C                                   I++  G   N    CT N DC         +C+R +  +   G C  N +C+  +H       IC C   +  NP   C             N CQ  SPC   A+C +     +C C   + G P N                C   +C+   +  C +   C +  + ++C            SC    ++   E   + Q C    CG +A C+ E     C C   YYG+       +  +N D  CP+N  CQ +                     D C  +        CA N  C+       C C++GF+GD    C+I  K   ++Y        C  ++ C  N E +I  C C  E+ G         +TS  C  +  C            C  NA C  +     C C  GF GD ++ C  +                   C    +C ++ G   C C          C    EC+ N                     C  NA+C       +CQCA GF G+    CH             D C      C  NA+C        C C    +GN        C    EC   K         P    C  NA+C+       C C     G  +  C    P  V        P+ C  N  C   N N  A+C C  DF     +C P+
Sbjct: 13476 QQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNY-DCSPSLACQN--QRCVDPCPGA----------------CGAYAECRTVNH--------------SPFCSCRPGYTGNPI--------VQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRP--ECVSNSECSQVHVCSNN-------RCKDPCPGLCGTDAVCRVIS--------HSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCN--PNPC-GAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGD-----PYRYCSIE-----------PKPIREYVNPCQPSPCGPNSQCREQN----GVATCSCLPEF-VGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTG-----DP---FTRCYPIPSPPTHIV----------HDYARHPC-------QPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSEC-----------------------LSSLACINQRCADPCPGS---------------------------------------CAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLP-----RLACQRQHCIDPCPGTCGFNALCHVVNHA-----PICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQ-PSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAE---IVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNND--CPSNKACQQQK------------------CRDPCPGV--------CALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAI--CSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCR--PECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDL--ITCGPNAVC----NQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQC--RNINGQAVCSCLRDFIGVPPSCRPE 14842          

HSP 17 Score: 83.1889 bits (204), Expect = 1.206e-14
Identity = 505/2328 (21.69%), Postives = 749/2328 (32.17%), Query Frame = -1
Query: 2264 TCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSN--------NTSVCDSNAFCKNTIGSFSCSCKEGFEGNG-----VTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA--------GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDI--DECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDG----SVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTN-----QCINTDECE-------SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKC-FDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQC--IDIDECNENVDD------CQENSICFNRFGSYDCKC-------PPN------YLDVFKDGKVCMAVPLSQCNQSCPT--GQYC------NNGSCSCLMGLNS-------QTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKC-KPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTE-------------------GSFTCSCKRGYSRNS---------SSGLCETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTP-------------------GSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP----VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQ-VNATYRCICPDGFQGDGYNFCNDI-----DECAN---------DNTHNCSSLEKCVNSNGQYNCVC-----GDGAVYVDDICVDIDECSSNQ-------------------TNKCSSNAICQNKEG----TYSCQCAEGFYGDGLL-----------------CHDIDECKFG--------VANCSENALCINKPGTFACECQAGTLGNG-TTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC------------------------NQEQMNENNSSCKPI---DSCAMGLDNCDRKVE---DCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMIC---GDLSKCLNTDGSYECQCVTGYK-----WNGTNCEDIDEC-------AIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIET---------------DSCPARDDV-------------KCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRKSA----------CHKFAECTNNDGAYVCTCPSYLTGDGK-----TTCEDQNECA--------------LETHTCNLNTSYCENLDNTVNVLAP-----------FQCHCFNGYVKIPGTQICLNKNECLNP--VENDCVENAICIDTEGSYECRCKSGFKQLPSGK-------------CENINECEEK--------SDNCSINSVCQDKAD----------GFSCQCK---------------PGFKWSDETNLNCEDID-----ECTNPTSCSSMPHSICMNNPGSFECVCPHGFS------------LQGGYCND---------INECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELI 8056
            +C   A C        C+C  G++G+        E S         N S C  NAFC+       C C  G+ GN        CT  ++C     C   +E+C D  PG    C    +       C   N       +C+  + +  N + S    C+   R  P   +V    N C     C  N ++C  + G   C+C   + G   +C    EC  +  C   D  C+N       +C D  PG  G N     QC   N   +   C C+ GF  +  T            +ND          G  ++C  ++G   C CL  Y  ++ N   E          +C  N  CI+                 ++CRD     C F+        A C     + +C C  GY+GD      V             C  S      +    +C CL  Y  D    C    EC   ++ C  N  C+N      C+            DP  G   CG     LNALC  VN   +C      + N     Q I  D            + C  NA C++ +G+ IC C  GY G   NC  +   +  C   + C +  C D    CP        KC  +  C+ +                   +     +   QC  I +    E V D      C  NS C N  G  +C+C       PPN        D   +   CM     +C   CP   GQ        +  +C C +G+             D           C P  C  NA C  +   Y+C+C +  Y G   + CR   EC G  + C  N+ C  ++                       CSC  GY+ N+              +      CG + IC       +C+C  G+  NP    C+   EC   S C     CIN+                     S  C CP N  G+P  +C E +       CQ        +        +C+  E +IN +C      V+Q C++     CG +A C+  N +A C C   +YG     C+           C ++  C N     +  C                   + C  S  CA    C   +    C C +G+ G+   +C +        GC  D  C  N                    +C+        G + C   AIC    N   RC C DG++G+    C        DECA          ++  NC    +C   N +  C C     G+ AV  D +    + C+ +                    T+ C +NAIC+  +     T  C C  G+ G+  +                 C D + C+ G         + C+ +A C+ +     C C   T G+  T C +  E K   G     EC     C NK       CQ              PC   N C  N  C    +NS  IC C   +  +     P+ +C                    +K ECK   +     TC ++N  DP +     Q    +G  CL      VC C                        + E  +  N  C+P+   ++CA+      R+ +   +C      +   QC    +     C+   +C  K+ +C N    +     +VC           ++ CT  +   +  M C   GD      TD S  C  +T  K      + + C + + C       A +   C   A+C+      +C C  GF G+    C  T               D CP RD +              C  G+YC++      C C  GY  + Q  C+   DV    C    +C + ++           C   AECT  +   +C C    +G+ +       C   +EC+              L +  C LN + C   ++  N   P            +  C + Y     + +    NEC++P    N C +NAIC   +    CRC     QLP G              C +  +C  K         D CS+ S C   A              C+C                P      E++ +C D +     +C NP +C +  +++C        C C  GF                G C+          IN CLI + CG N+ C    +   C C +G R  P   C +I
Sbjct: 17710 SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRAC--MSEKCRDPCPGV---CGLNAL-------CQVINH----SPVCECHTGHVGNPYHS----CRIPQREPPAPEYV----NPCQP-SPCGAN-SQCRESQGQAICSCLPEFVGTPPSCRP--ECVISAECPA-DRACINQ------KCQDPCPGACGLN----AQCHVRN---HSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINA-----ECPSNLACIN-----------------EKCRDPCPGACGFA--------AQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGC--RPEC-VLNSDCPRNRACVNQK----CV------------DPCPG--HCG-----LNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVD---PCP-------GKCGLNAVCQAI-----------QHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMN---QKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCR--PECVGN-SECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRP--ECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCR------------------NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLL-------GCRSDGECAAN-------------------EACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIK--TGCTHDSECQPTTACINK------RCQD-------------PCAEANPCAGNAEC--RVQNSRPICFCPAGWGGD-----PQVQC--------------------YKPECKINADCPYDKTCLNENCVDPCT---HGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKL-ACINERCADPCATPHVC---------TPQQTCTVLDTLPKRAMACKCPGDTV----TDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCP-RDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALN-AECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDC--ASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCP---DQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGT--NAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI 19792          

HSP 18 Score: 82.8037 bits (203), Expect = 1.486e-14
Identity = 304/1340 (22.69%), Postives = 433/1340 (32.31%), Query Frame = -1
Query: 2486 CPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG---LCETNNVCNCGSHG-ICGPNYICQCKSGYEINPSG--------MCQD---------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGEL------------------CVD---VDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVT---------DSCTDIDECLL----------SESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLE-KCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL---CHDIDECKFGVANCSEN------ALCINKPGTFACECQAGTLGNGTTCGDEDE---CKKPKGSPGAPE------------------------------------CDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC---ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC-NQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSKDSSYTCQCIEGFQRINGSCVDVDECADK---IDSCKNNATCNNM----IGSYVCKC----------------PDNLKLDLSKKACTDRNECQ----ENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMEC--IGDVCYKKCSDIDECVTRKS--------------ACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE--DQNECALETHTCNLNTSYCENLDNTVNVLAPFQ-----------------CHCFNGYV--------KIPGTQI---------CLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSD-------------------NCSINSVCQDKADGFSCQCKPGFKWSDE---TNLNCEDIDECTNPTSC 5842
            C + A C        C+C  G+ G     C   D    +   CT++ +C +    F   CK         G   +CE  +     +    C P Y+ +   G    P           CQD         VN C   SPC   AQC+       C CPE   GDP   C+E             E+     + S C+  +       IN  C      C   N C  +A C+++N R  CFC +G+ GD ++                  C++   VD C++G V C N + C  ++    C C  G Q   N  ++         + C D + C             E+CA N  C       +CEC+ G+ G+    C I  K  K   C +DA C   +        C  E   D    C   ++C    + +C    +         C CP    GD             D + NC  +    V S  Q+N  C +  V  +  C+D     + +  +C  NA C  ++    C C +GF G+  +     ++D  +     CS N       +C N+       C A   G G  C  +     C+ P G  G P+                                    C  NA C  K+    C C+ G+ G   F      C   + C  ++ C   N   +  C       L +D C    EC  +    +      ++ DP  +C   EC   ++   N     NEC   SP      C A    C   +   VC C +Q  +    + C+P            R VE  C    D      CI+            D+C D    +  C   A C+ +    + + VC+C                P  L    S + C D+  C      NP  CG  + C  T     C C  G++ N   +C  I  C +    C     C N              GD I  C+  D C    +        C +  N   C C +GY  +    C  IG      CS  ++C T K+               C   AEC   +   VC CP    G+    C    Q  C L+T          E   +   VL P Q                 C C +GYV          PG +          C     CLN V  D   C  NA C   +    C C+ GF+  P  +C  I EC   SD                    C  N+ C        C+C PG   +     T L C   DEC    +C
Sbjct: 18847 CGIGAQCRVENHRAQCRCPAGFSGNPAVRC---DLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPP-----------EIKTGCTHDSECQPTT-----ACINKRC---QDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ--GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPK-PQCIQDADCPSKLA-------CINERCAD---PCATPHVC--TPQQTC--TVLDTLPKRAMACKCP----GDT----------VTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLD-----ACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNE--ICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCV--NRECINPC-------LASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC--VSPCGQRNPC-AQNAICQALQHRAVCRCPDQLPLGNPYAYCEP------------RPVEPVCRDDGDCPSKLACID------------DKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG-CRVDGE-CDSGKACIN--------------GDCINPCLINDPCGPNAE--------CYVQSNRAQCRCLSGYRGNPYERCRVIG------CSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKI-ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKAC 20059          

HSP 19 Score: 82.4185 bits (202), Expect = 2.058e-14
Identity = 160/684 (23.39%), Postives = 216/684 (31.58%), Query Frame = -1
Query: 4091 NANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQ----------DVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQ---------------NKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQV-----------CQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCH------EDASCIVNVESSIYECQCHTEFSGDGITSCIK---------------NNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLE-----KCVNSNGQYNCVCGDG----AVYVDDICVDIDECSS-----NQ------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CH------------DIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-FCIKQTPCDVP 5833
            NA C ER     C+C P Y G   + CR           C +N DCS+       +C   + R+   G C  N  C   +H        C C  GY  +P   C             N CQ  SPC   +QC  + G   C+C  ++YG P                  C   +C    A  C    +C+   + + C      + +  +  + LP  Q            C    CG  A C++E  +A C C + YYG    C    EC+            QN D   H AC           V   C  +D C    +C  N  C        C C +G++GD  Y C                   + + C  N + S   C C   + GD    C                  N C      +C   A C+  N    C CP G+QG+ +  C      A    H C         +C     Q  C C  G           CV   EC       NQ         C   A C     +  C C  G+ G     CH             ID C    + C  +A C N+ G   C C    LG    C  E     EC   +         P    C  NA+C+  +    C C  G  G  +  C+  T  ++P
Sbjct: 15666 NAVCRERGEAASCQCLPEYYGNPYEGCRP---------ECVLNSDCSSH-----LACLNQHCRDPCPGSCAPNAQCQVVNH-----VPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQ-PSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRP--ECT------------QNSDCPSHRAC-----------VNQRC--VDPC--PGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCL--PSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIP 16298          

HSP 20 Score: 82.0333 bits (201), Expect = 2.333e-14
Identity = 521/2344 (22.23%), Postives = 752/2344 (32.08%), Query Frame = -1
Query: 1205 CGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRA--------TCENSIG----------SFTCRCNEGYSGDG-SVCSEIDECLLG--LHNCSRS----HQFCFNVNGGFECRCLSGYKSD---------------TNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSG-RNCDPQEGL------------EECGKLLCPLNALCVN----STCLCKSGYENSTNQC-----INTDECESQTSCDVNANCID---------THGSFI-----CYCNEGYIGDG-INCFKKDTDTDACQIENYCTDGDC-------YDGICHCPSGFVFKSNKCFDERC--ENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDI--DECNENV--DDCQENSICF---NRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC----NNGS--CSCL-----MGLNSQTDDDGNLNCSKNSA----SCL---PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKI--------NNCTINEDCSNTEGSFTCSCKRGYS---------------------------RNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC---------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDV-------SCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCA-------------TNGECQNTIGSFKCECKDGFIGD-------------------GKYDCRIDSKCEKYGGCHEDA-----SCIVNVESSIYECQCHTEFSGDGITS--CIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCN-----DIDECANDNTHNCSSL-EKCVNSNGQYNCVC---GDGAVYVDDICVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVAN------CSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-----------CIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK----TEC--------ENKTDNCD---RETSNCVQLDPGFKCECKPGFN-------MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKD--SSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLD------LSKKACTDR--NECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIET---DSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDID----ECVTRKSACHKFAECTNNDGAYVCTC-PSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFK-------QLPSGKCENINECEEKSD--NCSINSVCQDKADGFSCQCKPGF------------------KWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCP-----HGFS----LQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP---------NGDCELINECLEN--IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEIN---IHSCQAS----NSECVDTYGSFKCVCKPGF---SKNSDGDCVDYDECEISEQSNMKFC---------NNGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNI--------TCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYL-------------------ADCLDTDGSYKCTCKYGYKGDGIVSCKAI 7063
            CG NAECI  +G   CQC T + G+  E CR   EC  + ++C S+RA         C  S G          +  C C  G+ GD    CS+  E ++   ++ C  S    +  C  VN    C C S ++                 +N +C+++         C   A C   + S +C C    IG     C P+  +            + C    C L A C N    + C C   Y  +   C     IN  EC S  +C +   C D         T    I     C C  GY+GD  + C          +  + C    C         G C C + +           C   + CP+N                   L+    +C D     C  N   D     ++C       G+   +C P  LDV+++           CN S P G Y      NG   CSCL     +  + + +   N +CS + A     C+   PG C   A C        C C+PGY G  I  C  I E    I        + C  N +C     + +CSC   +                            ++   GLC T+ VC   SH     + +C C+ GY  +P   C         + V  C   +PC   A+C    G   CQC   ++G+P   C  +        C     C          +++C             VNQ C++    +CG +A C + N    C C SGY GD      ++     +         C  NS C+ ++G   C+C   F         + CT   EC L ++C              ++  CQ    +  C C+ G+ GD                    ++ C+  S C     C +       SCI N       C+     S + ++S  CI N  C      SC  NAIC   N    C CP G+ GD +  C+          A D+  N S      V  NGQ +C+    GD        CV   +C  N+              C+ NAIC        C+C E   G+  +  +         +      C  N+ C        C C    +G    C  E                 C  P   PG   C  NA+C   +    C C   + G  +             I + PC  P+ C     CT  +    A C C P++      C P+    +EC        +   D C       +NC  +     C C PGF        +     Q      P SP+      +    G + +     C C  E       +C+P                +C+++ D  S+  CQ     Q+    C  V         C  NA C  +     C C +    D      + +K       N CQ +P  CG  S+C   +    C C+  Y     NC    EC       HD A                        CI     D CP      C + + C +I +   C+C  G+       C+  +   +   +D     CV   S C ++AEC +N G   C+C PSY      T    + EC                   T+N   P    C               +  C +P    C  NA+C     +  C+C  GF         +P     +  +  +  D   C  N+VC        C C P F                   WS     N + ID C  P +C S  ++IC  +     C CP     + FS    L      D+ +   P+ CG N+ C N      CSC      +P         N +C L   CL+    D C  + G ++ C  +     C C   F  +      C       I    I  CQ S    N+EC     + +C C  GF     N   +CV   +C ++     + C         +N +C        C C  G   N +  C  V +    Q   +   C   N  C    G   C C   F          +  E   P   L+  C   P    CL     D   G C    EC     +                QC C+VGY+   G  Y  C  + + +   +         C  N+QC + +N   C C   +       CR   EC I   C                      A C   + S  C+C  G+ GD I  C+ I
Sbjct: 13106 CGANAECIQRNGAGACQCLTDYFGNPYEGCRP--ECVLN-SDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINA-ECPSHLAC-IGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRN-------------------LACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRN----------PCNPS-PCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISH-----SAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCN-PNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPE--------CVLDSDCP--------SQLAC-------------VNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPE-CTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQ-PSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACI-NQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDP--CPGT--CGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQ-PSPCGPYAKCT--SVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGS-----CQCLPEYYGNPYETCRP----------------ECVTNNDCPSNKACQ----QQKCRDPCPGV---------CALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSP--CGPNSQCRENNEQAICSCLPEYVGAPPNCR--PECVTSAECPHDKA------------------------CIRQKCNDPCPG----VCGSNADCRVIQHAPICSCRAGFTGDAFSRCL-PLPPSRPPQLDVYRNPCV--PSPCGQYAECRDNQGTATCSCLPSYF----GTPPNCRPEC-------------------TINPDCPSHLSC--------------QQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQG----QCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRN-KCIDPC--PGTCGS--NAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPF--AACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCG-ANALCSEGNGAGACKCLPEFYG--------NPYEGCRPECVLNSDC---PSHLACLNQHCRDPCPGTCGINAECQVRDHL---------------PQCNCHVGYQ---GNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPA-CR--PECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRI 15219          

HSP 21 Score: 81.6481 bits (200), Expect = 3.074e-14
Identity = 271/1185 (22.87%), Postives = 381/1185 (32.15%), Query Frame = -1
Query: 3983 CGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEEC-GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN---------------CFKKDTDTDA------------CQIENYCTDGDCYDGICHCPSGFVFKSN-----KCFDERCENVCPKNAXXXXXXXXXXXXXXXX-------------XSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINED------------CSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH-------------GICGPNYIC---------QCKSGYEINPSGMCQDV-------------NECQTQSPCHILAQCINTPGSYKCQCPENFYGDP----------------QNKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCE---------KISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNK-------------------DGSFHCACNVGFQ----------RLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-FC----IKQ----TPCDVPNACKANQTCTPS-NENSLAICECKPDFKLENDTCIPK 7063
            CG NA+C + +    C C  GF G   +CR   EC       +SD   C   +     +C +   G    C +  +C +  H    S    F+ N  F C+ L              N C  + + C  NA+C N +   +C C   YIG+  NC P     EC     CP+   C+   C                D C     C + A C        C C   YIGD                  C++    ++A            C  E Y   G+ Y+G   C    V  S+      C ++ C + CP +   +          S                   ++  Q +  + C  +   C  NS C    G   C+C P+Y      G      P    N  CP  + C +  C         TD      C+        G C  NA C        C C PGY G     C+ +       ++  I  D            C        CSC   Y         E     +C SH             G CG N  C          C  GY  +P   C                + CQ  SPC   AQC N      C C   + GDP                   C  ++C       C +G  C++  + ++C+          + C  + +    E  P    CQ   CG+H  C+    +A C C  GYYG    C    EC + D  CP +  C N+                   + S  C C  G+           R +++ +      ID CL S  C  + +C N  G+  C C   ++G   Y CR   +C     C  D +CI                          N  C       C  NAIC   N    C+C  G  G+ +N C          T   ++++                  Y +     I+ C   + N C +NA C  + G  SC C   ++G+       + C+     C  N+ C   P + AC               + +C+ P   PG   C  NA C   D    C C SGY G    +C    I Q    TPCD P+ C  N  C PS NE   A+C C P+F      C P+
Sbjct: 15450 CGNNAQCREVNDQAVCSCLPGFFGVPPKCRP--ECTI-----NSD---CAPHLACLNQQCRDPCPG---ACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPI---NPC--YPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRP-----ECITSSECPIQLACIGQKC---------------KDPCSGL--CGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYY---GNPYEG---CRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPS--PCGPNSQCTESQGQAVCRCLPDYY-----GSPPACRPECTTNPECPNDKACVSRRC---------TDP-----CA--------GACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQ-PSPCGPNAQCSNG----VCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHP----CQPSPCGHHGECREVGSQAICTCRLGYYGSPPAC--RPECVS-DPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQ--PIDPCLPS-PCGPHAQCSNEGGNAVCRCLTEYLGVPPY-CR--PECIANSECPSDRACI--------------------------NRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQV---------------LQYEEPF---INGC---EPNPCGANAQCNQRRGVVSCVCLPDYFGN-----PYEACR---PECILNSDC---PLSRACV--------------QQKCRDP--CPGT--CGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCD-PSPCGPNAQCHPSLNE---AVCSCLPEFYGTPPNCRPE 16461          

HSP 22 Score: 78.5666 bits (192), Expect = 2.504e-13
Identity = 50/122 (40.98%), Postives = 66/122 (54.10%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +ECS   + C   A CTNL+  +RCDC  G+ G G +E       C+D DECA   C   +DC NT GSF C C  G+       C D++EC+ N+  C   A+C+N  GS+ C C  GF
Sbjct:  255 DVDECSYP-NVCGPGAICTNLEGSYRCDCPPGYDGDGRSES-----GCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 23 Score: 78.1814 bits (191), Expect = 3.648e-13
Identity = 55/166 (33.13%), Postives = 79/166 (47.59%), Query Frame = -1
Query: 15605 DPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGD 16102
            D N+ C    +C N+    E++C C  G+E    +C DIDEC   + VC  +  C+N  G+Y C C+ G+VG+         CE     C A+A C        C+C++G+  N    S +    V+ D+ +       SC Q ATC + A G FTC C  G  GD
Sbjct:  543 DVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCED--VRCGAHAYCKPDQNEAYCVCEDGWTYNP---SDVAAGCVDIDECDVMHGPFGSCGQNATCTNSA-GGFTCACPPGFSGD 702          

HSP 24 Score: 77.411 bits (189), Expect = 7.000e-13
Identity = 404/1830 (22.08%), Postives = 586/1830 (32.02%), Query Frame = -1
Query: 1157 CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEIN-------PSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---KCFEDKCKTKALQCQAGE-------------VCKLSLYGSVC---EKISCNS-----SEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC---RIDSKCEKYGGCHED---ASCIVNVESSIYECQCHTEFSGDGITSC----IKNNLCFVNG-----------KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHN------CSSLEKCVNSNGQYNCVCGDGAVYVD----DICVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGL-LCHDIDECKFG----------VANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFC------IKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-----NDTCIPKTECENKTDNCDRETSNCVQLDPG--------------FKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPI----DSCAMGLDNCDRKVEDCISSK----------DSSYTCQCIEGF--------QRINGSCV---DVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLS--KKACTDRNECQEN------------PMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCE---DIDECAIK--THPCHDLARCSNVPGSCKCKCQPGFTGDGI----YSCIETDSCPA---------RDDVK--CPTGSYCNMIGNFIYCNCTNGYEDSNQMEC--IGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINEC-------EEKSDNCSINS-----VCQDKADGFSCQCKPGFKWSDE-------TNLNCEDIDECTN-------PTSCSSMPHSICMNNPGSFECVCPHGF---------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCAN--------GARQ--LPNGDCELINECLEN--IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQAS----NSECVDTYGSFKCVCKPGF---SKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFT----------CDCPEGFIYNN-YDCIDVDECSLDQVSSL----ADNCDQVNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQ--SVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVN 5857
            C P  C  NA C+       C C P Y+G     CR           C +N DC         +C R    +   G C  N +C+  +H       +C+C      N       P       + C   SPC   ++C     +  C C E+F G P N   +C  +      L CQ                +C +  +  +C    K + N       E +  +E +P N  CQ   CG +A C     +A C C   Y G    C            C  NS C     SF  AC        N    D C        S +C +N  C     +  C C  GF GD    C    +  + E    C  +   A+ +   E  +  CQC  E+ G+   +C    + NN C  N               C  NA+C  +N    C C +GF GD Y +C   ++       N      C    +C  +N Q  C C    V         CV   EC  ++              C SNA C+  +    C C  GF GD    C  +   +             + C + A C +  GT  C C     G    C  E                 C+ P   PGA  C  NA+C   +   TC+C  G+ G  +        I + P  + + C    TC P+   +   C C P+F           C+  TEC+  +  C R  + C+   PG                C C P   M GN         P         C  S  G    C N  G  VC+C ++ +     SC+P       C + L    R   D               + S  C CI  F         R     +    +D C  +   C  NA C     +  C C           +  C   ++C  N            P +CG  ++C   + +  C C+ G   N   +C+   D+ E        PC   A CS   G+  CKC P F G+        C+    CP+         RD     C   + C +  +   CNC  GY+ +  + C  + D   +    +     + S C   ++C  ++   +C C     G        + EC + +  C+L              LA  Q H                   C++P    C  +A C     S  C C  GF       C+ I          E   D C  +       C+ + +   C C PG+  +          N +C     C +       P SC        +N+  +  C CP G+                  +++   P+ CG N++C+    G  CSC          G R   + N DC     C  +   D C    G  +VC        C CP G  +   F Q    Q+   + ++ CQ S    N++C +      C C PGF         +C    +C        + C +  C    G F           C CP GF  N  + C  +      Q   +       C   N  C N      C C + ++        +C+   EC    +C+   C               D  +G C     C   S +     + ICI           +G   +G  +  P Q   +N C +    C SNA C +R     C C   Y  +    CR   EC +   C     CL+                    C+  C P SC P   CQ+VN
Sbjct: 14065 CNPSPCGANAVCQNGQ----CSCIPEYQGDPYTGCRP---------ECVLNADCPRNR-----ACVRHKCVDPCPGTCAPNAICDVINH-----IAMCRCPERMTGNAFIQCETPPVSLAPPDPCY-PSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNP-CQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNC---------RPECITNSEC-----SFDKAC-------LNQRCRDPC--------SGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDP--CPGA--CGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDL-ITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECD-WSKACVR--NKCIDPCPGTCGSNAICEVHRHIAMCHCPP--EMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGV-PPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPC--QPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEP---VPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPAC---RPECTISSE-CDL-------------TLACVQQH-------------------CVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINH--TPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICS---PGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPG-TSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRD-PCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGP-NAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCK--------------DPCSGLCGIAATCQVVSHV----PSCICIADY--------IGDPYTGCYARPPIQREQINPCYQN--PCGSNAVCRERGEAASCQCLPEYYGNPYEGCR--PECVLNSDCSSHLACLNQH------------------CRDPC-PGSCAPNAQCQVVN 15731          

HSP 25 Score: 77.411 bits (189), Expect = 7.000e-13
Identity = 404/1793 (22.53%), Postives = 620/1793 (34.58%), Query Frame = -1
Query: 2261 LHQCGENAEC-IDTDGGYYCQCKTGFTG----HCD--ECRDIDECAFSLNNCDSDR----------ATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSR-----SHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDG----SFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI-NCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVC----PKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVC---MAVPLSQCNQS---CPTGQYCNNGSCSCLMGLNSQTDD-DGNLNCSKNSASCLP----GICPLNANCEERLFGYICKCKPGYEG-------VGIKS----CRDIDECGGKINNCTINEDCSNT-------EGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH--GICGPNYICQCKSGYEINPSGMCQD---VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEK-ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECS----NGDVSCPNNSFCQN-----------------KDGSFHCACNVGFQ------------RLENALVTDS-CTD---IDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC-RIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQ-GDGYNFC--NDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDED-----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL---------ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR-INGSCVDVDECADKIDSCKNNATC----NNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCL-NTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIE-----------TDSC------PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKS--------ACHKFAECTNNDGAYV------CTCPSYLTGDGKTTCEDQNECAL-----------------------ETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQ-----ICLNKNECLNPVENDCV-ENAICIDT-EGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELIN 7072
              QCG  A C  D +    C C  G+ G     C+  ECR  DECAF L  C ++R          A C        CRC  G+SG+ +V    D        C+      S   CF    G EC+                N C    + C  NA C   D     + +C C  GY+G       +E   + G   C  +  C ++   C+ G  N  N C++   C        +A C+      IC C E   GD   NC++        +I+  CT    +D  C         +  C ++RC++ C    P          +    C        D        EC  N D C  +  C N           N +D    G+V     A  L+Q +Q+   CPTG    N   SC+ G     +D   +  C + +  C P      C LNA C  R     C+C+PGY+G       + +K+    C    +C  K+    INE C++            TC+      + + +  C  + V +   +   I  P  I  C+   E   + +C +   ++ C+ +  C + AQC       +C CP+ F G+P+            ++C   EV    +    C +   C   +I  N  C+     C   +CG  A+C ++  +A C C  GY G+  E C+   +           CP+N  C N                 K+    C C  GF             R ++    D  C +   I+ CL S+ CA N EC        C C  G  GD    C R++        CH D  C  N+     EC          ++ C + N         C +NAIC+ +     C CPD    G+ Y +C    ++    D+  +C S   C++   Q             D C  +  C  + T +CS   +      T  C+CAE                + V + S     +  P    CE       +   C D++     +C+ P        C  NAVC+       C CQ G++G  +   +   C V   C + + C   N + +  C       L ND C P  EC  +++       +  + +P  +C       ++G  C   N+C PT      ++C+         A    C       VC C  + +      C+P       LD       DC              G Q  IN  CVD   C   ++ C+  A C     + + + +C CPD     +S+     +  C+  P I  ++  C+ ++D   +  C+     +  NC    EC IK H                C C+ GF G+  + C +           T  C      PA    +C + + C  I +   C C  G+  + ++ C        C   DEC T K+         C   A C  ++   V      C CP   T  GK  CE +    +                        T  C +N ++C ++ +T+ V     C C  GY   P  Q     +C+ +   +  V+  CV      +D  E    CR + GF+   SG C    E            +  D+    +C    G++ +       E+  ECT+   C+   +  C               +L    C D   CL    CG N+ C        C C  G    P+  C   N
Sbjct: 18786 FTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLA-CRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAV--RCDLVPTQPEGCTMDAECPSKLACF----GGECK----------------NPCDV-THPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQG---CTSHDQCQDTE-ACRGG--NCVNPCLDASPCAR------SAQCLAQQHRAICSCPERTQGDPFTNCYEPP------EIKTGCT----HDSECQ-------PTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINAD-CPYDKTCLNE----------NCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ-GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLA--CINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPR------------IECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICI---SPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLE--------CHSDYDCASNLACVSNEC----------VSPCGQRN--------PCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDD-GDCPSKLACIDDKCQ-------------DPCSVLSPC--HPTAQCS--VLNSVPVRTMVCECAE----------------YEVPDASGACRKMMPPRLPGCE-------SDQDCPDQEACIHAQCRNPCN------CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACI--NGDCINPC-------LINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCR------VIG--CSSNNDC-PTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDT------DC-------------PGRQACINEQCVD--PCV-VLEPCQRPAICEVTPTSPVRTMLCICPDGY---VSR----GKGGCKPTPGI-KEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDH-------------KPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTP----LGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPG-TVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVN-AFC-SVRDTLPVRT-MICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALE----------RGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCAD--NRFC---------------NLDTKTCED--PCLT-KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTN 20323          

HSP 26 Score: 75.8702 bits (185), Expect = 2.057e-12
Identity = 179/769 (23.28%), Postives = 257/769 (33.42%), Query Frame = -1
Query: 3983 PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDI-------DECGG-KINNCTINEDCSNTEGSFTCSCKRGYSRNSS--------SGLCETNNVC-----------NCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQT--------QSPCHILAQCINTPGSYKCQCPENFYGDP----------------QNKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEI-------LINNECLPVNQ---VCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL----CVDVDECSNGDVSCPN-------------NSFCQNKDGSFHCACNVGFQ--RLENALVTDSCT-----DIDECLLSESCATNGECQNTIGSFKCECKDGFIGDG---KYDCRIDSKCEK-------------YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNG-------KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDE--------CKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-----FCIKQTPCDV-----PNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK 5851
            PG C + A C  +  G +C C P   G  + +C+ I       DE    + + C  N +C  T G   CSC   Y             S  C  +  C           +CG   +C     + +C C  GY  N   +C                 SPC + A C        CQC   +YG+P                   C  +KC+      C    +C++  +  VCE   C++  +        I     P  +    CQ   CG ++ C+   G+A C C   + G        CV   EC   D +C N             N+ C  ++ S  C+C  GF    L   L           DI +  +   C    +C+   G   C C   ++G     + +C I+++C                G C   A C  +V +    C C   ++GD  TSC                  S C  NA+C       +C C   + GD Y  C    EC              +NS+   N  C      V+  CV  D C  +    C  NA+C        C C E   G+  + C  I +             + C  NA C+ + G   C C AG  G    C  E               ++C  P   PG  +C  NAVC+       CEC   Y G  +       + + P  V     P+ C  N  CT  N N  A C C  +F+     C P+
Sbjct: 17601 PGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCE---CHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECP-ADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQC--SVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNN----GQCSCLPEYHGDPYTGCR--PECV-------------LNSDCPRNRAC------VNQKCV--DPCPGH----CGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDP--CPG--KCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCT--NVNGQAECRCLQEFQGTPPNCRPE 18326          

HSP 27 Score: 70.8626 bits (172), Expect = 6.655e-11
Identity = 47/128 (36.72%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9260 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA----LLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRG 9631
            D NEC      CD+ A+CTN    F C C  G++G        NG  C D DEC       +C   ++C N P  F+C C  G+      +C D++EC  N   C  NA C NT G+Y C+C  G+ G
Sbjct:  129 DENECKQ--RPCDVFAHCTNTLGSFTCTCFPGYRG--------NGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG 245          

HSP 28 Score: 69.3218 bits (168), Expect = 1.860e-10
Identity = 356/1593 (22.35%), Postives = 516/1593 (32.39%), Query Frame = -1
Query: 4013 KGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNT------------------SVCDSNAFCKNTIGSFSCSCKEGFEGNG-VTCTNINE----CYPLS--PCD----NATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG----RNCTDI--DECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGY------RMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRA--------TCENSIGSFTCRCN-----------EGYSGDGSVCSEIDECLLGLHNCSRSH-QFCFNVNGGFECRCLSGYKSD----------TNGSCVDENEC---RFFD---NGCDDNADCINTDGSFLCICRAGYIGSG----RNCDPQEGLEECGKLLCPLNALC--VN--STCLCKSGYENST----NQCINTDECESQT-------------SCDVNANCIDTHGSFICYCNEGYIGDG-------INCFKKD-TDTDACQIENYCTDGDCY----DGICHCPSGFVFKSN----------------KCFDERCENVCPK--NAXXXXXXXXXXXXXXXXXSLSSDS-SQCIDIDECNENVDDCQE-----NSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC-----------------------NNGSCSCLMGLNSQTDDDGNLNCSKNSA--------SCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNN---VCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKA-----LQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI--DECAND-NTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKE---------GTYS----------CQCAEGFYGDGLL-CHDIDECKFGV--------ANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-CIKQT---------PCDVPNACKANQTCTPSNENSLAICECKPDF 8092
            K E  +  C    C  ++ C  +D+   C C   F+G    C+   EC  NT                    C  ++ C+       C+C+ GF G+  V C    E      PL+  PCD     +  EC + +    C C   +  +  TG    R EC         +ST+C  T     C  K    P P    VC   ++C++ +                 C+C  GY GD     R+ T +  D C  N     P++ C        C C    PG  G  P    +C   +E      C  +            + +D C  A     G+ A+C  ++ +  C C  GY      R     +      +       CG N+EC   +G   C C   F G    CR   EC+ +   C   +A         C N+ G F  RCN            GY+GD     + ++ +     C+ S        N G  C C+  Y  D          T+  C  E  C   + FD     C  NA C   +   +C C  GY G+     +   P   ++ C    C  N+ C  VN  + C C  GY  +      +C +  EC S               SC  NA C   + +  C C   + G+        I   ++D    D C+      + +C        C C   FV                     C +++C + CP    +  +    S    C     L+ D  +QC  I +  E ++ CQ      N+ C  R G+  C+C  +Y     +G      P    N  CP+ + C                       +   C+C  G       D    CS+            C P  C  N+NC E     +C C+  +EG    +CR   +C    + C  N  C N +    C    G        +CE  N   +C C +  I  P   C  +      P        +    SPC + A C N      C C  N++G P +     +C   A     L C  GE C+    G+                             CG    C++ +    C C  GY GD  L                             AC+            D C           C +N  C N     +C+C   + GD    CR   +C     C  + +CI                             C      +C  NAIC+ VN    C CPD   G+ +  C  +  D   N  N   C S  +C   NGQ  C C      V   C    ECS+N    CS +  CQN+          G Y+          C C  G+ G+ ++ CH I E +  +        + C  N+ C     T +C C +   G    C  E               + CK P   PG   C  +AVC+       C CQ GY G  +  C             PC+ PN C A   C    +N +  C+C P++
Sbjct: 12364 KDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCR--PECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGI----CSCLADYQGDPYTGC---RPECT--------LSTDCAPTKA---CLNKKCVDPCP---GVCGQNSQCDVSNHIP-------------ICSCLQGYTGDPFVHCRHETPVAKDPCQPNPC--GPNSLCHISGQGPVCAC---QPGMLGSPPACKPECIVSSECSLHTACVNR------------KCVDPCPGA----CGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR--PECSINP-ECPPTKACIRQKCSDPCVNACG-FNARCNVANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNPSPCGPNAQCNNGV-CTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEG----CRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIG----DPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEG-APPNCR--PQCTSS-SECASNRACINQKCVDPCPGVCG-----QQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPH--CRPECSINAECPSHLAC-IGERCRDPCPGA-----------------------------CGQQTECRVISHVPSCVCLRGYVGDAFL-----------------------------ACHPAPPPPSREEPRDPCN-------PSPCGSNAICSN---QGECKCVADYQGDPYVACR--PECVLSSECPRNLACI--------------------------QQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCR--PECSTNY--DCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDP--CPGL--CGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCN-PNPCGAFAEC--RQQNGVGSCQCLPEY 13767          

HSP 29 Score: 68.9366 bits (167), Expect = 2.471e-10
Identity = 557/2614 (21.31%), Postives = 818/2614 (31.29%), Query Frame = -1
Query: 1328 TCSNDAFCDFKDDDYGCHCKNGFMGDG-IMCK-------DIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTC----TNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNP-CNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLG---LHNCSRS----HQFCFNVNGGFECRCLSGY---KSDTNGSCVDENECRF----FDNGCDD--------NADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKDGKVCMAVPLSQCNQS-------CPTGQYCNNGSCSCL--------MGLNSQ----TDDDGNLNCSKNSASCL---PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD---------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH-------------GICGPNYICQ---------CKSGYEINPSGMC----------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECL---PVNQV-CQNINCGNHAFCKIENGRADCFCDSGYYGDG-----ELCVDVDECSNGDV--------SCPN----NSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESC-----ATNGECQNTIGSFKCECKDGFIGDG---KYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDV---------PNACKANQTCTPSNENSLAICECKPDFKLE-----NDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNE-----CDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNE--NNSSCKPID-----SCAMGLDNCDRK-VEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLK-------LDLSKKACTDR---NECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCED----IDECAIKTH--------PCHDL----ARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDV------KCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGD-VCYKKCSDIDECVTR------KSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE-DQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGT--------------QICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSI-NSVCQDKADGFSCQCKPGFKWSD--------ETNLNCEDIDECTNPTSCSSMPHSICMNN------PGS-------------FECVCPHGFSLQGGY-------------CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP----------NGDCELINECLEN--IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQN-ECEINIHSCQAS----NSECVDTYGSFKCVCKPGFSKNSDG---DCVDYDECEISEQSNMKFCNNGKCINTAGGF--------------TCDCPEGFIYNNYDCIDVDECSLDQVSS-----------LADNCDQVNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNL-PG-------------SFECLCNIGY-------------------------DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRS-------------------NGYECICKDGYQEDQIGICRNI 8056
            TC+ +A CD  +    C C     G+  I C+         D C    S C  N+ C+    +  CSC E F G    C    T+ ++C P   C    + C D  PG       GF        C   N       +C     +  N F         G  P P+        N C     C   YAKCT+      C+C   Y G   NC    EC +N  C   D  C+N       RC D   G  G N  C+ +  T    +CY    F    F + V   + +  +     + +  G  A C        C+CL  Y  +                       EC+  +      C +       +CRD      +LN      A C       TC C  G+ GD     +I E  +    ++ C  S    +  C   N    C CL  Y     +    CV   EC          C+D        NADC     + +C CRAG+ G        +    C  L  P +              +   N C+        + C   A C D  G+  C C   Y G   NC  +      C I               CPS        C  +RC + CP                                         C  N++C     +  C+C P ++ + F    V   +       S       C     CN G C+CL        +G   +    T+ D +  C +N   C+   PG C  NA CE      +C C P   G     CR          ID C  + + C  N  C N  G   CSC R +     S   E  +   C  H             G+CG N  C+         C   +  NP   C          + ++ CQ  SPC   A+C     + +C C   F G P N                C   KC+      C +   C +  +  +C  ++  +    ++ + +   P  Q  C    CG +A C   NG   C C   +YG+        CV   +C +            CP     N+ CQ +D    C C+VG+Q       +     + E + S  C       N +C+ +     C+C   FIG     + +C I S+C                               D   +C++ + C       C  +A C  +N +  C C  GF GD  + C  I      +  N +  + CV S                                C +   C+ +     C C  G+YG    C    EC     +C+ +  CI+                       ++C+ P   PG+  C   A C   +    C C SGY+G  +   ++TP            P+ C +N  C+P  +     C C PDF           C+  T+C  +   C R  S C   DP       PG   +G  C+ +N      C P +   A  +C          + S V   N  Q +   NN+ C+ ++     SC  G      K   +C  + D      C      +N  C D   C     +C   A C  +     C CP             L       R   N C  +P  CG  ++C N +    C+C+  Y     NC        EC I+          PC  L    A C  V     C C   + GD    C        R+ +       C + + C   G    C C   Y  +    C  + V    CS    C+ +        +C   A+C   +    C+C    +GD    C   Q E     H      S C              C C   Y   P                + C+++  C +P    C +NAIC   +    C C  G+      +C+++   +   D+  I    C     G   QC+  ++ +          T   C    ECT  + C S  H  C+N       PG+               C CP G+     Y                 ++   P+ CG N+ C+N V    CSC    +  P          + +C     C+ N  +D C    G+ + C        C CP G+  +     +C+    +  + +H CQ S    + EC +      C C+ G+  +      +CV   EC  S       C N KC +   G                C CP G+  + Y      EC L +  S           L   C   +  C N  G   C C   ++ +      +C+   EC    +C++  C +  PG                C+C  G                           ++  +   IN C  N   CG  A   C    G   C C   Y    G  Y  C+   EC+ LN  CP +  CV +                    +  +C C  GY  + +  C  +
Sbjct: 14123 TCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCY--PSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQR--QHCIDPCPGT-----CGF-----NALCHVVNH----APICSCPPKHNGNPF--------LGCFPEPVRRDEVIPKNPCQP-SPCGP-YAKCTSVGDQAQCSCLPEYIGTPPNCRP--ECITNSECSF-DKACLNQ------RCRDPCSGTCGSNANCHVISHTA---MCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETC----------------RPECVTNN-----DCPSNKACQQQKCRDPCPGVCALN------ALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTG--------DAFSRCLPL--PPSR---------PPQLDVYRNPCV-------PSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPE------CTINP------------DCPSHL-----SCQQQRCRDPCP---------------------------------------GACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNK--CIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPC--QPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQ-PSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSEC-------------------------------DLTLACVQQH-CVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPS-------------------------------PCGAFGQCRAQGNQAICSCLPGYYGAPPNCRP--ECAIN-PDCASHLACIS-----------------------EKCRDP--CPGS--CGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQ-----CSCLPDFDGNPYVGCRPECVLNTDCA-RDKACQR--SKCT--DPC------PGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTL-------VQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSD------CAPHLACLNQQCRD--PCPG---ACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSP--CGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPI-QREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSR-RCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRP--ECTQNSDCPS--HRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGV----CSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFV--LCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPS-----LACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYS-----ECHLIRADSSPIQRQPIDPCLPSPCGP-HAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNP--CG--ANAQCNQRRGVVSCVCLPDY---FGNPYEACRP--ECI-LNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPV 16414          

HSP 30 Score: 68.1662 bits (165), Expect = 4.080e-10
Identity = 165/726 (22.73%), Postives = 245/726 (33.75%), Query Frame = -1
Query: 6296 NENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGD----------GIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT-----CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKN---------YAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPG-CDGDNPCNTVQCTKPNEICYLGQCFCKHGFQN---NVTTNICEDIDECDTAANDCA----GRKAKCANLDGSYECECLYGYR----------MSSXXXXXXXX----XXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGH----CDECRDIDECAFSLNNCDSDR----ATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRSHQ------------------FCFNVNGGFECRCLSGYKSDTNGSC-------VDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVN-----------------------STCLCKSGY--------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYD 8122
            N  C     C  E  Q  C   +C  +AFC   +    C C +G+ GD           I  + +  C    S C  NA C+   G+ SC+C   + G+  +     C   ++C     C N  ++C D  PG                 C    +C  + +L                C C  G+  +P  S  C ++ +     E D+N         Y++C    G   C+C  G+ G   NC    EC  +  C + +  C N       +C+D  PG C  +  C  +         +   C C  GF     N  T I  +    + + N C     G  +KC ++ GS  C CL  Y           +SS +                +  CG ++ C        C+C  G+TG     C   + I     + N C+       A C    G+ +C C   Y GD  S C    EC+    +C RS                     C  +N G  C C  GY  D + SC       +    C+   + C   + C++T+   +C C  GYIG+  +C P+  +       CP N  C+N                         C C+ G               +N  N C+        + C  N+ C        C CN GYIG    C  + T+ D CQ    C    C D
Sbjct: 10808 NTECPANLACINERCQDPCPG-SCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPC--QPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVN--QKCVDPCPGV----------------CGLNAQCRVSNHL--------------PSCSCLAGYTGNP--SSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRP--ECIISSDCAQ-NLNCQNQ------KCVDPCPGTCGIEARCQVIN--------HYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRP--ECVQN-DDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK--PSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSS----ECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCV-------PSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVD 11463          

HSP 31 Score: 67.3958 bits (163), Expect = 6.570e-10
Identity = 54/148 (36.49%), Postives = 76/148 (51.35%), Query Frame = -1
Query: 9176 CDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG----DCEAVAICGCWGDPHCLSFDGNW 9598
            C  +A C NL + F C C  G++G G  E+      C D DEC   + C   + CTNTPG++ C+C  G+V   P    C D++ECS   ++C   A C N  GSY C+C PG+ G G       D +  A   C  +  CL+ DG++
Sbjct:  181 CVENAECCNLPAHFLCKCKDGYEGDG--EVL-----CTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSF 320          

HSP 32 Score: 66.2402 bits (160), Expect = 1.466e-9
Identity = 168/732 (22.95%), Postives = 228/732 (31.15%), Query Frame = -1
Query: 4013 CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQS-PCHILAQCINT---PGSY----KCQCPENFYGDP----------------QNKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCE---------KISCNSSEIL-------------INNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDEC-SNGDVSCPNNSFCQNKDGSFHCACNVGFQRL-----------------ENALVTDSCTDIDECLLSE-------SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG-----LLCHDIDECKFGVANCSE------------NALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPE---------CDENAVCKNKDPGYTCECQSGYKGTGWFCIK-------------------QTPCDVPNACKANQTCTPSNENSLAICECKPDF 5857
            C P  C   ++C  R     C C P Y G    +CR           C IN DC ++       C     R+   G C  N VC    H    PN  C C++GY  NP   CQ       Q  P      C  +   P +     KC C   + GDP                   C + KCK      C    +C +  + + C           + C+                  I  +  P+N  CQ   CG ++ C+  + +A C+C   + G    C    EC SN D  CP + +C N      C    G + +                  N L+      I      E        C  N ECQ T G  +C C   + G   + CR   +C     C  D +C                          +N  C      SC  +A+C  V  +  C CP+G+ G+ Y  C+  +                                      V I  C+    + C  NA CQ       CQC  G+YG+        C    +C    A  SE            NALC     +  CEC  G +GN         C+ P+  P APE         C  N+ C+       C C   + GT   C                     Q PC  P AC  N  C   N + L  C C+P F
Sbjct: 17314 CYPSPCGPYSHCHNRFGVAACVCLPNYRGTP-PNCRP---------ECVINSDCPSSLACINEKC-----RDPCPGSCAYNAVCRVHEHV---PN--CYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINP-CQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRP--ECTSNSD--CPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF-CR--PECVNSADCPADKAC--------------------------RNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEP---------------------------------SPPAVVILPCNP---SPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGN-----PYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC--PGACGLNAQCHVRNHSPL--CSCQPGF 17946          

HSP 33 Score: 65.855 bits (159), Expect = 1.837e-9
Identity = 407/1808 (22.51%), Postives = 582/1808 (32.19%), Query Frame = -1
Query: 4013 NETPCAADVMAHSQLECQKLR----DKFASC--ETVMKTFNKSLDEYIESCVYDQCYSSGDLTQMMCKTAESLAQ-KCLEEYKVKISYRSINFCNMVCNKNMIYSDCASPCQPT-CYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIM-CKDIDECSNN--------TSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT----CTNINECYPLSPCDNATEECFDKVPGY--------------ECRCQKGFMKNTTTGNCDD-RNECADTGNLCDR----VSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYA----KCTNT-PGS-------------YYCTCDSGYQGDG-RNCTDIDECSSNKV--CQR----PDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLH----------QCGENAECIDTDGGYYCQCKTGFTGHCDECR----DIDECAFSLNNCDSDR------------ATCENSIGSFTCRCNEGYSGDG----SVCSEIDECLLGLHN-CSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTNQCINTDECES------------QTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYD------------------GICHCPS---GFVFKSNKCFDE--RCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCN-NGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGG-------KINNCTINEDCSNTEGSFTCSCKRGYSRN---SSSGLCETNNVCNCGS-----------HGICGPNYICQ---------CKSGYEINPSGMCQD---------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPV-----------NQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECS-NGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDA----SCIVNVESSIYECQCHTEFSGDGITSCIK---------------NNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNT------HNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQ-----------------TNKCSSNAICQNKEGTYSCQCAEGFYGDGL-LCH----------DIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIK--------QTPCDVPNACKANQTCTPSNENSLAICECKPDF 8605
            N +PC ++ +  +Q EC+ +     D + +C  E V+ +        I+    D C  +   T  +C     +A   C +    +++  +   C  V  +  +Y +   PC P+ C +        GQ V  C C P Y     +C +PE                  TN +CS    C+ +     C    C   A C   +    C C+ G+ G+ I+ C  I E   +         S C  N+ C+    + SCSC   F G        C + +EC  +  C N    C D  PG                C CQ G+  +         + E  +    C+         C    G   C C   +  +P +        EC L  +C    A    KC +  PGS               C C SGY GD  R C+   +     V  CQ     P++ C    G   C CL   P   G  P    +CT  +E C L +   +H             +D C  A     G  A C  ++ +  C C  GY      +     +     +H           CG NA+C  + G   C C   + G    CR       EC  SL  C + R            A C       +C+C  GY GD         +     + L + C+ S      V    +C C+  Y+ D    C  E         C  NADC                   R C   + ++ C     P NA+C  +N   +C+     + N  I   +CE+             + C  N+ C   + + +C C E +IG   NC  + T    C     C    C D                   IC CP    G  F    CF E  R + V PKN                        S C    +C    D  Q             C C P Y+    +           C   C T   C+ + +C     LN +  D  +  C  N            ANC       +C C PG+ G    SC  +              N C  N  C       +C C   Y  N   +    C TNN C                G+C  N +C+         C++G+  +P   CQ          +N CQ  SPC   +QC        C C   + G P N                C   KC       C +   C++  +  +C   +  + +    + CLP+              C    CG +A C+   G A C C   Y+G    C    EC+ N D  CP++  CQ +     C    GF    NAL    CT I+                   +  C+C  GFIG+    C +     +      D     +C  N   +  +C C  EF G+ +  C                  N C      +C  NAICE       C CP    G+ ++ C  +      +         C    +C N NGQ  C C    + V   C    EC SN                     C  NA C+    + +C C   F G+    CH           ID C+   + C  NA C  +     C C +G +G    C  E                +C+ P   PG   C  NA C   +    C C +G  G  +   +        QTPC VP+ C AN  C  S  N    C+C P+F
Sbjct: 13428 NPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCG-TNAICDVVNHIAMCHCPD----RMTGNAFVQCTPV--QLDVYRN---PCNPSPCGSYAECREQNGQAV--CSCLPNYFGVPPSC-RPEC----------------STNYDCSPSLACQNQRCVDPCPG-ACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSN--NRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGC----RPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCL---PEFVGTPPGCRPECTVSSE-CNLDKACVRHKC-----------LDPCPGA----CGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSL-ACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPE---------CVLNADCPR----------------NRACVRHKCVDPCPGTCAP-NAICDVINHIAMCRCPERMTGNAFI---QCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLG--CFPEPVRRDEVIPKNPC--------------------QPSPCGPYAKCTSVGDQAQ-------------CSCLPEYIGTPPN-----------CRPECITNSECSFDKAC-----LNQRCRDPCSGTCGSN------------ANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQ-PSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAF--SRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNC--RPECTINPD--CPSHLSCQQQRCRDPCPGACGF----NAL----CTVINH------------------NPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCR--PECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQ--PSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDP--CPGV--CGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPC-VPSPCGANALC--SEGNGAGACKCLPEF 15043          

HSP 34 Score: 65.855 bits (159), Expect = 1.997e-9
Identity = 63/198 (31.82%), Postives = 88/198 (44.44%), Query Frame = -1
Query: 15770 VDSCHLRDTSGCVCNDGFLRSGTT-------CTPKEQCG----CYDGDNNYKA------VGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEG--RADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16300
             + C+L     C C DG+   G         C   E CG    C +   NY        VG+  + + C   + CS        PNV C     C N    G   C C  GY+G  R+++ C D DEC+R    C  N DC+N  G++ CLC  G+ G+ +N C D +EC +    C   A C N  GS++C C +G+
Sbjct:  185 AECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-------PNV-CGPGAICTN--LEGSYRCDCPPGYDGDGRSESGCVDQDECARTP--CGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 35 Score: 62.003 bits (149), Expect = 2.512e-8
Identity = 54/160 (33.75%), Postives = 81/160 (50.62%), Query Frame = -1
Query: 13910 DCNKDG------ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKLFCLGDADCAKSGKCFQN----------LCSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGD 14341
            DC+KDG       C  G CHC  G+ G    NC + +E   +  PC +  +C++T GS++C C   + R N   C++   C    D A + +C +N          LC C  G+EGDG++LC   +     N  NC  +A CT+  G+YTC C +G+ G+
Sbjct:   96 DCDKDGTKCTHGACLNGVCHCNDGYGG---CNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGY-RGNGFHCEDIDEC---QDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCT--DVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN 246          

HSP 36 Score: 60.8474 bits (146), Expect = 7.080e-8
Identity = 152/651 (23.35%), Postives = 220/651 (33.79%), Query Frame = -1
Query: 4382 DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLS----QCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKI-ENGRADCFCDSGYYGDGEL---CV------DVDECSNGDV---------SCPNNS----------------FCQNKDGSFHCACNVGFQRLE----NALVTDS----------CTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGK-------YDCRIDSKCEKY-------------GGCHEDASCIVNVESSIYECQCHTEFSGDGITSCI-----KNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL 6100
            D C  N++C N   + DC C     D F+        P      Q N+ CP  + C+  +  C+              C ++S       C  NA C     G  C+C PG+ G     C     C    + C  ++ C N + S  C C        +  LC+  N              +C+C  GY  NP   C    +    +PC + A C    G+  C CP+   G+P   C  +  +     C     C+      VC  +     +       LP N  C    CG +  C +  NG + C C   Y         CV      D + C  G +          CP+N                  CQ      +  C V   R E    +  V D+            D + C  + +C   G+     G   C C DG  GD         Y+C++D+ C                G C + A C V     +  C C++  +G+    C      K N C     S C  N+ C+ +N    C C  G+ GD  + C    EC              +NS+      CGD    ++  CV  D C+      C  NAIC  ++ T  C C +GF GD  L
Sbjct: 8575 DPCATNAVCINSNHAADCSC----ADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINP------------CQEDS-------CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSD-SECDSSQACINGKCSSPCQC-------GAYALCDVVNH-----------RGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNP-CDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGD-----GQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV--CSCNSGLTGNPGIRCYALDHPKKNPCV---PSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQ--PECD-------------INSD------CGDTLSCINHKCV--DPCAG---AICGINAICNVRQHTPVCLCLDGFVGDAFL 9146          

HSP 37 Score: 60.4622 bits (145), Expect = 7.139e-8
Identity = 64/220 (29.09%), Postives = 89/220 (40.45%), Query Frame = -1
Query: 9224 PCGLKNGCAGILGESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD---PVNSLVIGSLMCSSSKIDFNECST--NFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG-DCEAVAI 9865
            PCGL   C  + G       S QC C     S    +     ++   P+ +  L   P A    P        L C    +D +EC+       C  +A C N    +RC C  G+QG G    Y +   C + +EC    C   + CT+T GSF+C C   +       C DI+EC+     C  +A C NT   Y C C  G+ G  +P   CE V +
Sbjct:  347 PCGLGAECVNLGG-------SFQCRC----PSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLAC----LDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQG----YLH---CENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV 544          

HSP 38 Score: 60.077 bits (144), Expect = 9.406e-8
Identity = 47/164 (28.66%), Postives = 64/164 (39.02%), Query Frame = -1
Query: 9275 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGG-----------------------NEMY------------SNGRSCIDDDECALLKCP-----STSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTY-GSYICNCK 9643
            SS +D +EC T+   C  HA C N    + C+C  G+ G                          NE Y                 C+D DEC ++  P       + CTN+ G F C C  GF     + C D++EC   +S C A A+C+N   G Y C C 
Sbjct:  576 SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCP 739          

HSP 39 Score: 60.077 bits (144), Expect = 1.179e-7
Identity = 51/206 (24.76%), Postives = 84/206 (40.78%), Query Frame = -1
Query: 15575 VQCHEYGECFNSTASGESECRCKKGYEGRA-DNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGS---ICSQIPIIAVNPDQTNCSFHQD----------------ASCDQLATCVDHAD------------GSFTCDCTEGSFGDGLQGANQTGC 16093
             +C    +C N    G   C C  G++G+   +C +I+EC      C +N  C + +G++ C CK  + G+    C D +EC +    C  +A C NT   Y C C  GY+G       C Q+ +  +     +C+ + +                +SC  +  C  HA+            GS+ C+C  G  G   + A +  C
Sbjct:  424 AKCGTNAKCIN--FPGSYRCLCPSGFQGQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPC 625          

HSP 40 Score: 59.6918 bits (143), Expect = 1.441e-7
Identity = 66/201 (32.84%), Postives = 96/201 (47.76%), Query Frame = -1
Query: 9089 GSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVK--AAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGD-CEAVAICG----CWGDPHCLSFDGNWLHYQGRCK--YTLVRDECRNGLPIESSTANF 9661
            G ++C+    D +EC  N  +C  +A CTN    + C C  G+ G   N  Y  G  C D DEC+    C   + CTN  GS+ C+C  G+     + + C D +EC+   + C  NADC+NT GS+ C C  G+  SG+P + CE V  C     C     C++  G+   +Q RC   + L  D   + LP   +T   
Sbjct:  206 GEVLCT----DVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG---NNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA--RTPCGRNADCLNTDGSFRCLCPDGY--SGDPMNGCEDVDECATNNPCGLGAECVNLGGS---FQCRCPSGFVLEHDPHADQLPQPLNTQQL 389          

HSP 41 Score: 58.5362 bits (140), Expect = 2.882e-7
Identity = 43/128 (33.59%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9257 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSF--ICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGS 9634
            +D +EC+     C  HA C N   G+ C C +G+ G    ++     +C   D    + C S  DCTN        C C  GF     + C DI+EC  ++ +C  +A C+NT GSY C C+ G+ GS
Sbjct:  496 VDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKV-----ACEQVD--VNILCSSNFDCTNNAECIENQCFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS 615          

HSP 42 Score: 57.3806 bits (137), Expect = 6.874e-7
Identity = 52/166 (31.33%), Postives = 78/166 (46.99%), Query Frame = -1
Query: 13892 AKDSDCNKDGEC-----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLN--NGTCQNKLFCLGDADCAKSGKCFQNL-----CSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDGTHDCH 14353
            A  + C ++ EC     HF  C CK G++GDG   C++++EC N  N C  N  C++T G+Y+C+C   +V  N     CQ+   C     C     C  NL     C C  G++GDG+       +        C  +A C +  GS+ C C +G+ GD  + C 
Sbjct:  176 AIAARCVENAECCNLPAHF-LCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICT-NLEGSYRCDCPPGYDGDGRSE-SGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE 337          

HSP 43 Score: 57.3806 bits (137), Expect = 7.473e-7
Identity = 217/957 (22.68%), Postives = 314/957 (32.81%), Query Frame = -1
Query: 1133 SSKDSSYTCQCIEGFQ---RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCE-----DIDECAIKT----HPCHDLARCSNVPGSCKCK-------------CQPGFTGD---GIYSCIETDSC--PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRK--SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNP-VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENIN----ECEEKSD--------NCSINSVCQDKADGFS---CQ---CKPGFKWSDE-------TNLNCED-------------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPN-SCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLAD-NCDQVNGHCINTVGGFQ-CYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPG-SFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSG-----------------------GKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA------ICGPNSCLPGQLCQIVNGNQYDCGC 3658
            +++     C C  GF    R+   C  +D C D    C   A C N  GSY C CP  L  D   + C    EC+ N   C   + C  T+G  +C+ V      G N E      + +CA ++     P   +A C  +P  C+               C+P    D   G +   +   C  P      C   + C M  +   C+C  G+   +  EC+     C  +C     C        CH   EC +N+          L G    TC   N+C L  H C  N                + CH  +       ++ C N ++C+NP +EN C  NA C  +     C C       P+ +   +     EC E  D              +C D A   +   CQ   CKP  +  +E         LNC                     +D C +PT+C +  H  C       +C+CP G             C +P  +CG+N  C +    +  SC    R   + +C     C+     C+ +   D  C                      Q+CEN   Q  C  ++ SC A++  CV+     KC   P  +    G C D                   C+    G  C CP  F+ +      +  C L       D  CD+   +C       + C C +     +   KC    +C     C  G C  + G      C      VNGKC+D   C+N  + CG  A  +C  +     C C  GYE                          GK  NPC     C        +NAQC       +C C   +  +    CR +        C   + C +  G Y+C C  G  GD    C         C    C     C ++  NQ +C C
Sbjct: 2726 TTEHHQQVCHCQPGFSGDPRVR--CDVIDFCRDA--PCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKC--------LKGSCMLTCRVDNDCFL-GHVCLHNKCV-------------YGCHVDDDCS---ASESCRN-DKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAH--CQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQGKCRN--DQNCLADERCMRGT--CRTVCNTDEACAQG-------------------QICENRMCQTGCRTDL-SC-ATDEACVNK----KCQ-NPCRTPGQCGQCAD-------------------CLVVNHGVQCQCPAAFMGDG-----LTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGAC--IAGCKSNGDCAADQSCVNGKCSD--PCANE-KACGRNA--LCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACG-------TNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYC 3576          

HSP 44 Score: 57.3806 bits (137), Expect = 7.663e-7
Identity = 41/119 (34.45%), Postives = 57/119 (47.90%), Query Frame = -1
Query: 15875 TPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD-NCTDIDECS-RGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN 16225
            TP+ QC      + YK VG+      CS+   C                  EC  S A G S C C KGY+ + D +C D+DEC  RG+ +C+    CVN+ G+Y+C C  G+ G+  N
Sbjct:  963 TPECQC-----QSPYKLVGNSCVLSGCSSGQACPSG--------------AECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYN 1061          

HSP 45 Score: 55.8398 bits (133), Expect = 1.827e-6
Identity = 166/695 (23.88%), Postives = 227/695 (32.66%), Query Frame = -1
Query: 6371 CSNDAFCDFKDDDYGCHCKNGFMGD----------GIMCKDIDECSNNTS--------------VCDSNAFCKNTIGSFSCSCKEGFEGNGV---------TCTNINECYPLSPCDNATEECFDK------------VP---GYECRCQKGFMKNT-----------TTGNCDDRNECAD----------TGNLCDRVSTNCNNTFGSYRCDCKYGFRP-----SPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG-RNC-TDIDECSSNKVCQRPDATCVNLPGSYECRCL---DGTP---GCD-GDNPCNTVQCTKPNEICYL-----GQCFCKHGF--QNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQ---CGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV--------------CSEIDECL-------------LGLH-NCSRSHQFC-----FNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLE-------ECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI 8053
            C+  A C  K     C C  G  G+           I C D  +C    +               C +NA C N+  +  CSC +GF+GNG           C    +C P   CD     C +             +P   G ECRC  GF+ N            +   CD    C +             LCD V     N  G  +C   Y   P      P D     D N C L   C+ +        G+  C C  G  G+  +NC  + DEC+ N     P++ C  + G+  C CL   +G P    C+   NPC+   C  PN  C +      +C C   +    N      E I+ CD   N C G  A C   D S    C              +       L Q   CG NAEC        C C++G+ G   + CR+        N C  +        G   C C +G SGD +               C     C+              G H      H  C        N G  C  L   K         +N C    + C  N++C   +   +C C  GY+G     DPQ G +       +CG  L      C+N  C+               D C     C +NA C     + +C C +G++GD  
Sbjct: 8512 CAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVV-----NHRGVCKCPPGYNGNPKVGCSPPQDPC---DPNPCGLNALCELDN-------GNPICYCPKGLTGNPFKNCIPEGDECTPNPC--GPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPC-GPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCD--PNPC-GTGAIC---DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPK---------KNPC--VPSPCGRNSECKLLNNRAVCSCIPGYLG-----DPQSGCQPECDINSDCGDTL-----SCINHKCV---------------DPCAGAI-CGINAICNVRQHTPVCLCLDGFVGDAF 9145          

HSP 46 Score: 55.0694 bits (131), Expect = 3.363e-6
Identity = 157/695 (22.59%), Postives = 222/695 (31.94%), Query Frame = -1
Query: 4385 CQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--------GSCS----CLMGLNS-----QTDDDGN--LNCSKNSAS------------CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC------------------------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQ---------------NKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQV-------CQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKY--------GGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHE-----------------NAICEQVNATYRCICPDGFQGDGYNFCN------DIDECAND-NTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI----CVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGL 6094
            C   S C NRFG   C C PNY     + +     P    N  CP+   C N        GSC+    C +  +      QT   GN  ++C +   +            C P IC  NA C        C C P Y G     CR           C +N DC+  +      CK     N   G C    +C+  +H        C C  G + +    C                          +N CQ  +PC   +QC        C C  NF G P                  C   +C+      C    +C +  +G +C      +   L+  + + +  V       CQ   CG ++ C+  +G A C C   Y+G    C    EC N    CP +  C+N    + C                    ID C    SC  +  C+    S  C C +G++G+    C                   C  +A C  + + S+  CQC   + G+    C     C VN     H                  NA+C+ +N +  C C  G  G+ Y+ C          E  N      C +  +C  S GQ  C C    V         CV   EC +++              C  NA C  +  +  C C  GF GD L
Sbjct: 17319 CGPYSHCHNRFGVAACVCLPNYRGTPPNCR-----PECVINSDCPSSLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGK----CSCIPEYRGDPYVGCRP---------ECVLNTDCARDKACIQQKCK-----NPCPGTCGLQALCHVYNHVA-----TCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQ-PTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFC--RPECVN-SADCPADKACRN----YKC--------------------IDPC--PGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSV--CQCLPGYYGNPSEICRPE--CTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAL 17951          

HSP 47 Score: 55.0694 bits (131), Expect = 3.420e-6
Identity = 192/806 (23.82%), Postives = 273/806 (33.87%), Query Frame = -1
Query: 6350 CTGQCVESCICAPGYVLENGNCTKP--EACG----CLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKD----IDECSNNTS------------VCDSNAFCKNTIGSFSCSCKEGFEGNGVT----------CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTT--GNCDDRNECADTGNLCDR------------VSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNY----AKCTNTPGSYYCTCDSGYQGDGRN-----CTDIDECSSNKVCQR------------PDATCVNLPGSYECRCLDGTPG-----CDGDNPCNTVQCTKPN---------EICYLGQCFCKHGFQNNVTTNICEDI---------------DECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL--------HQCGENAECIDTDGGYYCQCKTGFTG---HC-DECRDIDECAFSL--------NNCD---SDRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRS----HQFCFNVNGGFECRCLSGYKSDTNGSCVDE---------------NECRFFDNG-CDDNADCINTDGSFLCICRAGYIGSG-RNCD--PQEGLEE----CGKLLCPLNALC--VN--STCLCKSGYE----NSTNQCINTDECESQTSCDVNANCIDT--------------HGSFICYCNEGYIGDG-INCFKKDT 8257
            C  +C  S  CAP     N  C  P    CG    C +S+     +  Q    +  V CR +    +  C    C  ++ C        C C+ G +G    CK       ECS +T+             C   A C+    + SCSC  G+ G+  T           T  N C P SPC     EC        C C   F+    +    C    EC  T   C R             +  CN       C C  G+   P     C       L   C+ +     A+C N      CTC   Y GD  +     C    +CS    C R            P+A C  L     C C +G  G     C    P   VQ  +P+         E+     C C  G+    T  +C                   +C+       GR A+C+ ++ +  C CL  +  +      + I     ++          CG N+EC        C C   F G   +C  EC    EC  +L        + C       ATC     +  C C+ G +GD  + C  I + +  ++ C  S    +  C   NG   C+CL+ Y  +    C  E                +CR    G C  NA+C   + + +C C AG+IG   R C   P+  + E    C    C  N+ C  VN  + C C+S +E    N   QC ++ EC S  +C +N  C+D               + S IC C    IGD  + C  + T
Sbjct: 12511 CRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQP-SPC-GPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPT-KACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTG--CQKEQAVKLDDPCNPSPCGPNAQCNNG----VCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIG--TPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRAC-INQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPT 13304          
BLAST of SMED30010561 vs. Ensembl Fly
Match: dpy (gene:FBgn0053196 transcript:FBtr0332351)

HSP 1 Score: 330.102 bits (845), Expect = 3.439e-89
Identity = 496/1833 (27.06%), Postives = 705/1833 (38.46%), Query Frame = -1
Query: 1130 YLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS--------------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLC-FVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG---LLCHDIDECKFGVAN--CSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDT-----CIPKTECE---NKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT-CQDKNECDPTSPDFAAQKCLASGGGCLNTK-GSFVCTCNQEQMNENNSS--CKPIDSCAMGLD-------------------------------NCDRKVEDCISSKDSSYTCQCIEGF---QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNEC---QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTN--CEDIDECAIK--THPCHDLARCSNVPGSCKCKCQPGFTGDGIYSC--IETDSCPARDDVK----------------CPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKF-AECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEN-DCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQ-VLNGADSVCYDLPIGYACVCPDGFVNDEVFP------------------QVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDE-------------CEISEQSNMKFCN--------------------------NGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRG---------------FVMIENSTKCVDIDECQFPNSCLDGLCNNL-------PGSF----ECLCNIGY-----DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGY----QEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCV 6031
            YL +F   K+C                   +G+  C +G +  + +    N C K+   C  G C LN          +C C  GY G    +C D DE   K   C +   C+NT GSFTC+C  GY  N               ++   E    CN  +H      ++C+CK GYE +   +C DV+EC+    C   A C NTPG+Y C CP+ + G+                         + Y   C+ +          +EC   N       CG  A C    G   C C  GY GDG     CVD DEC+     C  N+ C N DGSF C C  G+    +    + C D+DEC  +  C    EC N  GSF+C C  GF+ +  +D   D   +            +       +   +   SG G+ +C+  + C   +G + C  NA C     +YRC+CP GFQG GY  C +I+EC ++    C     C ++ G + C C     Y  D    CVDIDEC++     C  +A+C+N    Y+C+C +G+ G     + C  +D      +N  C+ NA CI       C C  G    G++C D DEC+       A  C  +A C N    Y CEC++GY G+      + PC DV   C A+  C P    +  +CE   D    N +     C+   EC+       +C  + + C     GF C C PGF+   ++ C D +EC        A KC A G  C+N   G + C C    + + + S  C PI SC+   D                               NC    +  +++  +   C C  G+     + G C D+DEC  + + C   A C+N  G Y+C+CP     D  ++ C           NP   G+     +  G+  C C  GY+ N  N  C+D+DEC+++     C   A C N+PGS +C+C  G  G+    C    T  C  +   K                CP+G+ C ++ G   YC C  GY+      C+         D+DEC  R +    F A+C N  G+Y C CP    GD          CAL    C  +     N       + P +C C   Y   P      + N+C +P E   C  NA C  ++   +C C++GFK  P   C + +EC      C+  + C +K  G+ C C P     D     C  I E       S  P S C++N       C    +   G C      L+   CG N+ C        C C  G  +  +GDC         + +CQ V+ G  ++C     G  C CP G + +  FP                  Q+C N   +  CE  +    A+   C    G  KC+C+P F  N D  C+   E             CE     +   CN                          N +C       +C CP+GF  N Y  C DVDEC        A+    +N  C+N  GGF+C C  G               F    N  +C +  EC    SC  G C NL       P +      C+C +GY     D V+G C+   +C N++          C+++   FQ           GK    C  V+ C K  I C  NA CV   +   CIC DG+       Q+G        + ED C    DC      Y C        +GI  C  +C    C P +LC+I       C C 
Sbjct:   64 YLQLFNLSKLC-------------------DGTQDCFLGADELSKELKCTNDCDKDGTKCTHGAC-LNG---------VCHCNDGYGGC---NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAH------FLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN-------------------------NPYREGCQDV----------DECSYPNV------CGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECAR--TPCGRNADCLNTDGSFRCLCPDGY----SGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLE--HDPHADQLPQPLNTQQ------LGYGPGATDIAPYQRTSGAGL-ACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDN---PCGENAICTDTVGSFVCTCKPD--YTGDPFRGCVDIDECTA-LDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN----QCFCLDGFEPIGSSCVDIDECRT-----HAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV--RCGAHAYCKPDQNEAYCVCE---DGWTYNPSDVAAGCVDIDECDVMHGPFGSCG-QNATCTNSAGGFTCACPPGFSGDPHSKCVDVDEC-----RTGASKCGA-GAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQ--CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCV---------DVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAY-----NGLCALAQRKCAADRECAANE----KCIQPGECVCPPPYFLDP-----QDNNKCKSPCERFPCGINAKCTPSD-PPQCMCEAGFKGDPLLGCTDEDECSHLP--CAYGAYCVNKKGGYQCVC-PKDYTGDPYKSGC--IFE-------SGTPKSKCLSNDD-----CASNLACLEGSCVSPCSSLL---CGSNAYCETEQHAGWCRCRVGYVKNGDGDC---------VSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNP-FPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGAT---CDRNNG--KCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHG-CSIRGQCGNDAD---------CLHSEICFQL----------GKGLRKC--VDACSK--IQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDC---SRGYGCQASV----NGIKECINLCSNVVCGPNELCKINPAGHAICNCA 1673          

HSP 2 Score: 307.76 bits (787), Expect = 1.917e-82
Identity = 414/1422 (29.11%), Postives = 573/1422 (40.30%), Query Frame = -1
Query: 4415 GQLECTNI-------TCSNDAFCDFKDDDYGCHCKNGFMGDGIM---CKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT---CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF----------RPSPIDS----------------------FVCTDVNECNL---VHECDKNYAKCTNTPGSYYCTCDSGYQGDG-----------------------------------------RNCTDIDECSS-NKVCQRPDATCVNLPGSYECRC---LDGTPGCDGDNPCNTV----------QCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE----CRDIDECAF---SLNNCDSDRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRSHQFCFNV-NGGFECRCLSGYKSDTNGS--CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCV----NSTCLCKSGYENST---NQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDG--ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN--ENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGY-ICKCKPGYEGVGIKSCRDIDECGGK-INNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-----------------------------------ETNNVCN-------CGSHGICGPN--YICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYY--GDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCA-----TNGECQNT-------IGSF------KCECKDGFIGDGKYDCRIDSKCEK-YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSC--IKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQ 8080
            G++ CT++        C  +A C     +Y C C +G++G+      C+D+DECS   +VC   A C N  GS+ C C  G++G+G +   C + +EC   +PC     +C +    + C C  G+  +   G C+D +ECA T N C  +   C N  GS++C C  GF           P P+++                        C D++ECN    V +C  N AKC N PGSY C C SG+QG G                                         R C DIDEC++ +K C +  A C N    Y C+C    DG P  D    C  V           CT  N  C   QCFC  GF+   ++  C DIDEC T A  C G  A+C N  GSY CEC  GY  S     C+   E +    +CG +A C       YC C+ G+T +  +    C DIDEC        +C  + ATC NS G FTC C  G+SGD  S C ++DEC  G   C    + C NV  GG+ CRC     +D + S  CV    C   ++ C  N+ C   D +  C+C    IG+       +    C  L C  +A C+     + CLC  GY  ++     C + DEC +   C   A C +T G ++C C  G  GD        + T  C   N C  G     D Y G  +C C  G+         ER                            +S++ QC D+DEC+       C  N++C N  GSY+C+CP  +     +G      P   C       + CN   C C        +      CS   A      CP  A C     G   C C  GY+     SC D+DEC  +    C     C N  GS++C C  GY  ++ +GLC                                   + NN C        CG +  C P+    C C++G++ +P   C D +EC +  PC   A C+N  G Y+C CP+++ GDP       +  T   +C + + C  +L    C + SC S               C ++ CG++A+C+ E     C C  GY   GDG+    V +C   DV C + + C        C C  G  +L N     SC+  D+C  +  C       NG C+         IG+       KC C+  F+G+    C    +  K   GC E+A C   +  S   C C+    G+    C     N+C  N   SC  NA C  V     C+CP GF G+ Y  C D+DECAN     C     C+N  G + C+C  G A      C  I+       NKC  N   +  EG YSCQ
Sbjct:  206 GEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA-RTPCGR-NADCLNTDGSFRCLCPDGYSGDPMNG-CEDVDECA-TNNPCG-LGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTN-AKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQ-HAVCENTVPGYNCKCPQGYDGKP--DPKVACEQVDVNILCSSNFDCTN-NAECIENQCFCLDGFEPIGSS--CVDIDECRTHAEVC-GPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV----RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQN-ATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAE-CVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANED-CPGNSIC---DATKRCLCPEPNIGN-------DCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN-PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGY---------ER----------------------------NSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGH-----NGN-----PFIMC-------EICNTPECQCQSPYKLVGNSCVLSGCSSGQA------CPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDEC-SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNL---ACLEGSCVSP--------------CSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQ--DVICGDGALCIPTSEGPTCKCPQG--QLGNPFPGGSCS-TDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQS--RCACNPGTFGNPYEGCGAQSKNVCQPN---SCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECAN---KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEG-YSCQ 1500          

HSP 3 Score: 293.893 bits (751), Expect = 3.255e-78
Identity = 425/1505 (28.24%), Postives = 590/1505 (39.20%), Query Frame = -1
Query: 3707 ECNLVHECDKN----------------------------------------YAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQR--PDATCVNLPGSYECRCLDGTPGCDGDNPCNTV-QCTK-----PNEICYLGQ----CFCKHGFQ-NNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTG-HCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY-----------------------------------SGDGSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIG-----------------------------SGRNC----------DPQEGLEEC-------GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGINCF-KKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNK----CFD-ERCENV------CPKNAXXXXXXXXXXXXXXXXXSLSSDS-SQCIDIDECNENVDDCQENSICFN-RFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGN----LNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS--CRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP-----------NYICQCKSGYEINP-SGMCQDVNECQTQ---SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFC-KIENGRADCFCDSGY--YGDGELCVDVDEC-SNGDVSCPNNSFCQNKDGSFHCACNVGFQRLEN----ALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCG--DEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA---CKAN------QTCTPSNENSLAICECKP--------DFKLENDTCI--------PKTECENKTDNCDRETS-----NCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDS 7567
            E    ++CDK+                                        +A CTNT GS+ CTC  GY+G+G +C DIDEC    +  R   +A C NLP  + C+C DG  G DG+  C  V +C       PN +C        C C  G+  NN     C+D+DEC +  N C G  A C NL+GSY C+C  GY     ++      +       CG NA+C++TDG + C C  G++G   + C D+DECA   NN     A C N  GSF CRC  G+                                   SG G  C +IDEC    G+  C  ++  C N  G + C C SG++      C + NEC+  DN C +NA C +T GSF+C C+  Y G                              G NC          DP+   E+            C  NA C+ + C C  G+E   + C++ DEC +    C  +A C++T GS+ C C  GY+G       K+  +   C    YC   D  +  C C  G+ +  +     C D + C+ +      C +NA  + ++ +   +C+     S D  S+C+D+DEC      C   + C N   G Y C+CP N +        C+ +     N+ CP    C + +  CL    +  +D  +    LNC  ++   L       AN + +     C C PGY G    +  C DIDEC  + N C     CSNT G + C C  G S +     C T+    C     C             N +C C+ GYE N  +G CQDV+EC  Q     C + A C N PGSY+C+CP+   G+P   C  + C T   QCQ+       L G+ C    C+S +                  C + A C  I  G + C C  GY    DG  CVDVDEC   G   C   + C NK GS+ C C  G+Q        AL    C    EC  +E C   GEC          C   +  D + + +  S CE++  C  +A C     S   +C C   F GD +  C   + C       C   A C      Y+C+CP  + GD Y      +  +      C S + C +     N  C +G+         +  CSS     C SNA C+ ++    C+C  G+   GDG     + +C+  +  C + ALCI       C+C  G LGN    G    D+C        A  C E  +C N      CE        G  C     CD  N    C+ N        C P  E +    +C P        ++ L    C         P   C  ++ N  +  S      C  +     C C  GF+  GN    CQD +EC        A K       CLN  G F C C         SSC+PI+S
Sbjct:   90 ELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEG-DGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDEC-SYPNVC-GPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECART-PCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECA--TNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCG-TNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ--DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKP-DQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNA--TCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSIC-DATKRCLCPEPNIGNDCRHPCEALNCGAHAQCML-------ANGQAQ-----CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMC--EICNTPECQCQS----PYKLVGNSCVLSGCSSGQA-----------------CPSGAECISIAGGVSYCACPKGYQTQPDGS-CVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECV---------CPPPYFLDPQDNNKCKSPCERF-PCGINAKC---TPSDPPQCMCEAGFKGDPLLGCTDEDEC---SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFE--SGTPKSKCLSNDDCAS-----NLACLEGSC--------VSPCSS---LLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQDVI--CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCS------AARPCGERQICINGRCKERCE--------GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQA----KCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFS--GNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIES 1476          

HSP 4 Score: 293.123 bits (749), Expect = 4.903e-78
Identity = 406/1435 (28.29%), Postives = 578/1435 (40.28%), Query Frame = -1
Query: 4268 CHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATE--ECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRN---CTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLG----------QCFCKHGF---------------------------------QNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS---VCSEIDECLLGLHN--CSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEE-CGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQT----SCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCP-PNYLDVFKDGKVCMAV---PLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS-CRDIDECG-GKINNCTINEDC--SNTEGSFTCSCKRGYSRNSSSGLCETNNVCN-------CGSHGIC---GPNYICQCKSGYEINPSGMCQDVN--ECQTQSPCHIL------------------AQCINTPGSYK-CQCPENFYGDPQNKCFE-DKCKTKALQ----------------CQAGEVCKLSLYGSVC---EKISCNSSEILINNECLPVNQ-------------------VCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL-CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQ--RLENALVTDSCTDIDECLLSESCATN-----GECQNTIGSFK---------------CECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYEC---QCHTEFSG--------DGITSCIKNNLCFVNGK-------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGN 8008
            CHC +G+ G   + KD +EC      CD  A C NT+GSF+C+C  G+ GNG  C +I+EC   +      E  EC +    + C+C+ G+  +     C D +EC +  N     +  C NT G+Y C C  G+  +      C DV+EC+  + C    A CTN  GSY C C  GY GDGR+   C D DEC+    C R +A C+N  GS+ C C DG  G D  N C  V     N  C LG          QC C  GF                                 + +     C DIDEC+        G  AKC N  GSY C C  G++                  + CGENA C DT G + C CK  +TG     C DIDEC  +L+      A CEN++  + C+C +GY G       C ++D  +L   N  C+ + +   N     +C CL G++     SCVD +ECR     C  +A C+NT GS+ C C AGY+GS     P+   ++ C  + C  +A C      + C+C+ G+     +    C++ DEC+       SC  NA C ++ G F C C  G+ GD      K  D D           +C  G   C +G    +       C   CP N I                     S +C+ I  C+ N +DC  NSIC     +  C CP PN  +  +    C A+     +QC  +   GQ      C C  G    +   G  N   +   C    C   A C     GY+C+C  G  G   +  C      G    N C   E C   +  G+  C C++GY RNS +G C+  + C+       CG + +C     +Y C+C  G+  NP  MC+  N  ECQ QSP  ++                  A+CI+  G    C CP+ +   P   C + D+C+ +  Q                C   E  +   Y  +C   ++      E   N +C+   +                    C+   CG +A C   +    C C++G+ GD  L C D DECS+  + C   ++C NK G + C C   +     ++  + +S T   +CL ++ CA+N     G C +   S                 C C+ G++ +G  DC   S+C+    C + A CI   E    +C   Q    F G             C +  +C +NG+         C   A C++ N   +CIC   F G+    C    E A   +  C     C    GQ  C C  G              +  Q N C  NA C+      SC C +GF G+  + C D+DEC      C  NA C+N+ G F C C +G  GN
Sbjct:  114 CHCNDGYGGCNCVDKDENECKQRP--CDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEV-LCTDVDECRNPENC--GPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPG-AICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTP-CGR-NADCLNTDGSFRCLCPDGYSG-DPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQD---NPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECT-ALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN-----QCFCLDGFEP-IGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS----PPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDP---HSKCVDVD-----------ECRTGASKCGAGAECVNVPGGGYTCR--CPGNTIAD----------------PDPSVRCVPIVSCSAN-EDCPGNSIC---DATKRCLCPEPNIGNDCR--HPCEALNCGAHAQCMLA--NGQ----AQCLCAPGYTGNSALAGGCN---DIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDP-PQCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV--SQCQDV-ICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQIC-INGRCKERCEGVVCGIGATCDRNNG--KCICEPNFVGNPDLICMPPIEQAK-CSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--ANKPCGLNAACLNRAGGFECLCLSGHAGN 1466          

HSP 5 Score: 288.886 bits (738), Expect = 9.378e-77
Identity = 536/2042 (26.25%), Postives = 753/2042 (36.88%), Query Frame = -1
Query: 1160 NALCVNSTCLCKSGYENSTNQCINTDECE-SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL--DVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GS--CSCLMGLNSQTDDDGNLNCS-KNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRG--------------------------------YSRNSSSGLC--------ETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSL--YGSVCEKISCNSSEILINNECLPVNQVC-QNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGF----------QRLENAL----------------------------VTDSCTDIDECLLSE----SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGG-CHEDASCIVNVESSIYECQC--HTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQG-DGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG----------LLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGT--TCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF---------CIKQTPCD------VPNACKANQTCTPSNENSLAI------CECKPDFKLEND-TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN---------MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKAC-----TDRNECQEN-------------------PMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMI--GNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIP----GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKW--------------SDETNLNCEDIDECTNPTSC------------SSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQV-CENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKC-INTAGGFTCDCPEGFIYN----------------NYDCIDVDECSLDQVSSL--ADNCD----QVNGHCINTVGGFQCYCNRGFVMIENST---------KCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNP---CQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI--VSC--KAICGPNSCLPGQLCQIV 6550
            +  C+N  C C  GY      C++ DE E  Q  CDV A+C +T GSF C C  GY G+G +C   D   D         + +C    C+ P+ F+ K    ++   E +                              C D+DEC  N ++C  N++C N  G+Y C CP  Y+  + +++G  C  V        C  G  C N  GS  C C  G     D DG       +   C    C  NA+C      + C C  GY G  +  C D+DEC    N C +  +C N  GSF C C  G                                Y R S +GL         + + V  CG++  C     +Y C C SG++      C+++NECQ  +PC   A C +T GS+ C C  ++ GDP   C + D+C      C    VC+ ++  Y   C +      +  +  E + VN +C  N +C N+A C IEN    CFC  G+   G  CVD+DEC      C  ++ C N  GS+ C C  G+          Q  E+                              V   C DIDEC +      SC  N  C N+ G F C C  GF GD    C    +C      C   A C VNV    Y C+C  +T    D    C+    C  N    C  N+IC+   AT RC+CP+   G D  + C  +         NC +  +C+ +NGQ  C+C  G      +   C DIDEC   + N C+  AIC N  G Y CQC  G  GD           + C D + C  G   C +++      G   C C+ G   N     C D DEC   +G P    C  NA+CKN    Y C C  G+ G  +          C  Q+P        V + C + Q C PS    ++I      C C   ++ + D +C+   ECE +        + CV     + C C  G+          +    C    EC       A +KC+   G C+     F+         +NN    P +    G++        C  S      C C  GF+   + G C D DEC+     C   A C N  G Y C CP +   D  K  C     T +++C  N                    ++CG  + C     +  C+C  GY  NG                          G C  +CQ    GDG   CI T   P     KCP G   N    G+     C+       +  CI   C ++C  +         C   A C  N+G   C C     G+    C    E A  +  C  N ++CE        L   +C C  G    P    G Q   +KN C     N C  NA C        C C  GF   P   C++++EC  K   C +N+ C ++A GF C C  G                  D     C +  EC    SC            S  P +IC     +  C+CP G+   G   + ++ C I   CG ++ C ++   F         QL  G    + +C++   + Q   G +++C       +C+C DGF  +    QV C+ +         C+ S+ +C   YG     C+   S N   +C++         SN+    N  C IN AG   C+C E +++N                + +C D   C  D +  L     CD      N  C+      +C C  GFV   N            C +  ECQ   +C+        G     C    D V                CGP+A  +C+      QC+C  G     G  Y+P   CQSV  CV  N  CP +  C    N     C D        +C        E+SC   A CL  D    C C  G+KGD +  V+C  +  C   +C P  +C++ 
Sbjct:  106 HGACLNGVCHCNDGYGGC--NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAEC----CNLPAHFLCKCKDGYEGDGEVL------------------------------CTDVDEC-RNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGY----DGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ-DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC-IEN---QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAEC-VNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSAN--EDCPGNSICD---ATKRCLCPEPNIGNDCRHPCEAL---------NCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDEC---RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATG-ETCVQDSYT----GNSVCICRQGYERNSENGQCQDVDECSVQRGKPA---CGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQAC-PSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADREC------AANEKCIQP-GECVCPPPYFL------DPQDNNKCKSPCERFPCGIN------AKCTPSDPPQ--CMCEAGFKGDPLLG-CTDEDECSHL--PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGD-------------------------GDCVSQCQDVICGDGAL-CIPTSEGPT---CKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGV--------VCGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGEN-AHCEYG------LGQSRCACNPGTFGNPYEGCGAQ---SKNVCQ---PNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKP--CGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAIC----DAGNCICPMGYI--GDPHDQVHGCSIRGQCGNDADCLHSEICF---------QLGKG----LRKCVDACSKIQC--GPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCK-SDQDCSRGYG-----CQ--ASVNGIKECINL-------CSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLG-----CRPACDTVK---------------CGPRA--VCVTNNHQAQCQCPPGP--FAGDPYDPFNGCQSV-PCV-YNHDCPPSQMC----NRMTHTCFD--------VCD-------EESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVT 1912          

HSP 6 Score: 288.115 bits (736), Expect = 1.973e-76
Identity = 412/1436 (28.69%), Postives = 558/1436 (38.86%), Query Frame = -1
Query: 3443 YCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECL-LGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKL-LCPLNALCVNS----TCLCKSGYE---NSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-DCYDG----ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN-------------------------------------ENVDDCQ-----ENSICFNRFGSYDCKCPPNYL-DVFK---DGKVCMAVPLSQCNQSCPTGQYCNNG----SCSCLMGLNSQTDD-------DGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETN-NVCNCGSHGICGPNY---ICQCKSGYEINPSGM---CQDVNECQTQ----SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYG-----------------------------------SVCEKIS-CNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVG-------------------------------------------FQRLENALVTDSCTDIDECLLSE---SCATNGECQNTIGSFKCECKDGFIGDGKYDCRI--------------------DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDE--CANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSN-QTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPK-----------------GSPGAP----ECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDR-----ETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNE---CDPT---------SPDFAAQKCLASGG---GCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ-RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC-------PDNLKLDLSKKACTDRNECQ 7021
             C C  G+ G C+ C D DE       CD   A C N++GSFTC C  GY G+G  C +IDEC    +      +  C N+   F C+C  GY+ D    C D +ECR  +N C  NA C NT G++ C C  GY+G+    +  + ++EC    +C   A+C N      C C  GY+    S + C++ DEC ++T C  NA+C++T GSF C C +GY GD +N  +   D D C   N C  G +C +      C CPSGFV + +   D+  +   P N    +  G      +     S     C+DIDECN                                     EN+++CQ     EN+IC +  GS+ C C P+Y  D F+   D   C A+     ++ C     C N     +C C  G + + D        D N+ CS N        C  NA C E      C C  G+E +G  SC DIDEC      C  +  C NT GS+ C C+ GY  +     C+       CG+H  C P+     C C+ G+  NPS +   C D++EC         C   A C N+ G + C CP  F GDP +KC + D+C+T A +C AG  C     G                                   S+C+    C   E  I N+C      C+ +NCG HA C + NG+A C C  GY G+  L   C D+DEC      C   + C N  G + C C  G                                            Q  E       C D+DEC +     +C  N  C+N  GS++C C  G  G+    C I                     S C     C   A CI ++   +  C C   +      SC+  + C   G   C   A C     +Y C CP+G+QGD YN    + +  CA D    C++ EKC+       CVC     ++D    D ++C S  +   C  NA C   +    C C  GF GD LL C D DEC      C+  A C+NK G + C C     G+    G   E   PK                 GS  +P     C  NA C+ +     C C+ GY   G   C+ Q   DV   C     C P++E     C+C P  +L N    P   C   TD C       E   C+      +CE   G    +G TC   N    C+P           P     KC    G    C    G   C CN          C          ++C    E    +  +  +C C +GF       C DVDECA+K   C  NA C N  G + C C       P +    +  K C D N+CQ
Sbjct:  113 VCHCNDGY-GGCN-CVDKDENECKQRPCDV-FAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC-ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE---DVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQ---PLNT-QQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTAL-----DKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFD------CTNNAECIENQ----CFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDC---RHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN--PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAAD--RECAANEKCIQPG---ECVC-PPPYFLDP--QDNNKCKSPCERFPCGINAKCTPSD-PPQCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQ-DV--ICGDGALCIPTSEG--PTCKC-PQGQLGNP--FPGGSC--STDQCSAARPCGERQICINGRCKERCE---GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAE--CRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQ 1486          

HSP 7 Score: 286.574 bits (732), Expect = 4.669e-76
Identity = 655/2712 (24.15%), Postives = 944/2712 (34.81%), Query Frame = -1
Query: 1136 TNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGN-------------------------------------------GVTCTNINEC----YPLSPC-DNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKN-------------------------------YAKCTNTPGSYYCTCDSGYQGDGR---NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDG--------------TPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGY------------------RMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGY-YCQCKTGFTGHCD-ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFN---VNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEG---LEECGKLLCPLNALCVNST----CLC---------KSG--YENST--NQCINTDECESQTSCDVNANCIDTHGSFIC----YCNEGYIGDGINC---FKKDTDTDACQIENYCTDGDCYDG----------ICHCPSGFV---FKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDD--CQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM-AVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSAS-CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS-------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILIN-----NECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYG-----------------DGELCVDVDECSNG------------------DVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTD-------------SCTDIDECLL-------------SESCATNGECQNTIGSFKCECKDGFIGDG--KYDCRIDSK--CEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDG-FQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDI-DECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL---LCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQ-LDPG----FKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL-----ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMG--LDNCDRK---VEDCISSKDSSYT-CQCIEGFQ----------RINGSCVDVDECAD--------------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTD--GSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYS---CIETDSCPARDD------------------VKCPTGSYCNMIGNFIYCNCTNGY-EDSN-------QMECIGDVCYKKCSDIDECVTRKSACHKFAECTN--------NDGAYVCTCPS--YLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDET----NLNCED---------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY-CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSEC-------VDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYN------NYDCIDVDECSLD--------QVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAA-----GI-----------------CINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKD---GYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI-------VSCKAICGPNSCLPGQLCQIVNGNQYDCG 8065
            +N  C+N+A C     +  C C +GF   G  C DIDEC  +  VC  +A C NT GS+ C C+ G+ G+                                              C +I+EC     P   C  NAT  C +   G+ C C  GF  +  +  C D +EC    + C   +   N   G Y C C       P  S  C  +  C+   +C  N                               +A+C    G   C C  GY G+      C DIDEC +N   ++  A C N  G Y C+C  G              T GC   NPC T +    +       C C+ G++ N     C+D+DEC       A G  A C NL GSYEC C  G+                  +          +     +   C   AECI   GG  YC C  G+    D  C D+DEC        +  A C N  GS++C C EGY GD    +    C L    C+   +   N   +  G EC C   Y  D   +   ++ C  F   C  NA C  +D    C+C AG+ G     DP  G    +EC  L C   A CVN      C+C         KSG  +E+ T  ++C++ D+C S  +C +  +C+    S +C    YC          C   + K+ D D     + C D  C DG           C CP G +   F    C  ++C    P                        +   CI+   C E  +   C   + C    G   C C PN+  V     +CM  +  ++C+  C    +C  G        N  T  +    C   S + C P  C  NA C        C C  G+ G     C+D+DEC  K   C +N  C N  G F C C  G++ N         S  C+  N C C     C   Y CQ          G C+++    +Q+ C   A C     +  C CP  + GDP +                 +V   S+ G       C  SEI         +C+     C  I CG +A C  E+ R+ C C  G++G                 + + C    +CS G                  +V C  N  C+  + + H  CN     + N +V+              +C D   C               + +C  N  C       +C+C +GF+G+   +  C+   K  C  +  C E  +CI +  +    C+     + D +                C   A+C   N   +C CP G F GD Y+  N          H+C   + C                 +   C D+ DE        C  NAIC  ++    CQC  GF GD L    C     C  G   C  +A+C   P    C+C    +G+  + G                C  +  C N D     +C +     G  C  Q PCD  NAC +N  C   N     +C C   F+  +DT           D C R  S C+  +D G    +  +C+    +     QD ++ +    +     CL     ASG  C+    +  C  N+E        CK   SC     L+ C        + + S D  ++ C C EGF+          R+   C+  ++C                K  SC     C   +   VC   +N    L+ + C     CQ     C   + C  T+   + +C+C TG+      C DIDEC     PCH  ARC N+PG+ +C C  G  GDG YS   C +   C   DD                    C   + C   G+   C+C  G+  D N       ++ECI  V    C+    C    + C K  + T+         D    C C     L  D    CED NEC   +  C+ +T++C NL  +      + C C  G +  P    C + NECL+  + DC  +A C ++      RC+S                 E+ + C +N+ CQ +A    C C P     D T    ++ C D               ID C+ P +C ++      N+ G   C C  G +      C  +  C     C Q S+C++ +    CS         N DC     CL+ +  CQ    ++S C              F ++     +C  + EC         S+SEC        D YG  KC          +  C+    C            N +C+  +    C C EGF  +        +C   D+CS D        +++ L       N  C        C+C  GF   +   +C  ID C+         C N  GS++C C  G   D  N  C    EC  N + C P AA     G+                 C+      QC C  GY+         C+ +    ++   CP+N  C D      C+       ++  Q G C   N C    +C   A+C+  +   +C C  G+ GD         V+C   CGP       +C  V  N  +C 
Sbjct:  550 SNFDCTNNAECI----ENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNAT--CTNSAGGFTCACPPGFSGDPHS-KCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEK--AICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGD----AYNGLCALAQRKCAADRECAANEKCIQPG-ECVCPPPYFLDPQDNNKCKSPCERFP--CGINAKCTPSDPP-QCMCEAGFKG-----DPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLAC-LEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV---SQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARP----------------------CGERQICIN-GRCKERCEGVVCGIGATCDRNNG--KCICEPNF--VGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ---------KGQCKNLC---SQASCGPRAIC----DAGNCICPMGYIGDPHD-----------------QVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCV---DACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCK-INPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCR----PACDTV---------------KCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNR---------------MTHTCFDVCDE------ESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGT--CHPSAICEVTPEGPVCKCPPLFVGDAKSGG----------------CRPDGQCPNGD----ADCPANTICAGGVC--QNPCD--NACGSNAECKVINRK--PVCSCPLRFQPISDT---------AKDGCARTISKCLTDVDCGGALCYNGQCR----IACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKE--------CKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNC---LAGEICNSDRTCQPG---CDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECT--EQPCHASARCENLPGTYRCVCPEGTVGDG-YSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV---DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVND---VCEDINECL--SQPCH-STAFCNNLPGS------YSCQCPEGLIGDPLQAGCRDPNECLS--DADCPASASCQNS------RCRSPC---------------ERQNACGLNANCQAQAHQAICTC-PLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGV--CSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCST--------NRDCISEQLCLQGV--CQGTCKSNSSCPQF----------QFCSN----NICTKELECR--------SDSECGEDETCLSDAYGRAKC----------ESVCLGRAACG----------RNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSG-DPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQC--FNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECA 2974          

HSP 8 Score: 238.424 bits (607), Expect = 1.747e-61
Identity = 342/1313 (26.05%), Postives = 508/1313 (38.69%), Query Frame = -1
Query: 1229 GTYSCQCAEG-----FYGDGLLCHDIDECKFGVANCSEN---------------------------------------------------ALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET-----SNCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--------------------------------QRING---SCVDVDEC--ADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTG--DGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCY---------KKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPS-YLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPG--TQICLNKNEC--LNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQD-KADGFSCQCKPGFKWSD-ETNLNCEDIDECTNPTSCSS------------------------------MPHSICMNNPGSFECVCPHGF---SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGA-----------------------------------------------RQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDG-----FVNDEV--FPQVCENQNECEINIHSC--------QA--SNSECVDTYGSFK-CVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNG-KCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVM-IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYEN---------SGGKSYNPCQSVNECVK-------------LNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGD 4432
            G + CQ  E       +    LC    +C  G    S+                                                    A C N  G+F C C  G  GNG  C D DEC+ P     A  C ENA C N    + C+C+ GY+G G   C     C  P  C  N  CT  N      C C PD  + N+   P  E     D C         + C  L+  ++C+C PG++  G +   C D++EC        A+        CLNT GSF C C      +  + C+ +D CA   + C    E C+ +   S+ C+C  GF                                QR +G   +C+D+DEC   D +  C  NA C N  GSY C CP   +       C + NECQ+NP  CG+ + C +T GS+ C C   Y  +    C DIDEC     PC   A C N      CKC  G+ G  D   +C + D                N++       C++ ++ +N  ECI + C+           C DIDEC T    C   A+C N  G+Y C C + Y+    +  C+       E   C  + +YC+   N         C C +G+   P      C++ +EC  ++     C +NA C ++ G + C C  GF   P  KC +++EC   +  C   + C +    G++C+C PG   +D + ++ C  I  C+    C                                  H+ CM   G  +C+C  G+   S   G CNDI+EC   N C + ++C+NT  G+ C C  G+                                               R   NG C+ ++EC  ++ R +   G +++C +LP  Y C CP G     F+  E+   P+ C+ Q+  ++  +SC        QA  S +EC+   G    C C  G+    DG CVD DEC   E+   + C  G +C+N  G ++C CPEG+  + Y+ +    C+L Q    AD     N  CI      +C C   + +  +++ KC    E +FP   ++  C       +C+C  G+  D + G CTD +ECS+     G      C+N  G +QC C   Y             G   + C S ++C                ++ C SNA C    +   C C+ GY ++  G C  +++CQ +  C   A C+ T     C C  G  G+
Sbjct:   52 GYFGCQVNESTEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPA---IAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCT--NTPGNYTCSC-PDGYVGNN---PYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC--------ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAE-CV-NLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQ-GQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV---------------NIL-------CSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQ----PCEDVRCGAH-AYCKPDQNEA------YCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRC-PGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRA-NPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDEC--SVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPE-CQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDEC---EERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGL----CALAQRKCAADRECAANEKCIQP---GECVCPPPYFLDPQDNNKCKSPCE-RFPCG-INAKCTPS-DPPQCMCEAGFKGDPLLG-CTDEDECSHLPCAYG----AYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC--VSQCQ-DVICGDGALCIPTSEGPTCKCPQGQLGN 1282          

HSP 9 Score: 134.806 bits (338), Expect = 3.362e-30
Identity = 524/2364 (22.17%), Postives = 776/2364 (32.83%), Query Frame = -1
Query: 1154 CGENAECIDTDGGYYCQCKTGFTGHCDECRD-------------------IDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRS-----HQFCFNVNGGFECRCLSGYKSDT----------------NGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIG-----------SGRNCDPQEGLEECGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQTSC-------------DVNANCIDTHGSFICYCNEGYIGDG-INCFKKDTDT-------DACQIENYCTDGDCY------DGICHCPSGFVFKSNKCFDE-RCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKD--GKVCMAVPLSQ-CNQS-CPTGQYCNN----GSCSCLMGLNSQTDDD------GNLNCSKNSASCL--------PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINE-----DCSNTEGSFTCSCKRGYSRN--------SSSGLCETNNVC-----------NCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQ----------SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP----VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGD--------VSCPNNSFCQNKDGSFHCACNVGFQ-------RLENALVTDSCTD--------IDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCR----------------IDSKCEKYGGC-----HEDASCIVNVESSIYECQCHTEFSGDGITSC-IKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI--DECANDNTHN------CSSLEKCVNSNGQYNCVC----------------GDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL----LCHDI---DECKFG--VANCSENALCINKPGTFACECQAGTLGNGTT-----CGDEDECKKPKG---------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGW--------FCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG---CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSK----------DSSYTCQCIEGF----QRINGSCVDVDECADKID------------SCKNNATCNNMIGSYVCKCPDNLKLD-------LSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG--------TNCEDIDEC-AIK-------THPCH----DLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR-----DDVKCPTGSYCNMIGNFIYCNCTNGYEDSN---QMECIGDVCYKKCSDIDECVTRK------SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE------DQNECALETHTCNLNT----SYCENLDNTVNVLAPFQCHCFNGYVKIP--------------GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQ--DKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLEN--IDRCQVLN-GADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQA-SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLA-DNCDQ----VNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRN---------------INECQIEDSCHYL----ADCLDTDGSYKCTCKYGYKGDGIVSCKAI-----------CGPNSCLPGQLCQIVNG 7063
            CG N++C  +  G  C C T + G    CR                     D C  S  N     A C  S+ +  C C  GYSGD  S C +I E  + +    R      +  C   N    C+CL  Y  D                 + +CV++         C  NA C   + +  C C  GY G           S R  DP      C    C L + C     ++ C C   Y     N   +C+++ EC    SC               NA C   + + IC C+ G+ GD  + CF ++          D C       + +C         +C C   +V ++  C  E   ++ CP N                          CI++   +  V  C   + C        C+C   Y  D F +   K+ + V ++Q CN S C     C      GSCSCL   N     +       N +CSKN A CL        PG+C ++A C        C C  G+ G   + CR+I      +  C  +       C    G   CSC   Y           S S  C  +  C            CG+  IC     N IC C +GY  +P   C    E   Q          SPC   +QC     +  C C  NF G             +A  C+                      E  IN EC      +N+ CQ+    +CG +AFC + N    C CDSGY GD     +    +  D          C  N+ C+ ++G+  C C   +        R E  + +D   D        +D C     C  N +C+ +     C C  G+ G+    CR                  S C  Y  C     H   SC+     S   C+     S D   +   +N  C      +C   A C+ +N    C C  GF GD +N C  I  +    + + N      C    KC++  G   C C                       +  CV+   CS+     C  +++C   +   +C+C  G+ GD      +   I   DE +     + C  NA+C  + G  +C C     G+  +     C   D+C + +           PGA  C  NA C+  + G  C C  GY G             I+  PC  P+ C     C   + NS A+C C   +     +C P+                CV        EC      +   C+D               C  S G    C     + +CTC      +  S C+P+           + VE+ C+ S            +   C C  G+          C + DEC + +             SC +NA C  +  + VC C D  + +       +     T+       P  CG  ++C   +G+  C C  G++ N           CE+ D+C A++         PC+    D A C+       C C PG+TGD  +SC      P       +   C   S C  + N   C+C  G+ +     + EC   V   +C+    CV +K        C   A CT  + + +CTCP  +TGD    C       D    +    +C  +     + C+ + N+        C C   ++  P               T+ C+N+ +C +P    C   A C        C C  G++  P  +C    E           +       AD F+ +C+    +       C    ECT    C       CM N     CV P                  P  CG N+VC        CSC  G    P  +C  +   +E+  I+ C     G++S C D+     C C +G++     P  C  +        + QA  N +CVD   +                C     CE+   S +                C CP G   + +  C+ +   ++  V S   D C       N  C N   G  C C   F         +C+   +CQ   +C++  C+N                   C +   C  N++         C     +  C C  GY  +      P Q           C  NA+C++R+    C C D YQ +    CR                 N+CQ  D C  +    A C   +    C C  GY GD   SC+ +           C P+ C     C++ NG
Sbjct: 9849 CGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGN----NALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLA------------------------CINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRA-CLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVG-------------RAPNCRP---------------------ECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPC--PGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVN-QRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGA--CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK-PSPCGPYSQCL--DTNSHAVCSCLEGYIGAPPSCKPE----------------CV-----VSSECPQNRACINQKCED--------------PCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV--------KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPEC---VVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSP------ACSCLPNFIGAPPRCRPECVLNSECGPTEACINQ-KCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCR--PECTLSADCPR--DKACMRN----RCVDP-----------------CPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCR-VKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIG---APPQCRPECVVSSECSALQACVNKKCVDPCAAA---------------CGLEARCEVINHSPI----------------CGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSN------------------PCPE--SCGTNAE---------CRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQ--DPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANG 11997          

HSP 10 Score: 118.242 bits (295), Expect = 3.405e-25
Identity = 557/2406 (23.15%), Postives = 779/2406 (32.38%), Query Frame = -1
Query: 1190 CGENAECIDTDGGYYCQCKTGFTGHC-------DECRDIDECAFSL----NNCDSD-----RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE-NECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVN-----STCLCKSGYENSTNQ---CINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN-CFKKDTDTDACQIENYCTDGDCYDG----ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXX----XSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVP-LSQCNQSCPTGQYC----NNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD-------------------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYS-------------RNSSSGLCETNNVCNCGSHGICGP--NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINT------PGS---------YK----CQCPENFYGDPQNKC-------FEDKCKTKALQCQAGEVCKLSLYGSVC---------EKISCNSSEILINNECLPVNQVCQNIN--------CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCP-------NNSFCQ-NKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTI----------GSFKCE---------CKDGFIGDGKYDCR----------------IDSKCEKYGGCHEDA-----SCIVN-VESSIY---ECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCN-DIDECANDN-----THNCSSLEKCVNSNGQYNCVC-----GDG-AVYVDDICVDIDECSSNQ-----------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVA----------NCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCD--------VPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQL--DP-----GFKCECKPGFNMVGNTCQDKNECDPTSP---------DFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC---------------PDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCIETDSCPARDD--------VKCPTG--SYCNMIGNFIYCNCTNGYEDSNQMECIGDV--CYKKCSDIDECVTRKS------------ACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALET------HTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV---------------KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGF-----------SCQCKPGFKWSDET-NLNCEDIDECTNPTSCSSMP-----------HSICMNNPGSFECVCPHGFS-----------LQGGYCNDINECLIPNSCGQNSVCANTVSGFN----CSCANG-ARQLPN--GDCELINECLENI--------DRCQVLNGADSVCYDLPIGYACVCPDGFVND---EVFPQV-CENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEI-SEQSNMKFCNNGKCINTAGGF--------------TCDCPEGFIYNNYD--------CIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENS--TKCVDIDECQFPNSCLDGLCNNL-PGS-------------FECLCNIGYD---LVNGKCTDINE----CSNNSQICGPQAAGI---CINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDR--------SNGYE-----------CICKDGYQEDQIGIC---------RNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNS 7063
            CGENAECI  + G  C+C  GF G+          CR   EC  S       C S       A C+       C+C  GY+G+  V     +     + C   +  C   NG   C C  G   +   +C+ E +EC    N C  N+ C    G+ +C C   Y G   +   +     C    C  N  C       S C C   Y  S N    C+          C   A C D+    +CYC +  IG+    C K     + CQ      + +CY       C+C SG+V  + +   E    VC  N     ++                LS D +  I                 C       D  CP        + K CM       C  +C  G +C    ++  CSC  GL                  C+P  C  N+ C+      +C C PGY G     C+                    +D C G I  C IN  C+  + +  C C  G+              +N S   C  +    CG H +C    + +  C   +  N     +   EC   S C     C+        PGS         Y+    C CP   +G+P  +C          +     L C A   CK    G  C           I C   E ++N++C P  + C N          CG +A C++ N    C C  GY GD  +  +       +   P        NS C+   DG   C+C   F+               EC++S  CA N  C N            G  +CE         C+  F GD    C                 + S C     C         SC+ N + S  Y   EC   +E   D   +CI N  C     + C  NA C  +  +  C C + ++GD +  C+  I E   D+      + C+    C   N    C C     GD  +      C+   EC S+            T  C +NA C       SC C  GF G+       D CK  V            C  N++C +  G   C CQ G  G    C  E     EC +           P    C  NA C+  +    C C + Y+G  +      P +        +P+ C +N  C   N N+ A C C P        C P  EC    D C    +   Q   DP     GF   C    +    +C +  E DP +          D     C  S  G    C    G+  C+C Q    +   +C+P                +C+ + D      C      IN  C   D CA   ++C  NA C       VC C               P N+ L L K  C         P  CG  S C        C C+  Y     NC+   EC        D A    RC +  PG+C              C C  G+TGD  + C+     P   D        V  P G  S C +  +   C+C   Y        IG    C  +CS   EC  R +            +C   A C  +  A VC C    +GD  + C    E  +E         C LN + CE  +          C C   Y                  P ++ C+N+ +C++P    C  NA+C     +  C C  G+   P   C  + E     D     + CQ    G             C C P +  S       C    EC    SC +             +++C     +  C C  GFS            +    +D  +  +P+ CG NS C   VS  N    CSC      + PN   +C   +EC  N+        D C    G  + C        C C DG+  D   E  P++    Q     N   C A N+ C +  G   C C P ++ +   +C    EC + S+ S  + C N KC +   G               +C CP GF  N              V+ C        +  C +VNGH +       C C   ++    +   +C    EC    +C++  C +  PG+               C C  GY     V  +C    E      +N   C P   G    C     +  C C     N  G++ N C+   EC  +N  CP+N  C++         S G+            C C  GY  D    C           +  CQ    C   A+C + +G+  CTC   Y GD    C+  C  NS
Sbjct: 8362 CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGL-NALCELDNGNPICYCPKGLTGNPFKNCIPEGDEC--TPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAIC-DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIG----------------CHGYECQVDADCP--------NSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAI--CGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPS---PCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR-PECVLNSDC-PAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQ-------PECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSD--KACI-NEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF-----DGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSIC--RNVNNRAECSCAPGMFGAPPNCRP--ECVINQD-CPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP----------------ECVQNSD------CPNNRACINMKC--RDPCA---NACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPC--------RPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCK--PECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNY--------IGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLN-ALCEERNQAA------ACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQ-KCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECR--VSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGA-NAVCKERNGVGSCSCLPEYNGDPYTEC--RPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYS-QCREVNGHAV-------CSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFV--RCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSC---LPNFVGRAPN-CRP--ECT-INTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQ-PSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNS 10636          

HSP 11 Score: 113.235 bits (282), Expect = 9.245e-24
Identity = 448/1887 (23.74%), Postives = 639/1887 (33.86%), Query Frame = -1
Query:  455 CHILAQCINTPGSYKCQCPENFYG----DPQNKCFEDKCKTKALQCQAGEVCKLSLYG--SVCEKISCNSSEILINNECL------------PVNQV-------CQNINCGNHAFCKIENGRADCFCDSGYYGDGEL--CVDVDECSNGDVSCPNNSFC-----QNK--------------DGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCAT----NGECQNTIGSFKCECKDG---FIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNN-LCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTN-KCSSNAICQNKEGTYSCQCAEGFYGD-----GLLCHDIDECKFGV---ANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET----SNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTK--GSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQ--------------------ENPMICGDLSKC------------LNTDGSYECQCVTGYKWNGTNCED---------IDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSY----CE-----------NLDNTVNVLAPFQCHCFNGY----------VKIPGTQICLNKNECLNP-------VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNG-------ADSVC-----YDLPIGYACVCPDGF-VNDEVFPQVCENQNECEINIHSCQA---------SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTC----DCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNN----SQICGPQAAGICINAAGSFQC-KCNVGYENSGGKSYNPCQSVNECVKLNIT--------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA---ICGPNS-CLPGQLCQIVNGNQYDCGCVCQGPRCRDN--------------GPVCDTQGITYQS---EKQMFETTCKQNI---VGEVEYYNECQKSCATV-TCPGIEKCSMVNDRPSCTCQNCTQAELTPRLFCSNNGIEFHSICQMKTWICNTK---SEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKASMFNGNCEDPLFETQQCYNGPCPGDACENITCAPGSFCESGKCICPDCSDQRIPDPVCGKIGDLESGTYRTFC 5488
            C   A C+      +CQCP   +     DP N C    C      C   ++C    +    VC++ SC  + I +  +              P+ +V       C    C   A C++      C C   + GD +   C    +C NGD  CP N+ C     QN               +    C+C + FQ + +         I +CL    C      NG+C+    + + +C DG           C   S+C     C E   C +        C+ + E   D   SCI+N  L      +SC  NA+C       +C CP+GF+G                           N   +  CV         + C     C  NQ N  C+  A C   E  Y   C +  Y       G +C+    C+ G    A+C    LC+    T  C+C  G +G    C D DEC +         C  +A C+N    Y C C  G  G G+    Q  C  P  C                   KPD    N  CI   +C   TD C        +NC        C C  GF  +G    D N+               +G GC   +      C  ++    E N   KP D  + G  NC          +D   TC C EG+Q +N  C D++EC  +   C + A CNN+ GSY C+CP+ L  D  +  C D NEC                     E    CG  + C            LN+ G    +CV     +  +C           ID C++    C  LARCS       C C+ G TGD    C++   C  + D +C  GS C+       C+ TN    S Q+ C+  VC   C          S+C +F  C+NN    +CT         +  C   +EC  E  TC L+ +Y    CE           N +      AP  C C  G+          ++      C N   C N        +   C ENA+C        C C+ GF   P  +C+ I+ C +    C   + C++    + C C PG    D  N  C    EC     C   PH+ C    G  +C              D+   L    CG N+ C        C+C +G    P    + +  C      CQV          +DSVC      D   G   VC  G   N  + PQ C    EC +  H  Q          S  ECV    +    C PG++      C D   C     ++++  +N KC+  +   TC    DC  G +  +  C  V  C +D   S +++C   N  C+N      C  N    +  +   C          SCL+ +  N      C+ +   +     C +  +C N       +C P    +C + AG     +C  G      +  N C     C+ LN          CP    CV    G +C+                + C    +C   A C   D   +C C  G  G+  V+CK     CG N  C   QLC   +         CQG +CR++                VC+T     Q    E +M +T C+ ++     E     +CQ  C T   C     C +VN    C C         P  F   +G+   + CQ+    C+      E        C R+ DC   +  +   C   CG  R                        Q C  G C      N  CA    C +GKC  P C++++     CG+        +R  C
Sbjct: 1795 CGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPC-VYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQ-DCSDGESCLKNVCVVACLDHSQCASGLACVE-GHCTIG-------CRSNKECKQD--QSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEG---------------------------NPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCL----TGKCKCATGFIGTPFGCSDIDECTEQP-------CHASARCENLPGTYRCVCPEGTVGDGY---SQPGCSQPRQCH------------------KPDDCANNLACI-HGKC---TDPCLHTVCGINANCQSEGHEALCSCPAGF--LG----DPND---------------TGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQ--------VRDHKATCACYEGYQLVNDVCEDINECLSQ--PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNA-CGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYC--QQDGQCAQGSICSHGICSPLCS-TNRDCISEQL-CLQGVCQGTCKS-------NSSCPQFQFCSNN----ICT--------KELECRSDSECG-EDETC-LSDAYGRAKCESVCLGRAACGRNAECVARSHAP-DCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAP--CGPGARCRNARGSYKCTCPPGL-VGDPYNEGCRSSVECETNEDCP--PHAACTKTNGVAKC-------------RDVCAQL---QCGPNAECVPKGHVAQCACRSGYDGQPA---DRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYT------CRD-SMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKC--VYGCHVDDDCSASESCR--NDKCVNPCLENPCGPNAACSVSNHRASC----------SCLESMVPNPTPQVGCVRSPPLE-----CRENRDCGNGLACFESVCRP----LCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCV----GQQCV----------------DPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGS---------CQG-KCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQC---------PAAF-MGDGL---TGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTV-------------------GQLCERGACIAGCKSNGDCAADQSCVNGKCSDP-CANEK----ACGRNALCTVSEHRMLC 3427          

HSP 12 Score: 112.849 bits (281), Expect = 1.178e-23
Identity = 573/2438 (23.50%), Postives = 785/2438 (32.20%), Query Frame = -1
Query: 1907 TCSNDAFCDFKDDDYGCHCKNGFMGDGIM-CKDIDECSNN-----TSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTC----TNINECYPLSPCDNATEECFDKVPG--------------YECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVS-------TNCNNTFGSYRCDCKYGFRPSPIDS-----FVCTDVNECNLVHECDK------------NYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYL----GQCFCKHGFQNN--------VTTNICEDIDEC------DTAANDCAGRKAKCANLDGSYECECLYGY---------RMSSXXXXXXXXXXXXXNL-HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRA--------TCENSIG----------SFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNG---GFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VN--STCLCKSGYE-----NSTNQCINTD---ECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENV-------CPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKV-CMAVPLSQCNQSC-------PTGQYCNNG----------SCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTP-----------GSYKCQCPENFYGDPQN---------------KCFEDKC-----KTKALQCQAGEV-------CKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG----ELCVDVDECSNG------------DVSCPNNSFCQNKDGSFHCACNVG---------FQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND--NTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI----CVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGV--------ANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-CIKQ---------TPCDVPNACKANQTCTPSNENSLAICECKPD-FKLENDTCIPKTECENKTDNCDRETSNCVQ---LDP-----GFKCECKPGFNMVGNTCQDKNECDP------TSPDFAA------QKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKK-----------ACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCIETDSC-PARDDVKCP-TGSYC--NMIGNFIYCNCTNGYEDSN----QMECI--GDVCYKKCSDIDECVTR-KSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCED-----QNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIP--------------GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSD----ETNL----NCEDIDECTNPTSCSSMPHSICMNN------PG-------------SFECVCPHGF--------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP----NGDCELINECLENID----RCQ-------VLNGADSVCYDLPIGYACVCPDGFVNDEV-----FPQVCENQNECEINIHSCQAS----NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQ-SNMKFCNNGKCINTAGGFTC 8056
            +C N+A C   + +  C C+ G  GD I  C+ + E  N       S C  N+ C+      +CSC  G+ G   TC    TN +EC     C    E C D  PG                C C  G+      G C        T +               C    G+  C C  GF  +P D+       C + ++C  V  C +            +YA CT       C C  GY GD         C    V  RP                         NPCN   C  PN  C        C C+ GF N         V +  C     C      D   + C G +A C   + S  C C             R++  N            +   CG NA+C        C C   F G    CR   EC  + + C    A         C  S G             C C EGY GD  V C++ +E           +      N      ECRC + Y+ +    C  E         C  +ADC           R       R  DP  G+  CG      NA+C  +N    C C  GYE     N   + +  D   E  S + C  N+ C D +G  +C C EGYIG    C  +   +  C     C +  C D  C    G         + RCE +       CP            V        + S        D C  +   C  NSIC N      C+C P +     + +  C+  P  Q  Q+C       P  + C             SCSC  G              +    C P  C  NA C ER     CKC   Y+G   + CR           C ++ DC   +     +C R   ++   G+C  N  C   +H    PN  C C  GY  +P   C+ V   +  +P  +   CI +P           G   C C E F G P N                C + +C     KT  L  +   +       C L + G    +            +  PV + CQ   CG ++ C++ + +A C C   + G        CV   +CS              D SC  +S C+ ++    C C  G         F+ +E    +   T  D C L + C +N EC+N I    C C   + GD    CR   +C     C    +C+                          N  C       C +N+ C+  N    C C  G+ GD +  C      A D    + C     C  S     C C  G +         C+   ECS +               C   A CQ      SC C  G+ GD       +E K           + C  N+ C    G  AC C A  +G   +C  E     EC   K         P    C  NA C   +    C C  GY G  +  C K+         TPC+ PN C +N  C     N +  C+C PD F     +C P  EC   +D    +   C Q    DP     G   +C    ++   TC+     DP        P   A      Q C  S  G    C    G  VC+C +  +     +C+P                +C+ S +      CI   QR    C           +C  NA C     S +C+C      D   +              +R+ C  +P  CG  S+C N  G   C C+  +     NC    EC I      +LA    RC +  PGSC              C C  GFTGD   SC       P + +   P   S C  N   N   C C   +        + EC+   D    K     +CV      C + A C   +   +C CP    G     C        N C      C  N S C  ++          C C   ++  P               TQ CLN+  C +P    C   A C     S  C C   F   P  +C+   + E    + +    C+    G   QC+P  +       ET +    NC    EC   + CSS     C+N       PG             + +C+C  GF          +  Y N+I     P+ CG N+VC +     +C C       P      +C L ++C  N      RCQ        LN    V   LP    C C  G+V D        P+  +N+      ++ CQ +    NS+C  +     C C P F   +   C    EC IS + S  + C N KC++     TC
Sbjct: 11084 SCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQ--ERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFG-CQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGD-----PFFSCKPVPVTPRPPL-----------------------NPCNPSPC-GPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTC-GIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRP--ECVLN-SECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPE---------CTLSADCP----------RDKACMRNRCVDPCPGI--CGN-----NAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDP-CAAACG--------LEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQ-----DPCVPS--PCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRP---------ECVLSSDCPTDK-----TCIRNKCQDPCPGICGLNAQCYAVNH---VPN--CVCNDGYTGDPFASCRRV---EVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQ-DPCDL-QPCGSNAECRNGI----CSCLADYQGDPYTGCR--PECTLSTDCAPTKACL--------------------------NKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCE-PNPCGSNAVC--RERNGIGSCQCLPDHFGDPYQSCRP--ECVRHSDCASNKA--CQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGL-PPNCRP----------------ECVLSTECPTDKACIS--QRCQDPCP---------GTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSP--CGLNSQCRNVQGVPSCTCLPDFLGAPPNCR--PECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPC--RPSPCGPN-SQCREVNQQA------VCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQ-RCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQ--PQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR--PECVTSSDCSS--QLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPT---CTCLTGYVGDPYRQCNRLPEPPQNE-----YVNPCQPTPCGPNSQCRVSNEQAVCSCLPLF-VGTPPSC--RPECTISSECSADRACVNQKCVDPCAADTC 13321          

HSP 13 Score: 97.0561 bits (240), Expect = 8.467e-19
Identity = 477/2022 (23.59%), Postives = 662/2022 (32.74%), Query Frame = -1
Query: 2294 RCDCKYGFRPSPIDSFVCTDV-------NECNLVHECDKNYAKCTNTPGSYYCTCDSG---YQGDGR-------NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYG-----YRMSSXXXXXXXXXX--------------XXXNLHQ-CGENAECIDTDGGYYCQCKTGFTGHCD---------ECRDIDECAFSLNNCDSD--------------RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDT-NGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNAL------CVNSTCL----CKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDG-INCFKKDTDTDACQIENYCTDGD-CYDGICHCPSGFVFKSNKCFDER------CENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENV-------------DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSC--SCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLY--GSVCEK-----ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECK---DGFIGDG------KYDCRIDSKCEKYGGCHEDA--------SCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI-------DECANDNTHNCSSLEKCVNSNGQYNCVCG---DGAVYVDDICVD---IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCE---CQSGYK-----GTGWFCIK---QTPCDVPNACKANQTCTPSNENSLAICECKPDF--------KLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNT-KGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ------------RINGSCVDVDECAD--------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCV---TGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPG-SCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKK--CSDIDECV--------TRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEE--KSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCE----------------DIDECTNPTSCSS------------------MPHSICMNNPGSFEC-VCPHGF----------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGAR 7633
            +C C  GF  +P     C  V       N+C   H C  N     N P +   +C  G   YQ   R       NC   + C+S++ CQ                     PGCD D  C       P E+C  G+C C  GF    T   C DIDEC      C    A+C NL G+Y C C  G     Y     ++  +                      LH  CG NA C        C C  GF G  +         EC D  +CA     CD++              +  C+      TC C EGY     VC +I+ECL        S  FC N+ G + C+C  G   D     C D NEC   D  C  +A C N+     C  R    G   NC  Q     C    CPLN+       CV+  C     C        ++CI  D C    +C   A C   +   +C C  G  GD  + C +       CQ +  C  G  C  GIC   S     +  C  E+      C+  C  N+ C          C+      SDS +C + + C  +                C  N+ C  R  + DC C   +    K G  C  +  +  +  C   + C+N  C  +CL+G                        C  NA C       +C C+PG+ G     C  ID C  +   C     C N  GS+ C+C  G   +       SS  CETN   +C  H  C            + N    C+DV     Q  C   A+C+      +C C   + G P ++     CK     CQ    C  + Y   SVC+        C + E+    +C   N   Q   CG +A C ++N    C C  G+ GD        EC    V+C         DG     C  G+    +++    C +  EC  +E C          GS    C+   D F+G         Y C +D  C     C  D          C  N   S+   +         + +      C  +    C EN  C    A +  +C      D     N+          C +DN   C   E C+      NCV G   D     +  CV    +D C+      C +NA CQ  +    C C EG  G+  +      CK     C  N  C +    +A  CQ G   N   C  ++ C   +G+     C+ +  C     G  CE   CQ+G +      T   C+    Q PC  P  C     C   N      C+C   F        +L  + C P  EC+     C  + S       G +C          N C  K +C         Q C    G C+   K +  C  +Q  +N   S     D CA     C R     +S  +    C C +G++            R++  C     C          +  +C  NA C  +     C CP +   + + +       C   P  CG+ SKC    G YEC C+    G    G  C      A +  PC   A C  +     +C C   F  GD    C  T   P +D         C  +G  +      GYE   Q +   + CY    C     C+        T +  C   A C        C+CPS   G  +  C+   +C  E    + +    E +  + +              + P T  C    +C +P  N    C  N  C        C CKSGF     G+     +  E  + D+C+ N  C D      C    G       N +CE                 I  C     C +                   P+S C+       C  CP GF          +  GG C    +C   + CG +  C +       SCA G +
Sbjct: 2107 QCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQC---NLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQ---------------------PGCDSDADC------PPTELCLTGKCKCATGFIG--TPFGCSDIDEC--TEQPCHA-SARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGD-RACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECL---SQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNEC-LSDADCPASASCQNSRCRSPCE-RQNACGLNANCQAQAHQAIC---TCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCI--DPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQ----LQYCQQDGQCAQGSICSHGIC---SPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDS-ECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSG--CRKIECTS-DDDCSNDKSCDNHMCKIACLIGQP----------------------CGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFC--RDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNE--DCPPHAAC-----------TKTNGVAKCRDVC---AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVA--GCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCF--NPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDS-----AKECVRVPVAC---------DGE----CGPGYT-CRDSMCLPVCHNDLECASNEKCLK--------GSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN--ECGHGELCLG----LNCVPGCRSDQGCPPELSCVGQQCVDPCA--DPTACGTNAHCQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQ-GKCRNDQNCLADERCM--RGT-CRTVCNTDEACAQ---GQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHG--VQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQC----ARGKCRNKCGPKRQC------TVGQLC--ERGACIAGCKSNGDCAADQSCVNGKCS-----DPCA-NEKACGRNALCTVS--EHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKP--CGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTT--PKQD---------CRTLGCEVGGCVRQGYEYVCQQD--TEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAE----DTDPKTKEQIPCSTDS-------------ECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLT---SCAGGVK 3923          

HSP 14 Score: 94.3597 bits (233), Expect = 4.542e-18
Identity = 268/1164 (23.02%), Postives = 386/1164 (33.16%), Query Frame = -1
Query: 2930 SCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQD--------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINC--------GNHAFCKIENGRADCFCDSGYYGDG-ELCVD--VDECSNG--DVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNG---ECQNTIG----------SFKCECKDGFIGDGKYDCR------------------IDSKCEKYGGCHEDA-----SCIVNVESSIYEC--QCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI-----------DECANDNTHNCSSLEKCVNSNGQYNCVC---GDGAVYVDDICVDIDECSSN---QTNK--------CSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKF----GVANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF------------CIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKV----EDCISSKDSSYTCQCI--------EGFQR---INGSCVDVDECADK------IDSCKNNATCNNMIGSYVCKCPDNLKLDLSK--------KACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCI------ETDSCPARDD-VKCPTGSY--CNMIGNFIYCNCTNGY---------------EDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE 5860
            +CLP  C   + C E      C C P Y G    +CR           C  + +C   +     +C +   R+   GLC  +  C   SH        C C  G E +P  +C++        ++ C + SPC I A+C +   +  CQC  +++G+P   C                                   E ++N++C P N+ CQ   C        G +A C + N    C C SGY GD    CV   V E  N      C  NS C+  +    C+C   +      +    CT   EC   ++C        C NT G          S  C C+ G+ GD  + C                   + + C  Y  C         SC+V    +   C  +C          +CI N  C      SC   AIC  +N T  C CP G+ GD ++ C  +           D C   N   C    +C  +NG   C+    GD        C+   +CS       NK        C+ NAIC        C C EG+ G+  + C              + C  N+ C        C C  G +G    C  E                +C  P   PG+  C  NA C   +    C C   + G  +              + Q PC  P+ C  N  C  + E   A C C  DF      C P+                CV        EC      +   C+D                  S   C     + +C C+     +  + C+PI      ++ C         +CI  ++ +  CQC+        EG +    +N  C     C  +        SC  NA CN +  + +C C      D  +         A    N CQ +P  CG  S+C  + G   C C+  +     +C    EC I      D A    +C +  PG+C              C CQPGFTGD +  C+         S   RD  V  P G Y  C ++     C+C   Y               E  + + CI + C   C           AC   A+C+  +    C+CP+  TGD  T+C 
Sbjct: 14320 TCLPSPCGPYSQCREVNESPSCTCLPEYIG-APPNCRP---------ECVTSSECPTNQ-----ACIQQKCRDPCPGLCGQSAECRVLSH-----TPSCVCPEGMEGDPFTLCKEKRIQELDQLDPC-SPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGC---------------------------------RPECVLNSDC-PSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAP-PVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACI-NEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPC---NPSPCGPNAQC--NNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDP--CPGS--CGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCR-PSPCGPNSECRAAGET--ATCTCLGDFVGSPPYCKPE----------------CVA-----NSECPSNLACINQKCRDP-----------CPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECI-QRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSP--CGANSQCRESQGQAICSCLPEFVGTPPSCR--PECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPC---------PGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCR 15368          

HSP 15 Score: 88.5817 bits (218), Expect = 2.868e-16
Identity = 511/2205 (23.17%), Postives = 727/2205 (32.97%), Query Frame = -1
Query: 2453 KGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNT------------------SVCDSNAFCKNTIGSFSCSCKEGFEGNG-VTCTNINE----CYPLS--PCD----NATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG----RNCTDI--DECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGY------RMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRA--------TCENSIGSFTCRCN-----------EGYSGDG-SVCSEIDECLLGLH------NCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE---------------NECRFFDNG-CDDNADCINTDGSFLCICRAGYIGSG-RNC---DPQ------EGLEECGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQTS-------------CDVNANCIDTHGSFICYCNEGYIGDGI-NCFK--------KDTDTDACQIENYCTDGDCYD--GI--CHCPSGFVFKSNKCFDE-RCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKDGKVCMAVPLSQCNQS----------CPTGQYCNNGSCSCLMG--------------LNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGG---KINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSP--CHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYG------SVCEKISCNSSEILINNE--CLP--------------VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHN------CSSLEKCVNSNGQYNCVCGDGAV----------------YVDDICVD---IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG-----LLCHDIDECKFGVAN-------CSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICE-----CKPDFKLEN-DTCIPKTECENKTDNCDRETSNCVQ---LDP-----GFKCECKPGFNMVGNTCQDKN------ECDPTSPDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADK-IDSCKNNATCNNMIGSYVCKCPDNLK-------LDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDI----DECAIK--------THPCHDL----ARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR-----DDVKCPTGSYCNMIGNFIYCNCTNGY----EDSNQMECIGDVCYKKCSDIDECVTRK------SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE-DQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGT--------------QICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKC------------ENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNN 8092
            K E  +  C    C  ++ C  +D+   C C   F+G    C+   EC  NT                    C  ++ C+       C+C+ GF G+  V C    E      PL+  PCD     +  EC + +    C C   +  +  TG    R EC         +ST+C  T     C  K    P P    VC   ++C++ +                 C+C  GY GD     R+ T +  D C  N     P++ C        C C    PG  G  P    +C   +E      C  +            + +D C  A     G+ A+C  ++ +  C C  GY      R     +      +       CG N+EC   +G   C C   F G    CR   EC+ +   C   +A         C N+ G F  RCN            GY+GD  + C +  E ++         N   S+  C   NG   C+CL  +  D   SC  E                +CR    G C  NADC  T+    C CR GY G   R C    PQ      E  + C    C  N+ C      + C C   Y     N   +C+ + EC +  +             C +NA C   + S +C C +G+ GD    C+         +  + D C       +  C +  G+  C C   F+     C  E      CP N                   L+    +C  ID C  +     E S+  +   +  C CP  +  D F     C   P  +  QS          C     CN G C+CL                LNS    D   + SK    C PG C  NA C+      +C+C     G     C  +        + + C  N  C        CSC   +                 G+   C P    +C S  E  P+  C +   C    P  C + A C     S  C CPE F G+P  +C + + +         + C+ S  G       V E  +C+  E  I     C P              VNQ C +     CG +A C + +    C C  G+ GD                     F Q       C   + +   EN + T              C  N  C++  G   C+C   + GD    CR +        C  D+ C  N       CQ                + C      +C  NA C+ VN    C C  G+ GD Y  CN + E   +   N      C    +C  SN Q  C C    V                  D  CV+   +D C++   + C +NAIC+ +  +  C C  G+ GD      L+   I E K            C  N+ C N  G  AC C    +G    C  E                +C+ P   PGA  C +NAVC   +    C C  GY G  +      P + P    A+  C PS   + A C      C P++K +   +C P  EC   TD C R+ + CV+   +DP     G    C+   ++    C ++       EC P  P      C  S  G    C   + + VC+C    +  +   C+P                +C+++ D    C   +  Q +        +C D    +C  NA CN +     C CP  +          L  +    +N CQ +P  CG  S+C  +  S  C C+  +     NC        EC             PC  L    A C     S  C C  GFTGD    C      P       +   C   + C   G    C C   Y     D  + EC+ +     C     CV +K        C + AEC   +    C C    TGD  + C    NE     +      S C        V     C C   ++  P                + C+N+ +C++P  N C + A C     +  C C SGF   P  +C            E ++ C      C  NS C++     SC C P +     T  NC    EC+    C S  H  C+N 
Sbjct: 12084 KDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCR--PECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGI----CSCLADYQGDPYTGC---RPECT--------LSTDCAPTKA---CLNKKCVDPCP---GVCGQNSQCDVSNHIP-------------ICSCLQGYTGDPFVHCRHETPVAKDPCQPNPC--GPNSLCHISGQGPVCAC---QPGMLGSPPACKPECIVSSECSLHTACVNR------------KCVDPCPGA----CGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR--PECSINP-ECPPTKACIRQKCSDPCVNACG-FNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSN-------------------LACIRERC--IDPCPGSCGYAAECSVVNH---TPICVCPAGFTGDPFSS---CRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPC-PGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSF----------------IGAPPSCRP----ECTSNSECAPTQACLN-QRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRC-QPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGD--------------------PFVQ-------CKPEIAY---ENEIRTP--------CSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPE--------CMLDSDCPSNRACQQLRCQ----------------DPC----PGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAA---DTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDP--CPGA--CGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRP--ECVLNTD-CPRDRA-CVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVG-SPPQCRP----------------ECVTNSD----CPADQDCQNM--------KCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSP--CGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLN---SDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNR-KCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSP--CGANSQCREIHGTPSCSCLPQYLG---TPPNCR--PECSINAECPS--HQACINQ 14056          

HSP 16 Score: 81.6481 bits (200), Expect = 3.389e-14
Identity = 303/1339 (22.63%), Postives = 432/1339 (32.26%), Query Frame = -1
Query: 2486 CPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG---LCETNNVCNCGSHG-ICGPNYICQCKSGYEINPSG--------MCQD---------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGEL------------------CVD---VDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVT---------DSCTDIDECLL----------SESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL---CHDIDECKFGVANCSEN------ALCINKPGTFACECQAGTLGNGTTCGDEDE---CKKPKGSPGAPE------------------------------------CDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC---ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC-NQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSKDSSYTCQCIEGFQRINGSCVDVDECADK---IDSCKNNATCNNM----IGSYVCKC----------------PDNLKLDLSKKACTDRNECQ----ENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMEC--IGDVCYKKCSDIDECVTRKS--------------ACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE--DQNECALETHTCNLNTSYCENLDNTVNVLAPFQ-----------------CHCFNGYV--------KIPGTQI---------CLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSD-------------------NCSINSVCQDKADGFSCQCKPGFKWSDE---TNLNCEDIDECTNPTSC 5842
            C + A C        C+C  G+ G     C   D    +   CT++ +C +    F   CK         G   +CE  +     +    C P Y+ +   G    P           CQD         VN C   SPC   AQC+       C CPE   GDP   C+E             E+     + S C+  +       IN  C      C   N C  +A C+++N R  CFC +G+ GD ++                  C++   VD C++G V C N + C  ++    C C  G Q   N  ++         + C D + C             E+CA N  C       +CEC+ G+ G+    C I  K  K   C +DA C   +        C  E   D    C   ++C    + +C    +         C CP     D    C  I            ++ K V S  Q+N  C +  V  +  C+D     + +  +C  NA C  ++    C C +GF G+  +     ++D  +     CS N       +C N+       C A   G G  C  +     C+ P G  G P+                                    C  NA C  K+    C C+ G+ G   F      C   + C  ++ C   N   +  C       L +D C    EC  +    +      ++ DP  +C   EC   ++   N     NEC   SP      C A    C   +   VC C +Q  +    + C+P            R VE  C    D      CI+            D+C D    +  C   A C+ +    + + VC+C                P  L    S + C D+  C      NP  CG  + C  T     C C  G++ N   +C  I  C +    C     C N              GD I  C+  D C    +        C +  N   C C +GY  +    C  IG      CS  ++C T K+               C   AEC   +   VC CP    G+    C    Q  C L+T          E   +   VL P Q                 C C +GYV          PG +          C     CLN V  D   C  NA C   +    C C+ GF+  P  +C  I EC   SD                    C  N+ C        C+C PG   +     T L C   DEC    +C
Sbjct: 16151 CGIGAQCRVENHRAQCRCPAGFSGNPAVRC---DLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPP-----------EIKTGCTHDSECQPTT-----ACINKRC---QDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ--GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKP-QCIQDADCPSKL-------ACINERCAD---PCATPHVC--TPQQTC--TVLDTLPKRAMACKCPGDTVTDISRNCVPI------------TVPK-VISGCQHNSECANTEVCSNGNCLD-----ACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNE--ICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCV--NRECINPC-------LASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC--VSPCGQRNPC-AQNAICQALQHRAVCRCPDQLPLGNPYAYCEP------------RPVEPVCRDDGDCPSKLACID------------DKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG-CRVDGE-CDSGKACIN--------------GDCINPCLINDPCGPNAE--------CYVQSNRAQCRCLSGYRGNPYERCRVIG------CSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKI-ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKAC 17363          

HSP 17 Score: 81.6481 bits (200), Expect = 3.778e-14
Identity = 517/2367 (21.84%), Postives = 756/2367 (31.94%), Query Frame = -1
Query: 2264 QLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDI----DECSNNTS------------VCDSNAFCKNTIGSFSCSCKEGFEGNGVT--------CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTG-------NCD-------DRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFR-------PSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA--------GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDI--DECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDG----SVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTN-----QCINTDECE-------SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKC-FDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQC--IDIDECNENVDD------CQENSICFNRFGSYDCKC-------PPN------YLDVFKDGKVCMAVPLSQCNQSCPT--GQYC------NNGSCSCLMGLNS-------QTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKP------GYEG-----VGIKSCRD---------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS---------SSGLCETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTP-------------------GSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP----VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQ-VNATYRCICPDGFQGDGYNFCNDI-----DECAN---------DNTHNCSSLEKCVNSNGQYNCVC-----GDGAVYVDDI------CVDIDECSS-------------NQTNKCSSNAICQNKEG----TYSCQCAEGFYGDGLL-----------------CHDIDECKFG--------VANCSENALCINKPGTFACECQAGTLGNG-TTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC------------------------NQEQMNENNSSCKPI---DSCAMGLDNCDRKVE---DCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMIC---GDLSKCLNTDGSYECQCVTGYK-----WNGTNCEDIDEC-------AIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIET---------------DSCPARDDV-------------KCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRKSA----------CHKFAECTNNDGAYVCTCPSYLTGDGK-----TTCEDQNECA--------------LETHTCNLNTSYCENLDNTVNVLAP-----------FQCHCFNGYVKIPGTQICLNKNECLNP--VENDCVENAICIDTEGSYECRCKSGFKQLPSGK-------------CENINECEEK--------SDNCSINSVCQDKAD----------GFSCQCK---------------PGFKWSDETNLNCEDID-----ECTNPTSCSSMPHSICMNNPGSFECVCPHGFS------------LQGGYCND---------INECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELI 8077
            Q  C    C  ++ C    +   C C   F+G    CK       EC +N +            +C S+A C+    +  C C  G  G+  T           IN C P SPC  A  EC  +     C+C   +  N   G       N D        + +C D        +  CN    +  C+C  GF          P +      VN C     C  N ++C  + G   C+C   + G   +C    EC  +  C   D  C+N       +C D  PG  G N     QC   N   +   C C+ GF  +  T            +ND          G  ++C  ++G   C CL  Y  ++ N   E          +C  N  CI+                 ++CRD     C F+        A C     + +C C  GY+GD      V             C  S      +    +C CL  Y  D    C    EC   ++ C  N  C+N      C+            DP  G   CG     LNALC  VN   +C      + N     Q I  D            + C  NA C++ +G+ IC C  GY G   NC  +   +  C   + C +  C D    CP        KC  +  C+ +                   +     +   QC  I +    E V D      C  NS C N  G  +C+C       PPN        D   +   CM     +C   CP   GQ        +  +C C +G+             D           C P  C  NA C  +   Y+C+C         YEG     VG   C            D C G    C +   C+       CSC  GY+ N+              +      CG + IC       +C+C  G+  NP    C+   EC   S C     CIN+                     S  C CP N  G+P  +C E +       CQ        +        +C+  E +IN +C      V+Q C++     CG +A C+  N +A C C   +YG     C+           C ++  C N     +  C                   + C  S  CA    C   +    C C +G+ G+   +C +        GC  D  C  N                    +C+        G + C   AIC    N   RC C DG++G+    C        DECA          ++  NC    +C   N +  C C     G+ AV  D +      C    EC S             + T+ C +NAIC+  +     T  C C  G+ G+  +                 C D + C+ G         + C+ +A C+ +     C C   T G+  T C +  E K   G     EC     C NK       CQ              PC   N C  N  C    +NS  IC C   +  +     P+ +C                    +K ECK   +     TC ++N  DP +     Q    +G  CL      VC C                        + E  +  N  C+P+   ++CA+      R+ +   +C      +   QC    +     C+   +C  K+ +C N    +     +VC           ++ CT  +   +  M C   GD      TD S  C  +T  K      + + C + + C       A +   C   A+C+      +C C  GF G+    C  T               D CP RD +              C  G+YC++      C C  GY  + Q  C+   DV    C    +C + ++           C   AECT  +   +C C    +G+ +       C   +EC+              L +  C LN + C   ++  N   P            +  C + Y     + +    NEC++P    N C +NAIC   +    CRC     QLP G              C +  +C  K         D CS+ S C   A              C+C                P      E++ +C D +     +C NP +C +  +++C        C C  GF                G C+          IN CLI + CG N+ C    +   C C +G R  P   C +I
Sbjct: 14953 QDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQP-SPC-GANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQP-SPCGAN-SQCRESQGQAICSCLPEFVGTPPSCRP--ECVISAECPA-DRACINQ------KCQDPCPGACGLN----AQCHVRN---HSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINA-----ECPSNLACIN-----------------EKCRDPCPGACGFA--------AQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGC--RPEC-VLNSDCPRNRACVNQK----CV------------DPCPG--HCG-----LNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVD---PCP-------GKCGLNAVCQAI-----------QHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMN---QKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGV---CGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRP--ECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCR------------------NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYL-------LGCRSDGECAAN-------------------EACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIK--TGCTHDSECQPTTACINK------RCQD-------------PCAEANPCAGNAEC--RVQNSRPICFCPAGWGGD-----PQVQC--------------------YKPECKINADCPYDKTCLNENCVDPCT---HGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKL-ACINERCADPCATPHVC---------TPQQTCTVLDTLPKRAMACKCPGDTV----TDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCP-RDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALN-AECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDC--ASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCP---DQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGT--NAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI 17096          

HSP 18 Score: 78.9518 bits (193), Expect = 2.279e-13
Identity = 50/122 (40.98%), Postives = 66/122 (54.10%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +ECS   + C   A CTNL+  +RCDC  G+ G G +E       C+D DECA   C   +DC NT GSF C C  G+       C D++EC+ N+  C   A+C+N  GS+ C C  GF
Sbjct:  255 DVDECSYP-NVCGPGAICTNLEGSYRCDCPPGYDGDGRSES-----GCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 19 Score: 77.411 bits (189), Expect = 6.058e-13
Identity = 55/166 (33.13%), Postives = 79/166 (47.59%), Query Frame = -1
Query: 15605 DPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGD 16102
            D N+ C    +C N+    E++C C  G+E    +C DIDEC   + VC  +  C+N  G+Y C C+ G+VG+         CE     C A+A C        C+C++G+  N    S +    V+ D+ +       SC Q ATC + A G FTC C  G  GD
Sbjct:  543 DVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCED--VRCGAHAYCKPDQNEAYCVCEDGWTYNP---SDVAAGCVDIDECDVMHGPFGSCGQNATCTNSA-GGFTCACPPGFSGD 702          

HSP 20 Score: 75.8702 bits (185), Expect = 2.070e-12
Identity = 404/1793 (22.53%), Postives = 620/1793 (34.58%), Query Frame = -1
Query: 2261 LHQCGENAEC-IDTDGGYYCQCKTGFTG----HCD--ECRDIDECAFSLNNCDSDR----------ATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSR-----SHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDG----SFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI-NCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVC----PKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVC---MAVPLSQCNQS---CPTGQYCNNGSCSCLMGLNSQTDD-DGNLNCSKNSASCLP----GICPLNANCEERLFGYICKCKPGYEG-------VGIKS----CRDIDECGGKINNCTINEDCSNT-------EGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH--GICGPNYICQCKSGYEINPSGMCQD---VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEK-ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECS----NGDVSCPNNSFCQN-----------------KDGSFHCACNVGFQ------------RLENALVTDS-CTD---IDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC-RIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQ-GDGYNFC--NDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDED-----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL---------ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR-INGSCVDVDECADKIDSCKNNATC----NNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCL-NTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIE-----------TDSC------PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKS--------ACHKFAECTNNDGAYV------CTCPSYLTGDGKTTCEDQNECAL-----------------------ETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQ-----ICLNKNECLNPVENDCV-ENAICIDT-EGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELIN 7072
              QCG  A C  D +    C C  G+ G     C+  ECR  DECAF L  C ++R          A C        CRC  G+SG+ +V    D        C+      S   CF    G EC+                N C    + C  NA C   D     + +C C  GY+G       +E   + G   C  +  C ++   C+ G  N  N C++   C        +A C+      IC C E   GD   NC++        +I+  CT    +D  C         +  C ++RC++ C    P          +    C        D        EC  N D C  +  C N           N +D    G+V     A  L+Q +Q+   CPTG    N   SC+ G     +D   +  C + +  C P      C LNA C  R     C+C+PGY+G       + +K+    C    +C  K+    INE C++            TC+      + + +  C  + V +   +   I  P  I  C+   E   + +C +   ++ C+ +  C + AQC       +C CP+ F G+P+            ++C   EV    +    C +   C   +I  N  C+     C   +CG  A+C ++  +A C C  GY G+  E C+   +           CP+N  C N                 K+    C C  GF             R ++    D  C +   I+ CL S+ CA N EC        C C  G  GD    C R++        CH D  C  N+     EC          ++ C + N         C +NAIC+ +     C CPD    G+ Y +C    ++    D+  +C S   C++   Q             D C  +  C  + T +CS   +      T  C+CAE                + V + S     +  P    CE       +   C D++     +C+ P        C  NAVC+       C CQ G++G  +   +   C V   C + + C   N + +  C       L ND C P  EC  +++       +  + +P  +C       ++G  C   N+C PT      ++C+         A    C       VC C  + +      C+P       LD       DC              G Q  IN  CVD   C   ++ C+  A C     + + + +C CPD     +S+     +  C+  P I  ++  C+ ++D   +  C+     +  NC    EC IK H                C C+ GF G+  + C +           T  C      PA    +C + + C  I +   C C  G+  + ++ C        C   DEC T K+         C   A C  ++   V      C CP   T  GK  CE +    +                        T  C +N ++C ++ +T+ V     C C  GY   P  Q     +C+ +   +  V+  CV      +D  E    CR + GF+   SG C    E            +  D+    +C    G++ +       E+  ECT+   C+   +  C               +L    C D   CL    CG N+ C        C C  G    P+  C   N
Sbjct: 16090 FTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLA-CRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAV--RCDLVPTQPEGCTMDAECPSKLACF----GGECK----------------NPCDVT-HPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQG---CTSHDQCQDTE-ACRGG--NCVNPCLDASPCAR------SAQCLAQQHRAICSCPERTQGDPFTNCYEPP------EIKTGCT----HDSECQ-------PTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINAD-CPYDKTCLNE----------NCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ-GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLA--CINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPR------------IECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICI---SPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLE--------CHSDYDCASNLACVSNEC----------VSPCGQRN--------PCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDD-GDCPSKLACIDDKCQ-------------DPCSVLSPC--HPTAQCS--VLNSVPVRTMVCECAE----------------YEVPDASGACRKMMPPRLPGCE-------SDQDCPDQEACIHAQCRNPCN------CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACI--NGDCINPC-------LINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCR------VIG--CSSNNDC-PTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDT------DC-------------PGRQACINEQCVD--PCV-VLEPCQRPAICEVTPTSPVRTMLCICPDGY---VSR----GKGGCKPTPGI-KEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDH-------------KPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACT----PLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPG-TVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVN-AFC-SVRDTLPVRT-MICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALE----------RGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCAD--NRFC---------------NLDTKTCED--PCLT-KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTN 17627          

HSP 21 Score: 70.8626 bits (172), Expect = 6.211e-11
Identity = 47/128 (36.72%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9260 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA----LLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRG 9631
            D NEC      CD+ A+CTN    F C C  G++G        NG  C D DEC       +C   ++C N P  F+C C  G+      +C D++EC  N   C  NA C NT G+Y C+C  G+ G
Sbjct:  129 DENECKQ--RPCDVFAHCTNTLGSFTCTCFPGYRG--------NGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG 245          

HSP 22 Score: 67.781 bits (164), Expect = 5.276e-10
Identity = 54/148 (36.49%), Postives = 76/148 (51.35%), Query Frame = -1
Query: 9176 CDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG----DCEAVAICGCWGDPHCLSFDGNW 9598
            C  +A C NL + F C C  G++G G  E+      C D DEC   + C   + CTNTPG++ C+C  G+V   P    C D++ECS   ++C   A C N  GSY C+C PG+ G G       D +  A   C  +  CL+ DG++
Sbjct:  181 CVENAECCNLPAHFLCKCKDGYEGDG--EVL-----CTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSF 320          

HSP 23 Score: 66.2402 bits (160), Expect = 1.512e-9
Identity = 165/726 (22.73%), Postives = 245/726 (33.75%), Query Frame = -1
Query: 6296 NENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGD----------GIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT-----CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKN---------YAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPG-CDGDNPCNTVQCTKPNEICYLGQCFCKHGFQN---NVTTNICEDIDECDTAANDCA----GRKAKCANLDGSYECECLYGYR----------MSSXXXXXXXX----XXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGH----CDECRDIDECAFSLNNCDSDR----ATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRSHQ------------------FCFNVNGGFECRCLSGYKSDTNGSC-------VDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVN-----------------------STCLCKSGY--------------ENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYD 8122
            N  C     C  E  Q  C   +C  +AFC   +    C C +G+ GD           I  + +  C    S C  NA C+   G+ SC+C   + G+  +     C   ++C     C N  ++C D  PG                 C    +C  + +L                C C  G+  +P  S  C ++ +     E D+N         Y++C    G   C+C  G+ G   NC    EC  +  C + +  C N       +C+D  PG C  +  C  +         +   C C  GF     N  T I  +    + + N C     G  +KC ++ GS  C CL  Y           +SS +                +  CG ++ C        C+C  G+TG     C   + I     + N C+       A C    G+ +C C   Y GD  S C    EC+    +C RS                     C  +N G  C C  GY  D + SC       +    C+   + C   + C++T+   +C C  GYIG+  +C P+  +       CP N  C+N                         C C+ G               +N  N C+        + C  N+ C        C CN GYIG    C  + T+ D CQ    C    C D
Sbjct: 10528 NTECPANLACINERCQDPCPG-SCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPC--QPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVN--QKCVDPCPGV----------------CGLNAQCRVSNHL--------------PSCSCLAGYTGNP--SSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRP--ECIISSDCAQ-NLNCQNQ------KCVDPCPGTCGIEARCQVIN--------HYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRP--ECVQN-DDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK--PSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSS----ECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCV-------PSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVD 11183          

HSP 24 Score: 65.0846 bits (157), Expect = 3.607e-9
Identity = 63/198 (31.82%), Postives = 88/198 (44.44%), Query Frame = -1
Query: 15770 VDSCHLRDTSGCVCNDGFLRSGTT-------CTPKEQCG----CYDGDNNYKA------VGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEG--RADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16300
             + C+L     C C DG+   G         C   E CG    C +   NY        VG+  + + C   + CS        PNV C     C N    G   C C  GY+G  R+++ C D DEC+R    C  N DC+N  G++ CLC  G+ G+ +N C D +EC +    C   A C N  GS++C C +G+
Sbjct:  185 AECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-------PNV-CGPGAICTN--LEGSYRCDCPPGYDGDGRSESGCVDQDECAR--TPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 25 Score: 61.6178 bits (148), Expect = 4.105e-8
Identity = 54/160 (33.75%), Postives = 81/160 (50.62%), Query Frame = -1
Query: 13910 DCNKDG------ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKLFCLGDADCAKSGKCFQN----------LCSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGD 14341
            DC+KDG       C  G CHC  G+ G    NC + +E   +  PC +  +C++T GS++C C   + R N   C++   C    D A + +C +N          LC C  G+EGDG++LC   +     N  NC  +A CT+  G+YTC C +G+ G+
Sbjct:   96 DCDKDGTKCTHGACLNGVCHCNDGYGG---CNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGY-RGNGFHCEDIDEC---QDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLC--TDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN 246          

HSP 26 Score: 60.8474 bits (146), Expect = 5.546e-8
Identity = 64/220 (29.09%), Postives = 89/220 (40.45%), Query Frame = -1
Query: 9224 PCGLKNGCAGILGESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD---PVNSLVIGSLMCSSSKIDFNECST--NFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG-DCEAVAI 9865
            PCGL   C  + G       S QC C     S    +     ++   P+ +  L   P A    P        L C    +D +EC+       C  +A C N    +RC C  G+QG G    Y +   C + +EC    C   + CT+T GSF+C C   +       C DI+EC+     C  +A C NT   Y C C  G+ G  +P   CE V +
Sbjct:  347 PCGLGAECVNLGG-------SFQCRC----PSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLAC----LDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQG----YLH---CENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV 544          

HSP 27 Score: 60.077 bits (144), Expect = 9.389e-8
Identity = 149/660 (22.58%), Postives = 224/660 (33.94%), Query Frame = -1
Query: 4382 DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLS----QCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKL----------------------SLYGSVCEKISCNSS---EILINN----ECLP--------VNQVCQNIN------CGNHAFCKIENGRADCFCDSGYYGDG-ELC----VDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQ-------RLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGK-------YDCRIDSKCEKY-------------GGCHEDASCIVNVESSIYECQCHTEFSGDGITSCI-----KNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL 6100
            D C  N++C N   + DC C     D F+        P      Q N+ CP  + C+  +  C+              C ++S       C  NA C     G  C+C PG+ G     C            C  + +C +++      C               ++ C CG++ +C       +C+C  GY  NP   C    +    +PC + A C    G+  C CP+   G+P   C  +  +     C     C+                        L  + C+   C  +    +L N      CLP        +    + IN      CG  A C   +    C+C     G+   LC    V ++ C  G   C  N+ C        C C  G+        R  +  V D     + C  + +C   G+     G   C C DG  GD         Y+C++D+ C                G C + A C V     +  C C++  +G+    C      K N C     S C  N+ C+ +N    C C  G+ GD  + C    EC              +NS+      CGD    ++  CV  D C+      C  NAIC  ++ T  C C +GF GD  L
Sbjct: 8295 DPCATNAVCINSNHAADCSC----ADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINP------------CQEDS-------CGENAECIPVNHGTECRCLPGFLGNAYVQCL-------PSQGCRSDSECDSSQACINGKC---------------SSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICD-SSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPG--PCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDP----NPCGPNANCVVAGD-----GQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV--CSCNSGLTGNPGIRCYALDHPKKNPCV---PSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQ--PECD-------------INSD------CGDTLSCINHKCV--DPCAG---AICGINAICNVRQHTPVCLCLDGFVGDAFL 8866          

HSP 28 Score: 60.077 bits (144), Expect = 9.790e-8
Identity = 47/164 (28.66%), Postives = 64/164 (39.02%), Query Frame = -1
Query: 9275 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGG-----------------------NEMY------------SNGRSCIDDDECALLKCP-----STSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTY-GSYICNCK 9643
            SS +D +EC T+   C  HA C N    + C+C  G+ G                          NE Y                 C+D DEC ++  P       + CTN+ G F C C  GF     + C D++EC   +S C A A+C+N   G Y C C 
Sbjct:  576 SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCP 739          

HSP 29 Score: 59.6918 bits (143), Expect = 1.279e-7
Identity = 66/201 (32.84%), Postives = 96/201 (47.76%), Query Frame = -1
Query: 9089 GSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVK--AAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGD-CEAVAICG----CWGDPHCLSFDGNWLHYQGRCK--YTLVRDECRNGLPIESSTANF 9661
            G ++C+    D +EC  N  +C  +A CTN    + C C  G+ G   N  Y  G  C D DEC+    C   + CTN  GS+ C+C  G+     + + C D +EC+   + C  NADC+NT GS+ C C  G+  SG+P + CE V  C     C     C++  G+   +Q RC   + L  D   + LP   +T   
Sbjct:  206 GEVLCT----DVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG---NNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA--RTPCGRNADCLNTDGSFRCLCPDGY--SGDPMNGCEDVDECATNNPCGLGAECVNLGGS---FQCRCPSGFVLEHDPHADQLPQPLNTQQL 389          

HSP 30 Score: 58.9214 bits (141), Expect = 2.258e-7
Identity = 51/206 (24.76%), Postives = 84/206 (40.78%), Query Frame = -1
Query: 15575 VQCHEYGECFNSTASGESECRCKKGYEGRA-DNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGS---ICSQIPIIAVNPDQTNCSFHQD----------------ASCDQLATCVDHAD------------GSFTCDCTEGSFGDGLQGANQTGC 16093
             +C    +C N    G   C C  G++G+   +C +I+EC      C +N  C + +G++ C CK  + G+    C D +EC +    C  +A C NT   Y C C  GY+G       C Q+ +  +     +C+ + +                +SC  +  C  HA+            GS+ C+C  G  G   + A +  C
Sbjct:  424 AKCGTNAKCIN--FPGSYRCLCPSGFQGQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPC 625          

HSP 31 Score: 58.5362 bits (140), Expect = 3.025e-7
Identity = 43/128 (33.59%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9257 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSF--ICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGS 9634
            +D +EC+     C  HA C N   G+ C C +G+ G    ++     +C   D    + C S  DCTN        C C  GF     + C DI+EC  ++ +C  +A C+NT GSY C C+ G+ GS
Sbjct:  496 VDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKV-----ACEQVD--VNILCSSNFDCTNNAECIENQCFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS 615          

HSP 32 Score: 57.7658 bits (138), Expect = 5.252e-7
Identity = 217/957 (22.68%), Postives = 314/957 (32.81%), Query Frame = -1
Query: 1133 SSKDSSYTCQCIEGFQ---RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCE-----DIDECAIKT----HPCHDLARCSNVPGSCKCK-------------CQPGFTGD---GIYSCIETDSC--PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRK--SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNP-VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENIN----ECEEKSD--------NCSINSVCQDKADGFS---CQ---CKPGFKWSDE-------TNLNCED-------------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPN-SCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLAD-NCDQVNGHCINTVGGFQ-CYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPG-SFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSG-----------------------GKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA------ICGPNSCLPGQLCQIVNGNQYDCGC 3658
            +++     C C  GF    R+   C  +D C D    C   A C N  GSY C CP  L  D   + C    EC+ N   C   + C  T+G  +C+ V      G N E      + +CA ++     P   +A C  +P  C+               C+P    D   G +   +   C  P      C   + C M  +   C+C  G+   +  EC+     C  +C     C        CH   EC +N+          L G    TC   N+C L  H C  N                + CH  +       ++ C N ++C+NP +EN C  NA C  +     C C       P+ +   +     EC E  D              +C D A   +   CQ   CKP  +  +E         LNC                     +D C +PT+C +  H  C       +C+CP G             C +P  +CG+N  C +    +  SC    R   + +C     C+     C+ +   D  C                      Q+CEN   Q  C  ++ SC A++  CV+     KC   P  +    G C D                   C+    G  C CP  F+ +      +  C L       D  CD+   +C       + C C +     +   KC    +C     C  G C  + G      C      VNGKC+D   C+N  + CG  A  +C  +     C C  GYE                          GK  NPC     C        +NAQC       +C C   +  +    CR +        C   + C +  G Y+C C  G  GD    C         C    C     C ++  NQ +C C
Sbjct: 2726 TTEHHQQVCHCQPGFSGDPRVR--CDVIDFCRDA--PCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKC--------LKGSCMLTCRVDNDCFL-GHVCLHNKCV-------------YGCHVDDDCS---ASESCRN-DKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAH--CQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQGKCRN--DQNCLADERCMRGT--CRTVCNTDEACAQG-------------------QICENRMCQTGCRTDL-SC-ATDEACVNK----KCQ-NPCRTPGQCGQCAD-------------------CLVVNHGVQCQCPAAFMGDG-----LTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGAC--IAGCKSNGDCAADQSCVNGKCSD--PCANE-KACGRNA--LCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACG-------TNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYC 3576          

HSP 33 Score: 56.6102 bits (135), Expect = 1.242e-6
Identity = 52/166 (31.33%), Postives = 78/166 (46.99%), Query Frame = -1
Query: 13892 AKDSDCNKDGEC-----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLN--NGTCQNKLFCLGDADCAKSGKCFQNL-----CSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDGTHDCH 14353
            A  + C ++ EC     HF  C CK G++GDG   C++++EC N  N C  N  C++T G+Y+C+C   +V  N     CQ+   C     C     C  NL     C C  G++GDG+       +        C  +A C +  GS+ C C +G+ GD  + C 
Sbjct:  176 AIAARCVENAECCNLPAHF-LCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICT-NLEGSYRCDCPPGYDGDGRSE-SGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE 337          

HSP 34 Score: 56.6102 bits (135), Expect = 1.242e-6
Identity = 41/119 (34.45%), Postives = 57/119 (47.90%), Query Frame = -1
Query: 15875 TPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD-NCTDIDECS-RGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN 16225
            TP+ QC      + YK VG+      CS+   C                  EC  S A G S C C KGY+ + D +C D+DEC  RG+ +C+    CVN+ G+Y+C C  G+ G+  N
Sbjct:  963 TPECQC-----QSPYKLVGNSCVLSGCSSGQACPS--------------GAECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYN 1061          

HSP 35 Score: 55.0694 bits (131), Expect = 3.871e-6
Identity = 154/630 (24.44%), Postives = 211/630 (33.49%), Query Frame = -1
Query: 6371 CDSNAFCKNTIGSFSCSCKEGFEGNGV---------TCTNINECYPLSPCDNATEECFDK------------VP---GYECRCQKGFMKNT-----------TTGNCDDRNECAD----------TGNLCDRVSTNCNNTFGSYRCDCKYGFRP-----SPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG-RNC-TDIDECSSNKVCQRPDATCVNLPGSYECRCL---DGTP---GCD-GDNPCNTVQCTKPNEICYL-----GQCFCKHGF--QNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQ---CGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV--------------CSEIDECL-------------LGLH-NCSRSHQFC-----FNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLE-------ECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI 7930
            C +NA C N+  +  CSC +GF+GNG           C    +C P   CD     C +             +P   G ECRC  GF+ N            +   CD    C +             LCD V     N  G  +C   Y   P      P D     D N C L   C+ +        G+  C C  G  G+  +NC  + DEC+ N     P++ C  + G+  C CL   +G P    C+   NPC+   C  PN  C +      +C C   +    N      E I+ CD   N C G  A C   D S    C              +       L Q   CG NAEC        C C++G+ G   + CR+        N C  +        G   C C +G SGD +               C     C+              G H      H  C        N G  C  L   K         +N C    + C  N++C   +   +C C  GY+G     DPQ G +       +CG  L      C+N  C+               D C     C +NA C     + +C C +G++GD  
Sbjct: 8297 CATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVV-----NHRGVCKCPPGYNGNPKVGCSPPQDPC---DPNPCGLNALCELDN-------GNPICYCPKGLTGNPFKNCIPEGDECTPNPC--GPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPC-GPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCD--PNPC-GTGAIC---DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPK---------KNPC--VPSPCGRNSECKLLNNRAVCSCIPGYLG-----DPQSGCQPECDINSDCGDTL-----SCINHKCV---------------DPCAGAI-CGINAICNVRQHTPVCLCLDGFVGDAF 8865          
BLAST of SMED30010561 vs. Ensembl Fly
Match: dpy (gene:FBgn0053196 transcript:FBtr0332348)

HSP 1 Score: 330.102 bits (845), Expect = 3.905e-89
Identity = 496/1833 (27.06%), Postives = 705/1833 (38.46%), Query Frame = -1
Query: 1130 YLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLN-CSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS--------------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLC-FVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG---LLCHDIDECKFGVAN--CSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPC-DVPNACKANQTCTPSNENSLAICECKPDFKLENDT-----CIPKTECE---NKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT-CQDKNECDPTSPDFAAQKCLASGGGCLNTK-GSFVCTCNQEQMNENNSS--CKPIDSCAMGLD-------------------------------NCDRKVEDCISSKDSSYTCQCIEGF---QRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNEC---QENPMICGDLSKCLNTDGSYECQCVTGYKWNGTN--CEDIDECAIK--THPCHDLARCSNVPGSCKCKCQPGFTGDGIYSC--IETDSCPARDDVK----------------CPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKF-AECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEN-DCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQ-VLNGADSVCYDLPIGYACVCPDGFVNDEVFP------------------QVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDE-------------CEISEQSNMKFCN--------------------------NGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRG---------------FVMIENSTKCVDIDECQFPNSCLDGLCNNL-------PGSF----ECLCNIGY-----DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGY----QEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVNGNQYDCGCV 6031
            YL +F   K+C                   +G+  C +G +  + +    N C K+   C  G C LN          +C C  GY G    +C D DE   K   C +   C+NT GSFTC+C  GY  N               ++   E    CN  +H      ++C+CK GYE +   +C DV+EC+    C   A C NTPG+Y C CP+ + G+                         + Y   C+ +          +EC   N       CG  A C    G   C C  GY GDG     CVD DEC+     C  N+ C N DGSF C C  G+    +    + C D+DEC  +  C    EC N  GSF+C C  GF+ +  +D   D   +            +       +   +   SG G+ +C+  + C   +G + C  NA C     +YRC+CP GFQG GY  C +I+EC ++    C     C ++ G + C C     Y  D    CVDIDEC++     C  +A+C+N    Y+C+C +G+ G     + C  +D      +N  C+ NA CI       C C  G    G++C D DEC+       A  C  +A C N    Y CEC++GY G+      + PC DV   C A+  C P    +  +CE   D    N +     C+   EC+       +C  + + C     GF C C PGF+   ++ C D +EC        A KC A G  C+N   G + C C    + + + S  C PI SC+   D                               NC    +  +++  +   C C  G+     + G C D+DEC  + + C   A C+N  G Y+C+CP     D  ++ C           NP   G+     +  G+  C C  GY+ N  N  C+D+DEC+++     C   A C N+PGS +C+C  G  G+    C    T  C  +   K                CP+G+ C ++ G   YC C  GY+      C+         D+DEC  R +    F A+C N  G+Y C CP    GD          CAL    C  +     N       + P +C C   Y   P      + N+C +P E   C  NA C  ++   +C C++GFK  P   C + +EC      C+  + C +K  G+ C C P     D     C  I E       S  P S C++N       C    +   G C      L+   CG N+ C        C C  G  +  +GDC         + +CQ V+ G  ++C     G  C CP G + +  FP                  Q+C N   +  CE  +    A+   C    G  KC+C+P F  N D  C+   E             CE     +   CN                          N +C       +C CP+GF  N Y  C DVDEC        A+    +N  C+N  GGF+C C  G               F    N  +C +  EC    SC  G C NL       P +      C+C +GY     D V+G C+   +C N++          C+++   FQ           GK    C  V+ C K  I C  NA CV   +   CIC DG+       Q+G        + ED C    DC      Y C        +GI  C  +C    C P +LC+I       C C 
Sbjct:   64 YLQLFNLSKLC-------------------DGTQDCFLGADELSKELKCTNDCDKDGTKCTHGAC-LNG---------VCHCNDGYGGC---NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAH------FLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN-------------------------NPYREGCQDV----------DECSYPNV------CGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECAR--TPCGRNADCLNTDGSFRCLCPDGY----SGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLE--HDPHADQLPQPLNTQQ------LGYGPGATDIAPYQRTSGAGL-ACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDN---PCGENAICTDTVGSFVCTCKPD--YTGDPFRGCVDIDECTA-LDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN----QCFCLDGFEPIGSSCVDIDECRT-----HAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV--RCGAHAYCKPDQNEAYCVCE---DGWTYNPSDVAAGCVDIDECDVMHGPFGSCG-QNATCTNSAGGFTCACPPGFSGDPHSKCVDVDEC-----RTGASKCGA-GAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQ--CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCV---------DVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAY-----NGLCALAQRKCAADRECAANE----KCIQPGECVCPPPYFLDP-----QDNNKCKSPCERFPCGINAKCTPSDPP-QCMCEAGFKGDPLLGCTDEDECSHLP--CAYGAYCVNKKGGYQCVC-PKDYTGDPYKSGC--IFE-------SGTPKSKCLSNDD-----CASNLACLEGSCVSPCSSLL---CGSNAYCETEQHAGWCRCRVGYVKNGDGDC---------VSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNP-FPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGAT---CDRNNG--KCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHG-CSIRGQCGNDAD---------CLHSEICFQL----------GKGLRKC--VDACSK--IQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDC---SRGYGCQASV----NGIKECINLCSNVVCGPNELCKINPAGHAICNCA 1673          

HSP 2 Score: 309.686 bits (792), Expect = 5.611e-83
Identity = 414/1421 (29.13%), Postives = 571/1421 (40.18%), Query Frame = -1
Query: 4415 GQLECTNI-------TCSNDAFCDFKDDDYGCHCKNGFMGDGIM---CKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVT---CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGF----------RPSPIDS----------------------FVCTDVNECNL---VHECDKNYAKCTNTPGSYYCTCDSGYQGDG-----------------------------------------RNCTDIDECSS-NKVCQRPDATCVNLPGSYECRC---LDGTPGCDGDNPCNTV----------QCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE----CRDIDECAFSLNNCDS--DRATCENSIGSFTCRCNEGYSGDG-SVCSEIDECLLGLHNCSRSHQFCFNV-NGGFECRCLSGYKSDTNGS--CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCV----NSTCLCKSGYENST---NQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-----DCYDG--ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN--ENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGY-ICKCKPGYEGVGIKSCRDIDECGGK-INNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLC-----------------------------------ETNNVCN-------CGSHGICGPN--YICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYY--GDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCA-----TNGECQNT-------IGSF------KCECKDGFIGDGKYDCRIDSKCEK-YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSC--IKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG-AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQ 8080
            G++ CT++        C  +A C     +Y C C +G++G+      C+D+DECS   +VC   A C N  GS+ C C  G++G+G +   C + +EC   +PC     +C +    + C C  G+  +   G C+D +ECA T N C  +   C N  GS++C C  GF           P P+++                        C D++ECN    V +C  N AKC N PGSY C C SG+QG G                                         R C DIDEC++ +K C +  A C N    Y C+C    DG P  D    C  V           CT  N  C   QCFC  GF+   ++  C DIDEC T A  C G  A+C N  GSY CEC  GY  S     C+   E +    +CG +A C       YC C+ G+T +  +    C DIDEC        S    ATC NS G FTC C  G+SGD  S C ++DEC  G   C    + C NV  GG+ CRC     +D + S  CV    C   ++ C  N+ C   D +  C+C    IG+       +    C  L C  +A C+     + CLC  GY  ++     C + DEC +   C   A C +T G ++C C  G  GD        + T  C   N C  G     D Y G  +C C  G+         ER                            +S++ QC D+DEC+       C  N++C N  GSY+C+CP  +     +G      P   C       + CN   C C        +      CS   A      CP  A C     G   C C  GY+     SC D+DEC  +    C     C N  GS++C C  GY  ++ +GLC                                   + NN C        CG +  C P+    C C++G++ +P   C D +EC +  PC   A C+N  G Y+C CP+++ GDP       +  T   +C + + C  +L    C + SC S               C ++ CG++A+C+ E     C C  GY   GDG+    V +C   DV C + + C        C C  G  +L N     SC+  D+C  +  C       NG C+         IG+       KC C+  F+G+    C    +  K   GC E+A C   +  S   C C+    G+    C     N+C  N   SC  NA C  V     C+CP GF G+ Y  C D+DECAN     C     C+N  G + C+C  G A      C  I+       NKC  N   +  EG YSCQ
Sbjct:  206 GEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA-RTPCGR-NADCLNTDGSFRCLCPDGYSGDPMNG-CEDVDECA-TNNPCG-LGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTN-AKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQ-HAVCENTVPGYNCKCPQGYDGKP--DPKVACEQVDVNILCSSNFDCTN-NAECIENQCFCLDGFEPIGSS--CVDIDECRTHAEVC-GPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV----RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAE-CVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANED-CPGNSIC---DATKRCLCPEPNIGN-------DCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN-PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGY---------ER----------------------------NSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGH-----NGN-----PFIMC-------EICNTPECQCQSPYKLVGNSCVLSGCSSGQA------CPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDEC-SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNL---ACLEGSCVSP--------------CSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQ--DVICGDGALCIPTSEGPTCKCPQG--QLGNPFPGGSCS-TDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQS--RCACNPGTFGNPYEGCGAQSKNVCQPN---SCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECAN---KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEG-YSCQ 1500          

HSP 3 Score: 295.049 bits (754), Expect = 1.422e-78
Identity = 427/1505 (28.37%), Postives = 591/1505 (39.27%), Query Frame = -1
Query: 3707 ECNLVHECDKN----------------------------------------YAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQR--PDATCVNLPGSYECRCLDGTPGCDGDNPCNTV-QCTK-----PNEICYLGQ----CFCKHGFQ-NNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTG-HCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGY-----------------------------------SGDGSVCSEIDEC--LLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIG-----------------------------SGRNC----------DPQEGLEEC-------GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTS-CDVNANCIDTHGSFICYCNEGYIGDGINCF-KKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNK----CFD-ERCENV------CPKNAXXXXXXXXXXXXXXXXXSLSSDS-SQCIDIDECNENVDDCQENSICFN-RFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGN----LNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS--CRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGP-----------NYICQCKSGYEINP-SGMCQDVNECQTQ---SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFC-KIENGRADCFCDSGY--YGDGELCVDVDEC-SNGDVSCPNNSFCQNKDGSFHCACNVGFQRLEN----ALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFY--GDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCG--DEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNA---CKAN------QTCTPSNENSLAICECKP--------DFKLENDTCI--------PKTECENKTDNCDRETS-----NCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDS 7567
            E    ++CDK+                                        +A CTNT GS+ CTC  GY+G+G +C DIDEC    +  R   +A C NLP  + C+C DG  G DG+  C  V +C       PN +C        C C  G+  NN     C+D+DEC +  N C G  A C NL+GSY C+C  GY     ++      +       CG NA+C++TDG + C C  G++G   + C D+DECA   NN     A C N  GSF CRC  G+                                   SG G  C +IDEC    G+  C  ++  C N  G + C C SG++      C + NEC+  DN C +NA C +T GSF+C C+  Y G                              G NC          DP+   E+            C  NA C+ + C C  G+E   + C++ DEC +    C  +A C++T GS+ C C  GY+G       K+  +   C    YC   D  +  C C  G+ +  +     C D + C+ +      C +NA  + ++ +   +C+     S D  S+C+D+DEC      C   + C N   G Y C+CP N +        C+ +     N+ CP    C + +  CL    +  +D  +    LNC  ++   L       AN + +     C C PGY G    +  C DIDEC  + N C     CSNT G + C C  G S +     C T+    C     C             N +C C+ GYE N  +G CQDV+EC  Q     C + A C N PGSY+C+CP+   G+P   C  + C T   QCQ+       L G+ C    C+S +                  C + A C  I  G + C C  GY    DG  CVDVDEC   G   C   + C NK GS+ C C  G+Q        AL    C    EC  +E C   GEC          C   +  D + + +  S CE++  C  +A C     S   +C C   F GD +  C   + C       C   A C      Y+C+CP  + GD Y     I E     +  C S + C +     N  C +G+         +  CSS     C SNA C+ ++    C+C  G+   GDG     + +C+  +  C + ALCI       C+C  G LGN    G    D+C        A  C E  +C N      CE        G  C     CD  N    C+ N        C P  E +    +C P        ++ L    C         P   C  ++ N  +  S      C  +     C C  GF+  GN    CQD +EC        A K       CLN  G F C C         SSC+PI+S
Sbjct:   90 ELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEG-DGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDEC-SYPNVC-GPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECART-PCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECA--TNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCG-TNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ--DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKP-DQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNA--TCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSIC-DATKRCLCPEPNIGNDCRHPCEALNCGAHAQCML-------ANGQAQ-----CLCAPGYTGNSALAGGCNDIDEC--RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMC--EICNTPECQCQS----PYKLVGNSCVLSGCSSGQA-----------------CPSGAECISIAGGVSYCACPKGYQTQPDGS-CVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECV---------CPPPYFLDPQDNNKCKSPCERF-PCGINAKC---TPSDPPQCMCEAGFKGDPLLGCTDEDEC---SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKS-GCIFESGTPKS-KCLSNDDCAS-----NLACLEGSC--------VSPCSS---LLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC---VSQCQDVI--CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCS------AARPCGERQICINGRCKERCE--------GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQA----KCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFS--GNPYIGCQDVDEC--------ANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIES 1476          

HSP 4 Score: 294.278 bits (752), Expect = 2.468e-78
Identity = 406/1435 (28.29%), Postives = 578/1435 (40.28%), Query Frame = -1
Query: 4268 CHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATE--ECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRN---CTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLG----------QCFCKHGF---------------------------------QNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGS---VCSEIDECLLGLHN--CSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEE-CGKLLCPLNALCV----NSTCLCKSGY----ENSTNQCINTDECESQT----SCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCP-PNYLDVFKDGKVCMAV---PLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKS-CRDIDECG-GKINNCTINEDC--SNTEGSFTCSCKRGYSRNSSSGLCETNNVCN-------CGSHGIC---GPNYICQCKSGYEINPSGMCQDVN--ECQTQSPCHIL------------------AQCINTPGSYK-CQCPENFYGDPQNKCFE-DKCKTKALQ----------------CQAGEVCKLSLYGSVC---EKISCNSSEILINNECLPVNQ-------------------VCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL-CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQ--RLENALVTDSCTDIDECLLSESCATN-----GECQNTIGSFK---------------CECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYEC---QCHTEFSG--------DGITSCIKNNLCFVNGK-------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGN 8008
            CHC +G+ G   + KD +EC      CD  A C NT+GSF+C+C  G+ GNG  C +I+EC   +      E  EC +    + C+C+ G+  +     C D +EC +  N     +  C NT G+Y C C  G+  +      C DV+EC+  + C    A CTN  GSY C C  GY GDGR+   C D DEC+    C R +A C+N  GS+ C C DG  G D  N C  V     N  C LG          QC C  GF                                 + +     C DIDEC+        G  AKC N  GSY C C  G++                  + CGENA C DT G + C CK  +TG     C DIDEC  +L+      A CEN++  + C+C +GY G       C ++D  +L   N  C+ + +   N     +C CL G++     SCVD +ECR     C  +A C+NT GS+ C C AGY+GS     P+   ++ C  + C  +A C      + C+C+ G+     +    C++ DEC+       SC  NA C ++ G F C C  G+ GD      K  D D           +C  G   C +G    +       C   CP N I                     S +C+ I  C+ N +DC  NSIC     +  C CP PN  +  +    C A+     +QC  +   GQ      C C  G    +   G  N   +   C    C   A C     GY+C+C  G  G   +  C      G    N C   E C   +  G+  C C++GY RNS +G C+  + C+       CG + +C     +Y C+C  G+  NP  MC+  N  ECQ QSP  ++                  A+CI+  G    C CP+ +   P   C + D+C+ +  Q                C   E  +   Y  +C   ++      E   N +C+   +                    C+   CG +A C   +    C C++G+ GD  L C D DECS+  + C   ++C NK G + C C   +     ++  + +S T   +CL ++ CA+N     G C +   S                 C C+ G++ +G  DC   S+C+    C + A CI   E    +C   Q    F G             C +  +C +NG+         C   A C++ N   +CIC   F G+    C    E A   +  C     C    GQ  C C  G              +  Q N C  NA C+      SC C +GF G+  + C D+DEC      C  NA C+N+ G F C C +G  GN
Sbjct:  114 CHCNDGYGGCNCVDKDENECKQRP--CDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEV-LCTDVDECRNPENC--GPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPG-AICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTP-CGR-NADCLNTDGSFRCLCPDGYSG-DPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQD---NPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECT-ALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIEN-----QCFCLDGFEP-IGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS----PPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDP---HSKCVDVD-----------ECRTGASKCGAGAECVNVPGGGYTCR--CPGNTIAD----------------PDPSVRCVPIVSCSAN-EDCPGNSIC---DATKRCLCPEPNIGNDCR--HPCEALNCGAHAQCMLA--NGQ----AQCLCAPGYTGNSALAGGCN---DIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDP-PQCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV--SQCQDV-ICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQIC-INGRCKERCEGVVCGIGATCDRNNG--KCICEPNFVGNPDLICMPPIEQAK-CSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDEC--ANKPCGLNAACLNRAGGFECLCLSGHAGN 1466          

HSP 5 Score: 293.123 bits (749), Expect = 6.140e-78
Identity = 654/2718 (24.06%), Postives = 941/2718 (34.62%), Query Frame = -1
Query: 1136 TNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGN-------------------------------------------GVTCTNINEC----YPLSPC-DNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKN-------------------------------YAKCTNTPGSYYCTCDSGYQGDGR---NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDG--------------TPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA-GRKAKCANLDGSYECECLYGY------------------RMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGY-YCQCKTGFTGHCD-ECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFN---VNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEG---LEECGKLLCPLNALCVNST----CLC---------KSG--YENST--NQCINTDECESQTSCDVNANCIDTHGSFIC----YCNEGYIGDGINC---FKKDTDTDACQIENYCTDGDCYDG----------ICHCPSGFV---FKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDD--CQENSICFNRFGSYDCKCPPNYLDVFKDGKVCM-AVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSAS-CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS-------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILIN-----NECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG-----------------ELCVDVDECSNG------------------DVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTD-------------SCTDIDECLL-------------SESCATNGECQNTIGSFKCECKDGFIGDG--KYDCRIDSK--CEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDG-FQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDI-DECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL---LCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQ-LDPG----FKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL-----ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMG--LDNCDRK---VEDCISSKDSSYT-CQCIEGFQ----------RINGSCVDVDECAD--------------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTD--GSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYS---CIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDG--------KTTCEDQNECA------LETHTC-------NLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLP-SGKCENINECE--------------------EKSDNCSINSVCQDKADGFSCQCKPGFKWSDET----NLNCED---------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGY-CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSEC-------VDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYN------NYDCIDVDECSLD--------QVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAA-----GI-----------------CINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKD---GYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI-------VSCKAICGPNSCLPGQLCQIVNGNQYDCG 8065
            +N  C+N+A C     +  C C +GF   G  C DIDEC  +  VC  +A C NT GS+ C C+ G+ G+                                              C +I+EC     P   C  NAT  C +   G+ C C  GF  +  +  C D +EC    + C   +   N   G Y C C       P  S  C  +  C+   +C  N                               +A+C    G   C C  GY G+      C DIDEC +N   ++  A C N  G Y C+C  G              T GC   NPC T +    +       C C+ G++ N     C+D+DEC       A G  A C NL GSYEC C  G+                  +          +     +   C   AECI   GG  YC C  G+    D  C D+DEC        +  A C N  GS++C C EGY GD    +    C L    C+   +   N   +  G EC C   Y  D   +   ++ C  F   C  NA C  +D    C+C AG+ G     DP  G    +EC  L C   A CVN      C+C         KSG  +E+ T  ++C++ D+C S  +C +  +C+    S +C    YC          C   + K+ D D     + C D  C DG           C CP G +   F    C  ++C    P                        +   CI+   C E  +   C   + C    G   C C PN+  V     +CM  +  ++C+  C    +C  G        N  T  +    C   S + C P  C  NA C        C C  G+ G     C+D+DEC  K   C +N  C N  G F C C  G++ N         S  C+  N C C     C   Y CQ          G C+++    +Q+ C   A C     +  C CP  + GDP +                 +V   S+ G       C  SEI         +C+     C  I CG +A C  E+ R+ C C  G++G+                  + C    +CS G                  +V C  N  C+  + + H  CN     + N +V+              +C D   C               + +C  N  C       +C+C +GF+G+   +  C+   K  C  +  C E  +CI +  +    C+     + D +                C   A+C   N   +C CP G F GD Y+  N          H+C   + C                 +   C D+ DE        C  NAIC  ++    CQC  GF GD L    C     C  G   C  +A+C   P    C+C    +G+  + G                C  +  C N D     +C +     G  C  Q PCD  NAC +N  C   N     +C C   F+  +DT           D C R  S C+  +D G    +  +C+    +     QD ++ +    +     CL     ASG  C+    +  C  N+E        CK   SC     L+ C        + + S D  ++ C C EGF+          R+   C+  ++C                K  SC     C   +   VC   +N    L+ + C     CQ     C   + C  T+   + +C+C TG+      C DIDEC     PCH  ARC N+PG+ +C C  G  GDG YS   C +   C   DD                          +N + CI    + KC+  D C+   + C   A C +     +C+CP+   GD         K  C D  +CA       ET+ C       +     C+  D+         C C+ GY  +    +C + NECL+     C   A C +  GSY C+C  G    P    C + NEC                     E+ + C +N+ CQ +A    C C P     D T    ++ C D               ID C+ P +C ++      N+ G   C C  G +      C  +  C     C Q S+C++ +    CS         N DC     CL+ +  CQ    ++S C              F ++     +C  + EC         S+SEC        D YG  KC          +  C+    C            N +C+  +    C C EGF  +        +C   D+CS D        +++ L       N  C        C+C  GF   +   +C  ID C+         C N  GS++C C  G   D  N  C    EC  N + C P AA     G+                 C+      QC C  GY+         C+ +    ++   CP+N  C D      C+       ++  Q G C   N C    +C   A+C+  +   +C C  G+ GD         V+C   CGP       +C  V  N  +C 
Sbjct:  550 SNFDCTNNAECI----ENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNAT--CTNSAGGFTCACPPGFSGDPHS-KCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEK--AICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGD----AYNGLCALAQRKCAADRECAANEKCIQPG-ECVCPPPYFLDPQDNNKCKSPCERFP--CGINAKCTPSDPP-QCMCEAGFKG-----DPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLAC-LEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCV---SQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARP----------------------CGERQICIN-GRCKERCEGVVCGIGATCDRNNG--KCICEPNF--VGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ---------KGQCKNLC---SQASCGPRAIC----DAGNCICPMGYIGDPHD-----------------QVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCV---DACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCK-INPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCR----PACDTV---------------KCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNR---------------MTHTCFDVCDE------ESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGT--CHPSAICEVTPEGPVCKCPPLFVGDAKSGG----------------CRPDGQCPNGD----ADCPANTICAGGVC--QNPCD--NACGSNAECKVINRK--PVCSCPLRFQPISDT---------AKDGCARTISKCLTDVDCGGALCYNGQCR----IACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKE--------CKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNC---LAGEICNSDRTCQPG---CDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECT--EQPCHASARCENLPGTYRCVCPEGTVGDG-YSQPGCSQPRQCHKPDDC-------------------------ANNLACI----HGKCT--DPCL--HTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKAT------CACYEGYQLV--NDVCEDINECLS---QPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTC-PLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGV--CSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCST--------NRDCISEQLCLQGV--CQGTCKSNSSCPQF----------QFCSN----NICTKELECR--------SDSECGEDETCLSDAYGRAKC----------ESVCLGRAACG----------RNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSG-DPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQC--FNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECA 2974          

HSP 6 Score: 289.271 bits (739), Expect = 7.229e-77
Identity = 412/1436 (28.69%), Postives = 558/1436 (38.86%), Query Frame = -1
Query: 3443 YCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECL-LGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKL-LCPLNALCVN----STCLCKSGYE---NSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDG-DCYD----GICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECN-------------------------------------ENVDDCQ-----ENSICFNRFGSYDCKCPPNYL-DVFK---DGKVCMAVPLSQCNQSCPTGQYCNNG----SCSCLMGLNSQTDD-------DGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETN-NVCNCGSHGICGPNY---ICQCKSGYEINPSGM---CQDVNECQTQ----SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYG-----------------------------------SVCEKIS-CNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGEL---CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVG-------------------------------------------FQRLENALVTDSCTDIDECLLSE---SCATNGECQNTIGSFKCECKDGFIGDGKYDCRI--------------------DSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDE--CANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSN-QTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPK-----------------GSPGAP----ECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDR-----ETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNE---CDPT---------SPDFAAQKCLASGG---GCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ-RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKC-------PDNLKLDLSKKACTDRNECQ 7021
             C C  G+ G C+ C D DE       CD   A C N++GSFTC C  GY G+G  C +IDEC    +      +  C N+   F C+C  GY+ D    C D +ECR  +N C  NA C NT G++ C C  GY+G+    +  + ++EC    +C   A+C N      C C  GY+    S + C++ DEC ++T C  NA+C++T GSF C C +GY GD +N  +   D D C   N C  G +C +      C CPSGFV + +   D+  +   P N    +  G      +     S     C+DIDECN                                     EN+++CQ     EN+IC +  GS+ C C P+Y  D F+   D   C A+     ++ C     C N     +C C  G + + D        D N+ CS N        C  NA C E      C C  G+E +G  SC DIDEC      C  +  C NT GS+ C C+ GY  +     C+       CG+H  C P+     C C+ G+  NPS +   C D++EC         C   A C N+ G + C CP  F GDP +KC + D+C+T A +C AG  C     G                                   S+C+    C   E  I N+C      C+ +NCG HA C + NG+A C C  GY G+  L   C D+DEC      C   + C N  G + C C  G                                            Q  E       C D+DEC +     +C  N  C+N  GS++C C  G  G+    C I                     S C     C   A CI ++   +  C C   +      SC+  + C   G   C   A C     +Y C CP+G+QGD YN    + +  CA D    C++ EKC+       CVC     ++D    D ++C S  +   C  NA C   +    C C  GF GD LL C D DEC      C+  A C+NK G + C C     G+    G   E   PK                 GS  +P     C  NA C+ +     C C+ GY   G   C+ Q   DV   C     C P++E     C+C P  +L N    P   C   TD C       E   C+      +CE   G    +G TC   N    C+P           P     KC    G    C    G   C CN          C          ++C    E    +  +  +C C +GF       C DVDECA+K   C  NA C N  G + C C       P +    +  K C D N+CQ
Sbjct:  113 VCHCNDGY-GGCN-CVDKDENECKQRPCDV-FAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC-ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE---DVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQ---PLNT-QQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTAL-----DKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFD------CTNNAECIENQ----CFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDC---RHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRAN--PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAAD--RECAANEKCIQPG---ECVC-PPPYFLDP--QDNNKCKSPCERFPCGINAKCTPSDPP-QCMCEAGFKGDPLLGCTDEDECSH--LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQ-DV--ICGDGALCIPTSEG--PTCKC-PQGQLGNP--FPGGSC--STDQCSAARPCGERQICINGRCKERCE---GVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAE--CRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQ 1486          

HSP 7 Score: 288.115 bits (736), Expect = 1.710e-76
Identity = 536/2042 (26.25%), Postives = 753/2042 (36.88%), Query Frame = -1
Query: 1160 NALCVNSTCLCKSGYENSTNQCINTDECE-SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL--DVFKDGKVCMAVPLSQCNQSCPTGQYCNN--GS--CSCLMGLNSQTDDDGNLNCS-KNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRG--------------------------------YSRNSSSGLC--------ETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE-DKCKTKALQCQAGEVCKLSL--YGSVCEKISCNSSEILINNECLPVNQVC-QNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGF----------QRLENAL----------------------------VTDSCTDIDECLLSE----SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGG-CHEDASCIVNVESSIYECQC--HTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQG-DGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI---CVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG----------LLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGT--TCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF---------CIKQTPCD------VPNACKANQTCTPSNENSLAI------CECKPDFKLEND-TCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN---------MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ--RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKAC-----TDRNECQEN-------------------PMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMI--GNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIP----GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKW--------------SDETNLNCEDIDECTNPTSC------------SSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQV-CENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKC-INTAGGFTCDCPEGFIYN----------------NYDCIDVDECSLDQVSSL--ADNCD----QVNGHCINTVGGFQCYCNRGFVMIENST---------KCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNP---CQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGI--VSC--KAICGPNSCLPGQLCQIV 6550
            +  C+N  C C  GY      C++ DE E  Q  CDV A+C +T GSF C C  GY G+G +C   D   D         + +C    C+ P+ F+ K    ++   E +                              C D+DEC  N ++C  N++C N  G+Y C CP  Y+  + +++G  C  V        C  G  C N  GS  C C  G     D DG       +   C    C  NA+C      + C C  GY G  +  C D+DEC    N C +  +C N  GSF C C  G                                Y R S +GL         + + V  CG++  C     +Y C C SG++      C+++NECQ  +PC   A C +T GS+ C C  ++ GDP   C + D+C      C    VC+ ++  Y   C +      +  +  E + VN +C  N +C N+A C IEN    CFC  G+   G  CVD+DEC      C  ++ C N  GS+ C C  G+          Q  E+                              V   C DIDEC +      SC  N  C N+ G F C C  GF GD    C    +C      C   A C VNV    Y C+C  +T    D    C+    C  N    C  N+IC+   AT RC+CP+   G D  + C  +         NC +  +C+ +NGQ  C+C  G      +   C DIDEC   + N C+  AIC N  G Y CQC  G  GD           + C D + C  G   C +++      G   C C+ G   N     C D DEC   +G P    C  NA+CKN    Y C C  G+ G  +          C  Q+P        V + C + Q C PS    ++I      C C   ++ + D +C+   ECE +        + CV     + C C  G+          +    C    EC       A +KC+   G C+     F+         +NN    P +    G++        C  S      C C  GF+   + G C D DEC+     C   A C N  G Y C CP +   D  K  C     T +++C  N                    ++CG  + C     +  C+C  GY  NG                          G C  +CQ    GDG   CI T   P     KCP G   N    G+     C+       +  CI   C ++C  +         C   A C  N+G   C C     G+    C    E A  +  C  N ++CE        L   +C C  G    P    G Q   +KN C     N C  NA C        C C  GF   P   C++++EC  K   C +N+ C ++A GF C C  G                  D     C +  EC    SC            S  P +IC     +  C+CP G+   G   + ++ C I   CG ++ C ++   F         QL  G    + +C++   + Q   G +++C       +C+C DGF  +    QV C+ +         C+ S+ +C   YG     C+   S N   +C++         SN+    N  C IN AG   C+C E +++N                + +C D   C  D +  L     CD      N  C+      +C C  GFV   N            C +  ECQ   +C+        G     C    D V                CGP+A  +C+      QC+C  G     G  Y+P   CQSV  CV  N  CP +  C    N     C D        +C        E+SC   A CL  D    C C  G+KGD +  V+C  +  C   +C P  +C++ 
Sbjct:  106 HGACLNGVCHCNDGYGGC--NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAEC----CNLPAHFLCKCKDGYEGDGEVL------------------------------CTDVDEC-RNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGY----DGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ-DNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC-IEN---QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAEC-VNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSAN--EDCPGNSICD---ATKRCLCPEPNIGNDCRHPCEAL---------NCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDEC---RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATG-ETCVQDSYT----GNSVCICRQGYERNSENGQCQDVDECSVQRGKPA---CGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQAC-PSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADREC------AANEKCIQP-GECVCPPPYFL------DPQDNNKCKSPCERFPCGIN------AKCTPSDPPQ--CMCEAGFKGDPLLG-CTDEDECSHL--PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGD-------------------------GDCVSQCQDVICGDGAL-CIPTSEGPT---CKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGV--------VCGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGEN-AHCEYG------LGQSRCACNPGTFGNPYEGCGAQ---SKNVCQ---PNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKP--CGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAIC----DAGNCICPMGYI--GDPHDQVHGCSIRGQCGNDADCLHSEICF---------QLGKG----LRKCVDACSKIQC--GPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCK-SDQDCSRGYG-----CQ--ASVNGIKECINL-------CSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLG-----CRPACDTVK---------------CGPRA--VCVTNNHQAQCQCPPG--PFAGDPYDPFNGCQSV-PCV-YNHDCPPSQMC----NRMTHTCFD--------VCD-------EESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVT 1912          

HSP 8 Score: 238.424 bits (607), Expect = 2.022e-61
Identity = 342/1313 (26.05%), Postives = 508/1313 (38.69%), Query Frame = -1
Query: 1229 GTYSCQCAEG-----FYGDGLLCHDIDECKFGVANCSEN---------------------------------------------------ALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTG-WFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET-----SNCVQLDPGFKCECKPGFNMVGNT---CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGF--------------------------------QRING---SCVDVDEC--ADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTG--DGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCY---------KKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPS-YLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPG--TQICLNKNEC--LNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQD-KADGFSCQCKPGFKWSD-ETNLNCEDIDECTNPTSCSS------------------------------MPHSICMNNPGSFECVCPHGF---SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGA-----------------------------------------------RQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDG-----FVNDEV--FPQVCENQNECEINIHSC--------QA--SNSECVDTYGSFK-CVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNG-KCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVM-IENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYEN---------SGGKSYNPCQSVNECVK-------------LNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGD 4432
            G + CQ  E       +    LC    +C  G    S+                                                    A C N  G+F C C  G  GNG  C D DEC+ P     A  C ENA C N    + C+C+ GY+G G   C     C  P  C  N  CT  N      C C PD  + N+   P  E     D C         + C  L+  ++C+C PG++  G +   C D++EC        A+        CLNT GSF C C      +  + C+ +D CA   + C    E C+ +   S+ C+C  GF                                QR +G   +C+D+DEC   D +  C  NA C N  GSY C CP   +       C + NECQ+NP  CG+ + C +T GS+ C C   Y  +    C DIDEC     PC   A C N      CKC  G+ G  D   +C + D                N++       C++ ++ +N  ECI + C+           C DIDEC T    C   A+C N  G+Y C C + Y+    +  C+       E   C  + +YC+   N         C C +G+   P      C++ +EC  ++     C +NA C ++ G + C C  GF   P  KC +++EC   +  C   + C +    G++C+C PG   +D + ++ C  I  C+    C                                  H+ CM   G  +C+C  G+   S   G CNDI+EC   N C + ++C+NT  G+ C C  G+                                               R   NG C+ ++EC  ++ R +   G +++C +LP  Y C CP G     F+  E+   P+ C+ Q+  ++  +SC        QA  S +EC+   G    C C  G+    DG CVD DEC   E+   + C  G +C+N  G ++C CPEG+  + Y+ +    C+L Q    AD     N  CI      +C C   + +  +++ KC    E +FP   ++  C       +C+C  G+  D + G CTD +ECS+     G      C+N  G +QC C   Y             G   + C S ++C                ++ C SNA C    +   C C+ GY ++  G C  +++CQ +  C   A C+ T     C C  G  G+
Sbjct:   52 GYFGCQVNESTEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPA---IAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCT--NTPGNYTCSC-PDGYVGNN---PYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDEC--------ARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATN-NPCGLGAE-CV-NLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQ-GQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV---------------NIL-------CSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQ----PCEDVRCGAH-AYCKPDQNEA------YCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRC-PGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRA-NPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDEC--SVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPE-CQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDEC---EERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGL----CALAQRKCAADRECAANEKCIQP---GECVCPPPYFLDPQDNNKCKSPCE-RFPCG-INAKCTPS-DPPQCMCEAGFKGDPLLG-CTDEDECSHLPCAYG----AYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC--VSQCQ-DVICGDGALCIPTSEGPTCKCPQGQLGN 1282          

HSP 9 Score: 139.813 bits (351), Expect = 1.029e-31
Identity = 538/2363 (22.77%), Postives = 787/2363 (33.31%), Query Frame = -1
Query: 1229 CGENAECIDTDGGYYCQCKTGFTGHC-------DECRDIDECAFSL----NNCDSD-----RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE-NECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVN-----STCLCKSGYENSTNQ---CINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN-CFKKDTDTDACQIENYCTDGDCYDG----ICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXX----XSLSSDSSQCIDIDECNENVD-DCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYC----NNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD-------------------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYS-------------RNSSSGLCETNNVCNCGSHGICGP--NYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINT------PGS---------YK----CQCPENFYGDPQNKC-------FEDKCKTKALQCQAGEVCKLSLYGSVC---------EKISCNSSEILINNECLPVNQVCQNIN--------CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCP-------NNSFCQ-NKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTI----------GSFKCE---------CKDGFIGDGKYDCR----------------IDSKCEKYGGCHEDA-----SCIVN-VESSIY---ECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCN-DIDECANDN-----THNCSSLEKCVNSNGQYNCVC-----GDG-AVYVDDICVDIDECSSNQ-----------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVA----------NCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCD--------VPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTD-----NCDRET--SNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTS---------PDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDS-CKNNATCNNMIGSYVCKCPDNLKLDLSK------KACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCIETDSCPARDD------VKCPTG--SYCNMIGNFIYCNCTNGY---------------EDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGT---------------QICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINEC---EEKSDN------CSINSVCQDKADGFSCQCKPGFKWSDE-------------TNLNCED---IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFS-----------LQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP---NGDCELINECLENI--------DRCQVLNGADSVCYDLPIGYACVCPDGFVNDE-----VFPQVC---ENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNS----DGDCVDYDECEISEQSNMKFCN---------NGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSL-ADNCDQVN----GHCINTVGGFQCYCNRGFVMIENSTK--CVDIDECQFPNSCLDGLCNN--------------LPGSFECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAG---ICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECV--------KLNITCP----SNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYL---------ADCLDTDGSYKCTCKYGYKGD 7063
            CGENAECI  + G  C+C  GF G+          CR   EC  S       C S       A C+       C+C  GY+G+  V     +     + C   +  C   NG   C C  G   +   +C+ E +EC    N C  N+ C    G+ +C C   Y G   +   +     C    C  N  C       S C C   Y  S N    C+          C   A C D+    +CYC +  IG+    C K     + CQ      + +CY       C+C SG+V  + +   E    VC  N     ++                LS D +  I        VD DC  +  C   +  YD                        C  +C  G +C    ++  CSC  GL                  C+P  C  N+ C+      +C C PGY G     C+                    +D C G I  C IN  C+  + +  C C  G+              +N S   C  +    CG H +C    + +  C   +  N     +   EC   S C     C+        PGS         Y+    C CP   +G+P  +C          +     L C A   CK    G  C           I C   E ++N++C P  + C N          CG +A C++ N    C C  GY GD  +  +       +   P        NS C+   DG   C+C   F+               EC++S  CA N  C N            G  +CE         C+  F GD    C                 + S C     C         SC+ N + S  Y   EC   +E   D   +CI N  C     + C  NA C  +  +  C C + ++GD +  C+  I E   D+      + C+    C   N    C C     GD  +      C+   EC S+            T  C +NA C       SC C  GF G+       D CK  V            C  N++C +  G   C CQ G  G    C  E     EC +           P    C  NA C+  +    C C + Y+G  +      P +        +P+ C +N  C   N N+ A C C P        C P  EC    D      C R+     C+ +  GF   C    +    +C +  E DP +         P   AQ C  S  G    C    G   C+C  E   +  + C+P                +C+ + D S            N +C++ ++C D     C  +A C+ +  +  C CP     + S+      +       C+ +P  CG  S+C   +G   C CVT Y      C    EC++ +    D A    RC++  PG+C              C C  G++GD    C      P +        V  P G  S C ++G    C+C   +               E    + CI + C   C           +C   A C+  + + +CTC S  TGD    C  Q     +        S C              C C   Y   P +               + C+N+ +C++P    C  NA C  +     C C +G+   PS  C  I +     E+ +N      C   S C++      C C  GF  S                NLNC++   +D C  P +C        +N+     C C  GF+           L+           IP+ CG NS C +      CSC       P     +C    +C  N+        + C    G  SVC  +    AC C  G+  D      +  Q+    E +N C  N   C A N+ C +  G+  C C P +  +       +CV  D+C+ S       C          N +C     G  C+C +G+  + +       CSL +V ++  + C          C++T     C C  G++    S K  CV   EC    +C++  C +              +  +  C C  G   D ++G C  + E  N    C P   G   +C        C CN GY          C + +EC         +    CP    SNA C    +   C C DGY+ + +  C+ I      +S             A+C + +G+  C C  G++G+
Sbjct: 8642 CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGL-NALCELDNGNPICYCPKGLTGNPFKNCIPEGDEC--TPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAIC-DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMG-YRCYD-----------------------PCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAI--CGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPS---PCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR-PECVLNSDC-PAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQ-------PECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSD--KACI-NEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF-----DGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSIC--RNVNNRAECSCAPGMFGAPPNCRP--ECVINQDCPSNRACIRQRCEDPCIGIC-GFNAVCSTQNHQPKCSCIESFEGDPYTACKMREINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRP----------------ECVLNSDCSK-----------NRACLN-NKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSP--CGPYSQCREVNGHAVCSCVTNYIGTPPACR--PECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPC---------PGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQ-KCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPC--PGTCGIEARCQVINH--YPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPC--NPSPCGA-NAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPH-----RSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISG-CEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGN 10894          

HSP 10 Score: 112.849 bits (281), Expect = 1.155e-23
Identity = 448/1887 (23.74%), Postives = 639/1887 (33.86%), Query Frame = -1
Query:  455 CHILAQCINTPGSYKCQCPENFYG----DPQNKCFEDKCKTKALQCQAGEVCKLSLYG--SVCEKISCNSSEILINNECL------------PVNQV-------CQNINCGNHAFCKIENGRADCFCDSGYYGDGEL--CVDVDECSNGDVSCPNNSFC-----QNK--------------DGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCAT----NGECQNTIGSFKCECKDG---FIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNN-LCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTN-KCSSNAICQNKEGTYSCQCAEGFYGD-----GLLCHDIDECKFGV---ANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRET----SNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTK--GSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQ--------------------ENPMICGDLSKC------------LNTDGSYECQCVTGYKWNGTNCED---------IDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSY----CE-----------NLDNTVNVLAPFQCHCFNGY----------VKIPGTQICLNKNECLNP-------VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNG-------ADSVC-----YDLPIGYACVCPDGF-VNDEVFPQVCENQNECEINIHSCQA---------SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTC----DCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNN----SQICGPQAAGICINAAGSFQC-KCNVGYENSGGKSYNPCQSVNECVKLNIT--------CPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA---ICGPNS-CLPGQLCQIVNGNQYDCGCVCQGPRCRDN--------------GPVCDTQGITYQS---EKQMFETTCKQNI---VGEVEYYNECQKSCATV-TCPGIEKCSMVNDRPSCTCQNCTQAELTPRLFCSNNGIEFHSICQMKTWICNTK---SEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKASMFNGNCEDPLFETQQCYNGPCPGDACENITCAPGSFCESGKCICPDCSDQRIPDPVCGKIGDLESGTYRTFC 5488
            C   A C+      +CQCP   +     DP N C    C      C   ++C    +    VC++ SC  + I +  +              P+ +V       C    C   A C++      C C   + GD +   C    +C NGD  CP N+ C     QN               +    C+C + FQ + +         I +CL    C      NG+C+    + + +C DG           C   S+C     C E   C +        C+ + E   D   SCI+N  L      +SC  NA+C       +C CP+GF+G                           N   +  CV         + C     C  NQ N  C+  A C   E  Y   C +  Y       G +C+    C+ G    A+C    LC+    T  C+C  G +G    C D DEC +         C  +A C+N    Y C C  G  G G+    Q  C  P  C                   KPD    N  CI   +C   TD C        +NC        C C  GF  +G    D N+               +G GC   +      C  ++    E N   KP D  + G  NC          +D   TC C EG+Q +N  C D++EC  +   C + A CNN+ GSY C+CP+ L  D  +  C D NEC                     E    CG  + C            LN+ G    +CV     +  +C           ID C++    C  LARCS       C C+ G TGD    C++   C  + D +C  GS C+       C+ TN    S Q+ C+  VC   C          S+C +F  C+NN    +CT         +  C   +EC  E  TC L+ +Y    CE           N +      AP  C C  G+          ++      C N   C N        +   C ENA+C        C C+ GF   P  +C+ I+ C +    C   + C++    + C C PG    D  N  C    EC     C   PH+ C    G  +C              D+   L    CG N+ C        C+C +G    P    + +  C      CQV          +DSVC      D   G   VC  G   N  + PQ C    EC +  H  Q          S  ECV    +    C PG++      C D   C     ++++  +N KC+  +   TC    DC  G +  +  C  V  C +D   S +++C   N  C+N      C  N    +  +   C          SCL+ +  N      C+ +   +     C +  +C N       +C P    +C + AG     +C  G      +  N C     C+ LN          CP    CV    G +C+                + C    +C   A C   D   +C C  G  G+  V+CK     CG N  C   QLC   +         CQG +CR++                VC+T     Q    E +M +T C+ ++     E     +CQ  C T   C     C +VN    C C         P  F   +G+   + CQ+    C+      E        C R+ DC   +  +   C   CG  R                        Q C  G C      N  CA    C +GKC  P C++++     CG+        +R  C
Sbjct: 1795 CGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPC-VYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQ-DCSDGESCLKNVCVVACLDHSQCASGLACVE-GHCTIG-------CRSNKECKQD--QSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEG---------------------------NPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCL----TGKCKCATGFIGTPFGCSDIDECTEQP-------CHASARCENLPGTYRCVCPEGTVGDGY---SQPGCSQPRQCH------------------KPDDCANNLACI-HGKC---TDPCLHTVCGINANCQSEGHEALCSCPAGF--LG----DPND---------------TGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQ--------VRDHKATCACYEGYQLVNDVCEDINECLSQ--PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNA-CGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYC--QQDGQCAQGSICSHGICSPLCS-TNRDCISEQL-CLQGVCQGTCKS-------NSSCPQFQFCSNN----ICT--------KELECRSDSECG-EDETC-LSDAYGRAKCESVCLGRAACGRNAECVARSHAP-DCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAP--CGPGARCRNARGSYKCTCPPGL-VGDPYNEGCRSSVECETNEDCP--PHAACTKTNGVAKC-------------RDVCAQL---QCGPNAECVPKGHVAQCACRSGYDGQPA---DRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYT------CRD-SMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKC--VYGCHVDDDCSASESCR--NDKCVNPCLENPCGPNAACSVSNHRASC----------SCLESMVPNPTPQVGCVRSPPLE-----CRENRDCGNGLACFESVCRP----LCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCV----GQQCV----------------DPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGS---------CQG-KCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQC---------PAAF-MGDGL---TGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTV-------------------GQLCERGACIAGCKSNGDCAADQSCVNGKCSDP-CANEK----ACGRNALCTVSEHRMLC 3427          

HSP 11 Score: 110.923 bits (276), Expect = 4.945e-23
Identity = 576/2493 (23.10%), Postives = 802/2493 (32.17%), Query Frame = -1
Query: 1907 NKNMIYSDCASPCQPTCYNNTNSMLCTGQCVESCICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCK----DIDECSNNTS------------VCDSNAFCKNTIGSFSCSCKEGFEGN---------GVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGN-----LCDRVS--TNCNNTFGSYR----------CDCKYGFRPSPIDSFVCTDVNECNLVHECDKNY----AKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCN-----TVQCTKPNE--ICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA----GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV-CSEIDECLLGLHNCSRSHQFCFNVNG---GFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VN--STCLCKSGYE-----NSTNQCINTD---ECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENV-------CPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKV-CMAVPLSQCNQSC-------PTGQYCNNG----------SCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTP-----------GSYKCQCPENFYGDPQN---------------KCFEDKC-----KTKALQCQAGEV-------CKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG----ELCVDVDECSNG------------DVSCPNNSFCQNKDGSFHCACNVG---------FQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND--NTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDI----CVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGV--------ANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF-CIKQ---------TPCDVPNACKANQTCTPSNENSLAICECKPD-FKLENDTCIPKTECENKTDNCDRETSNCVQ---LDP-----GFKCECKPGFNMVGNTCQDKNECDP------TSPDFAA------QKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKK-----------ACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLA----RCSNV-PGSCK-------------CKCQPGFTGDGIYSCIETDSC-PARDDVKCP-TGSYC--NMIGNFIYCNCTNGYEDSN----QMECI--GDVCYKKCSDIDECVTR-KSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCED-----QNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIP--------------GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSD----ETNL----NCEDIDECTNPTSCSSMPHSICMNN------PG-------------SFECVCPHGF--------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP----NGDCELINECLENID----RCQ-------VLNGADSVCYDLPIGYACVCPDGFVNDEV-----FPQVCENQNECEINIHSCQAS----NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQ-SNMKFCNNGKCINTAGGFTC 8332
            N+  I   C  PC+ +C NN    +     +  C C PG   +  +  +P                E +  EN               C    C  ++ C    +   C C  G++G    C+    + DEC N+ S             C SNA C+    +  CSC +G+EG           VT T                EC ++     C C  GF  N        R EC +  +      C R      CNN  G Y           CDC  G+   P  S     V     ++ C+ +     + C        C+C +G+     NC    EC  +  C  P+  CV+       +C+D         PC         CT  N   IC   +      F       I  D      A   C     G  AKC  +  S  C CL  +  +      E +        +CG    CI+      C    GF   C            LN+                C C EGY GD  V C++ +E           +      N      ECRC + Y+ +    C  E         C  +ADC           R       R  DP  G+  CG      NA+C  +N    C C  GYE     N   + +  D   E  S + C  N+ C D +G  +C C EGYIG    C  +   +  C     C +  C D  C    G         + RCE +       CP            V        + S        D C  +   C  NSIC N      C+C P +     + +  C+  P  Q  Q+C       P  + C             SCSC  G              +    C P  C  NA C ER     CKC   Y+G   + CR           C ++ DC   +     +C R   ++   G+C  N  C   +H    PN  C C  GY  +P   C+ V   +  +P  +   CI +P           G   C C E F G P N                C + +C     KT  L  +   +       C L + G    +            +  PV + CQ   CG ++ C++ + +A C C   + G        CV   +CS              D SC  +S C+ ++    C C  G         F+ +E    +   T  D C L + C +N EC+N I    C C   + GD    CR   +C     C    +C+                          N  C       C +N+ C+  N    C C  G+ GD +  C      A D    + C     C  S     C C  G +         C+   ECS +               C   A CQ      SC C  G+ GD       +E K           + C  N+ C    G  AC C A  +G   +C  E     EC   K         P    C  NA C   +    C C  GY G  +  C K+         TPC+ PN C +N  C     N +  C+C PD F     +C P  EC   +D    +   C Q    DP     G   +C    ++   TC+     DP        P   A      Q C  S  G    C    G  VC+C +  +     +C+P                +C+ S +      CI   QR    C           +C  NA C     S +C+C      D   +              +R+ C  +P  CG  S+C N  G   C C+  +     NC    EC I      +LA    RC +  PGSC              C C  GFTGD   SC       P + +   P   S C  N   N   C C   +        + EC+   D    K     +CV      C + A C   +   +C CP    G     C        N C      C  N S C  ++          C C   ++  P               TQ CLN+  C +P    C   A C     S  C C   F   P  +C+   + E    + +    C+    G   QC+P  +       ET +    NC    EC   + CSS     C+N       PG             + +C+C  GF          +  Y N+I     P+ CG N+VC +     +C C       P      +C L ++C  N      RCQ        LN    V   LP    C C  G+V D        P+  +N+      ++ CQ +    NS+C  +     C C P F   +   C    EC IS + S  + C N KC++     TC
Sbjct: 10700 NRACINQKCEDPCRGSCGNNAKCQVVNHNPI--CTCQPGMTGDPISGCEPMP--------------EVKNVEN--------------PCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCK--PECVVSAECA-PEKACVHK------KCVD---------PCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNS-----ECGPTEACINQKCADPCSGSCGFEAKC----------HVLNHLP-------------ICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPE---------CTLSADCP----------RDKACMRNRCVDPCPGI--CGN-----NAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDP-CAAACG--------LEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQ-----DPCVPS--PCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRP---------ECVLSSDCPTDK-----TCIRNKCQDPCPGICGLNAQCYAVNH---VPN--CVCNDGYTGDPFASCRRV---EVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQ-DPCDL-QPCGSNAECRNGI----CSCLADYQGDPYTGCR--PECTLSTDCAPTKACL--------------------------NKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCE-PNPCGSNAVC--RERNGIGSCQCLPDHFGDPYQSCRP--ECVRHSDCASNKA--CQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGL-PPNCRP----------------ECVLSTECPTDKACIS--QRCQDPCP---------GTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSP--CGLNSQCRNVQGVPSCTCLPDFLGAPPNCR--PECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPC--RPSPCGPN-SQCREVNQQA------VCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQ-RCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQ--PQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR--PECVTSSDCSS--QLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPT---CTCLTGYVGDPYRQCNRLPEPPQNE-----YVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFV-GTPPSC--RPECTISSECSADRACVNQKCVDPCAADTC 12952          

HSP 12 Score: 98.9821 bits (245), Expect = 1.954e-19
Identity = 664/3019 (21.99%), Postives = 981/3019 (32.49%), Query Frame = -1
Query:  575 CTGQCVESCICAPGYVLENGNCTKP--EACG----CLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKD----IDECSNNTS------------VCDSNAFCKNTIGSFSCSCKEGFEGNGVT----------CTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTT--GNCDDRNECADTGNLCDR------------VSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHE----CDKNY----AKCTNTPGSYYCTCDSGYQGDG-----RNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSC------------VDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIE--NYC------TDGDCYDGICHCPSGFVFKS-NKCFDERCENV-CPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSIC--FNRF----------GSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGL-----NSQTDDDGNLNCSKNSASCL--------PGICPLNANC-----------EERLFG-YICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGY-------------SRNSSSGLCETNNVCNCGSHGICGPN---------YICQCKSGYEINPSGMCQDV----NECQTQ---SPCHILAQCINTPGSYKCQCPENFYGDPQNKC-----FEDKCKT----KALQCQ--------AGEVCKLSLYGSVCEKIS---------CNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVD-------------------VDECSNGDVSCPNNSFCQNKDGSFHCACNVG-----FQR---LENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND--------NTHNCSSLEKCVNSNGQYNCVC---GDGAVYVDDICVDIDECSSNQ-----------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKFG----VANCSENALCINKPGTFACECQAGTLGNGTTC-----------GDED----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQT---------PCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK----TECENKTDNCDRETSNCVQLDPGF--------------KCECKPGFNMVGNTCQDKNECDPT--SPDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSK------------------DSSYTCQCIEGFQRINGSC--VDVDECADKI-------DSCKNNATCNNMIGSYVCKC-------PDNLKLD-------LSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNC------------EDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTG---------------DGIYSCIE---TDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDI----DECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEE-----KSDNCSINSVCQDKADGFSCQCKPGFKWSDE-------TNLNCEDIDECTNPTSCSSMPHSIC-------MNNPGSFECVCPHGFSLQGGY-CNDINECLIP--------NSCGQNSVCANTVSGFNCSCAN---GARQLPNGDCELINECLEN--------IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEIN-IHSCQAS----NSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEI-SEQSNMKFCNNGKCINTAGGF--------------TCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQ----VNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQF-------------PNSCLD-GLCNNLPGSFECLCNIGYD--------------LVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAI-------------CGPNSCLPGQLCQIVNGNQYDCGCVCQGPRCRDNGPVCDTQGITYQSEKQMFETTCKQNIVGEVEYYNECQKSCATVTCPGIEKCSMVNDRPSCTCQNCTQAELTPRLFCSNNGIEFHSICQMKTWICNTKSEISISYDGSCHRSIDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKAS-MFNGNCEDPLFETQQCYNGPCPGDACENITCA 8257
            C  +C  S  CAP     N  C  P    CG    C +S+     +  Q    +  V CR +    +  C    C  ++ C        C C+ G +G    CK       ECS +T+             C   A C+    + SCSC  G+ G+  T           T  N C P SPC     EC        C C   F+    +    C    EC  T   C R             +  CN       C C  G+     D F      +  +V+E    C+ N     A C    G   C C   + GD        C    +C+SNK CQ             + +C D  PG  G N      C+  N   +L  C C+ G+         +    C         R       + S  C                           CG N++C + +G   C C   + G    CR   EC  S   C +D+A         + RC +   G   + +E                 C   N    C+C  G+  D+   C            V+ + C    + C  N+ C N  G   C C   ++G+  NC P+  +       CP N  C+   C+               D C    SC   A C   + + IC C  G+ GD  +  +     +  Q E  + C       +  C  GIC C + F     + C  E   N  CP++                    +  SS+C+     N     C EN+IC   N            GS   +C P  + V    +     P SQC +            CSCL        + + +   N  C+   A CL        PG C + ANC            ER  G    +C+P  E   ++    +D C  + + C     C     +  CSC   Y             S + SS L   N  C     G CG N           C C+ G+  +P   C+      NE +T    SPC   A C +  G   CQC   ++GDP   C      +  C +    + L+CQ            C++  +   C  ++         CN       NE +     CQ   CG ++ C++ N +A C C   + G    C                     VD C+    +C NN+ C+ ++ S  C+C  G     F R   +   ++      + +  +   C  N EC+N  G   C C   FIG    +CR +              C +N E       C ++ +      CI N  C      +C +NA+C  +N T  C C DG+ G+ +  CN                N   C +  +C   NGQ +C+    GD  V     CV   +C  ++           +  C  NA+C+       C+C E   G+    C  +   K       + C  N+ C     T  C C A  +G+   C            D+D    +C+ P   PG   C  NA+C   +    C C +G  G  +   +Q          PC  P+ C  N  C  S ++    C C P+F      C P+    +EC       +++   CV   PG                C C  GF     T    ++C P   SP    Q C  S  G    C    G+  C C  +        C+P   C +  D C    + C++ K                  +   TC C+ G+     S   + V+E  +++         C  N+ C  +    VC C       P   + +        + KAC +R      P +CG  ++C   + +  C C++G+  +  T C            E +D C     PC   ++C  + G+  C C P + G                   +CI     D CP      C   + C++I +   C+C  GY       C  +   +K  D     D C    S C    +C N     VC+C     GD  T C  + EC L T         C+                         ++ C+ +++C++P    C  NAIC        CRC  G +     +C  + + +      +   C  NS C+       C C   F  S         TN  C     C N   CS     +C       + N   F C C   ++      C  I E  +P        + CG  S C       +C+C     GA      +C   +EC  N         D C  L G  + C  L    +CVCP+G   D     +C+ +   E++ +  C  S    N+ C     +  C C P +  N    C    EC + S+  + K C   KC +   G               +C C  G+  + Y       C  + V    + C       N  C        C C   +V        +C    EC               PN+C D  +C  +  S  C C  GY                   + T ++ C      CGP +   C +   +  C C VGY  +      P     EC ++N  CPS+  C++        C+D                    SC Y A C   + +  CTC  GY GD    C+ +             C P+ C P   C   NG      C C      D    C  + IT  S     E  C +N     + ++ C  +CA         C+++N  P CTC                 G   ++  Q K       + +       C  +  C      +  SC     V  Y  T  + +     N  C   L    Q  N PCPG    N  C+
Sbjct: 11862 CRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQP-SPC-GPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPT-KACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYT---GDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQ-------------QQKCRDPCPGTCGSN----ADCSVTN---HLPTCTCRIGYTG-------DPYRYCHVEPPQLPARVT-----EPSQPCR-----------------------PSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRP--ECVLS-TECPTDKA-------CISQRCQDPCPGTCGINAE-----------------CRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPC--LPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTI----SAECPSNLACIRERCI---------------DPCPG--SCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDK-------------------ACHSSKCV-----NPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCRE------VNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQA-CLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEP-PVRDVAPVDPC--RPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYV---NPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAAD--TCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAP-NCRPE--------------CTINSE-------CPSQLA------CI-NQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQC--RNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDP--CPGT--CGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQ-PSPCGPNSECRVSGDS--PSCSCLPEFVGAPPNCRPECISNSECPTNQACINQK---CVDPCPGLCGQNAICRVFSHSAMCLCDGGF-----TGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRP--ECVLNSD-CPSN-QACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPS--PCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPG----SCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPC--NPSPCGSNTQCNNG----VCSCLPEYHGDPYTGC--RPECVLHTD--------CDR------------------------SRACV-RHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRN-QKCSDPCPGVCGRGAQCHVTNHSPF-CRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPF--TLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGC--RPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYR-----SCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTP--CGPYSQ--CRSQGDAPACSCLVGYIGA------PPNCRPEC-RINAECPSSQACINEK------CRD----------------PCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCN--NGV-----CTCIPEYHGDPYSGCRPECIT--SADCSRELACSRN-----KCFDPCPGTCAPNA-----ICTVLNHVPMCTCPE---------------GYNGNAFVQCKPT--PPPALVQPCQPSPCGPNSQCREVNQQAVCSC-----VPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCS 14548          

HSP 13 Score: 98.5969 bits (244), Expect = 2.662e-19
Identity = 475/2027 (23.43%), Postives = 661/2027 (32.61%), Query Frame = -1
Query: 2294 RCDCKYGFRPSPIDSFVCTDV-------NECNLVHECDKNYAKCTNTPGSYYCTCDSG---YQGDGR-------NCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYG-----YRMSSXXXXXXXXXX--------------XXXNLHQ-CGENAECIDTDGGYYCQCKTGFTGHCD---------ECRDIDECAFSLNNCDSD--------------RATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDT-NGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNAL------CVNSTCL----CKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDG-INCFKKDTDTDACQIENYCTDGD-CYDGICHCPSGFVFKSNKCFDER------CENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENV-------------DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSC--SCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS------SSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLY--GSVCEK-----ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECK---DGFIGDG------KYDCRIDSKCEKYGGCHEDA--------SCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI-------DECANDNTHNCSSLEKCVNSNGQYNCVCG---DGAVYVDDICVD---IDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGA--------PECDENAVCKNKDPGYTCECQSGYK-----GTGWFCIK---QTPCDVPNACKANQTCTPSNENSLAICECKPDF--------KLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNT-KGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQ------------RINGSCVDVDECAD--------KIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCV---TGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPG-SCKCKCQPGFT-GDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKK--CSDIDECV--------TRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEE--KSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCE----------------DIDECTNPTSCSS------------------MPHSICMNNPGSFEC-VCPHGF----------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGAR 7633
            +C C  GF  +P     C  V       N+C   H C  N     N P +   +C  G   YQ   R       NC   + C+S++ CQ                     PGCD D  C       P E+C  G+C C  GF    T   C DIDEC      C    A+C NL G+Y C C  G     Y     ++  +                      LH  CG NA C        C C  GF G  +         EC D  +CA     CD++              +  C+      TC C EGY     VC +I+ECL        S  FC N+ G + C+C  G   D     C D NEC   D  C  +A C N+     C  R    G   NC  Q     C    CPLN+       CV+  C     C        ++CI  D C    +C   A C   +   +C C  G  GD  + C +       CQ +  C  G  C  GIC   S     +  C  E+      C+  C  N+ C          C+      SDS +C + + C  +                C  N+ C  R  + DC C   +    K G  C  +  +  +  C   + C+N  C  +CL+G                        C  NA C       +C C+PG+ G     C  ID C  +   C     C N  GS+ C+C  G   +       SS  CETN   +C  H  C            + N    C+DV     Q  C   A+C+      +C C   + G P ++     CK     CQ    C  + Y   SVC+        C + E+    +C   N   Q   CG +A C ++N    C C  G+ GD        EC    V+C         DG     C  G+    +++    C +  EC  +E C          GS    C+   D F+G         Y C +D  C     C  D          C  N   S+   +         + +      C  +    C EN  C    A +  +C      D     N+          C +DN   C   E C+      NCV G   D     +  CV    +D C+      C +NA CQ  +    C C EG  G+  +      CK     C  N  C +    +A  CQ G   N   C  ++ C +     G           C +  +C+N+       CQ+G +      T   C+    Q PC  P  C     C   N      C+C   F        +L  + C P  EC+     C  + S       G +C          N C  K +C         Q C    G C+   K +  C  +Q  +N   S     D CA     C R     +S  +    C C +G++            R++  C     C          +  +C  NA C  +     C CP +   + + +       C   P  CG+ SKC    G YEC C+    G    G  C      A +  PC   A C  +     +C C   F  GD    C  T   P +D         C  +G  +      GYE   Q +   + CY    C     C+        T +  C   A C        C+CPS   G  +  C+   +C  E    + +    E +  + +              + P T  C    +C +P  N    C  N  C        C CKSGF     G+     +  E  + D+C+ N  C D      C    G       N +CE                 I  C     C +                   P+S C+       C  CP GF          +  GG C    +C   + CG +  C +       SCA G +
Sbjct: 2107 QCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQC---NLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQ---------------------PGCDSDADC------PPTELCLTGKCKCATGFIG--TPFGCSDIDEC--TEQPCHA-SARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGD-RACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECL---SQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNEC-LSDADCPASASCQNSRCRSPCE-RQNACGLNANCQAQAHQAIC---TCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCI--DPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQ----LQYCQQDGQCAQGSICSHGIC---SPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDS-ECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSG--CRKIECTS-DDDCSNDKSCDNHMCKIACLIGQP----------------------CGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFC--RDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNE--DCPPHAAC-----------TKTNGVAKCRDVC---AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVA--GCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCF--NPCLQPQACGQNAECVMQNHLKQCHCPEGFTGD-----SAKECVRVPVAC---------DGE----CGPGYT-CRDSMCLPVCHNDLECASNEKCLK--------GSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN--ECGHGELCLG----LNCVPGCRSDQGCPPELSCVGQQCVDPCA--DPTACGTNAHCQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQ-GKCRNDQNCLADERCMR-----GTCRTVCNTDEACAQGQICENR------MCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHG--VQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQC----ARGKCRNKCGPKRQCT------VGQLC--ERGACIAGCKSNGDCAADQSCVNGKCS-----DPCA-NEKACGRNALCTVS--EHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKP--CGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTT--PKQD---------CRTLGCEVGGCVRQGYEYVCQQD--TEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAE----DTDPKTKEQIPCSTDS-------------ECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLT---SCAGGVK 3923          

HSP 14 Score: 97.8265 bits (242), Expect = 4.660e-19
Identity = 582/2709 (21.48%), Postives = 892/2709 (32.93%), Query Frame = -1
Query: 1154 MIYSDCASPCQPTCYNNTNSMLCTGQCV-----------ESCICAPGYVLENGNCTKPEACGCLMSDGTYYANGEQRTNENCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDY-GCHCKNGFMGDGIMCKD----IDECSNNTS------------VCDSNAFCKNTIGSFSCSCKEGFEGNG-VTCTNI-----------NECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTT--TGNCDDRNEC-ADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG----------RNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLD---GTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNL---HQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDE--NECRFFD----NGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTC------------LCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVF-----KSNKCFDERCENVCPK--NAXXXXXXXXXXXXXXXXXSLSSDSSQ-CIDIDECNENVDDCQEN-----SICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQC-------NQSC--PTGQYCNNGS----------CSCLMGLNSQTDDDGNLNCSK----------NSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMC---------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGD-GELCVDV---------DECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIK-----------NNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGL----LCHDI---DECKFG--VANCSENALCINKPGTFACECQAGTLGNGTT-----CGDEDECKKPKG---------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGW--------FCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG---CLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSK----------DSSYTCQCIEGF----QRINGSCVDVDECADKID------------SCKNNATCNNMIGSYVCKCPDNLKLD-------LSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNG--------TNCEDIDEC-AIK-------THPCH----DLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPAR-----DDVKCPTGSYCNMIGNFIYCNCTNGYEDSN---QMECIGDVCYKKCSDIDECVTRK------SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE------DQNECALETHTCNLNT----SYCENLDNTVNVLAPFQCHCFNGYVKIP--------------GTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQ--DKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLEN--IDRCQVLN-GADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQA-SNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNY-DCIDVDECSLDQVSSLA-DNCDQ----VNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRN---------------INECQIEDSCHYL----ADCLDTDGSYKCTCKYGYKGDGIVSCKAI-----------CGPNSCLPGQLCQIVNG 8323
            ++ SDC  P +  C N+     CTG C              CICA GY  +      P           +Y    +R +                 C    C  ++ C    D Y  C C   F G   +C+       EC+ N +            +C   A C+    +  CSC+  FEG+  V C+ I           N C P SPC      C  K     C C   ++ +       C   +EC +D   + ++    C N  G                                  + A+CT    S +C+CD  Y+GD           R    ID C  N   +  +A C     +  C C++   G P   G  P    +C   +E      C  +H          C   D C  A     G  A+C  ++    C C  G+  +  +     +    + +   + CG N+ C   +G   C C+ G+ G   +CR   EC  S        + C   +     +C +   G    C    +C +  HN                C C + Y+ +    C+ +     R  D    + C  N+ C N +    C C  G  G+  NC P+  + +     CP N  C+   C            +C +        CI + E +  T+C +    I+        CN    G    C +++       +  Y  +GD Y     C    V      K+  C + +C + CP            +   SCS  +  + + SQ C +I      V+ C+ +     S C    G   C C  NY+      +   +V  S+C       NQ C  P    C N +          CSC  G +     D  + C+           N   C+P  C  N+ C       +C C P + G    +CR           CTIN +C         +C     ++   G C  N  C+  +H     + IC C SGY  +P   C         + +  CQ  SPC   A+C    G+  C C   ++GDP + C   +C   +                      C+  +  +N +C+     C  + CG +A C++ N    C C +GY G+    C ++         DE       C   S C+  DG   C+C  GF       +  +     EC++S  CA N  CQN       +C D   G     C I+++C+              V +    C C   F+GD    C K            N C     S C  N+ C  V  +  C C   + G   N      EC   ++ +C +   CVN                         CS+     C  +++C   +   +C+C  G+ GD      +   I   DE +     + C  NA+C  + G  +C C     G+  +     C   D+C + +           PGA  C  NA C+  + G  C C  GY G             I+  PC  P+ C     C   + NS A+C C   +     +C P+                CV        EC      +   C+D               C  S G    C     + +CTC      +  S C+P+           + VE+ C+ S            +   C C  G+          C + DEC + +             SC +NA C  +  + VC C D  + +       +     T+       P  CG  ++C   +G+  C C  G++ N           CE+ D+C A++         PC+    D A C+       C C PG+TGD  +SC      P       +   C   S C  + N   C+C  G+ +     + EC   V   +C+    CV +K        C   A CT  + + +CTCP  +TGD    C       D    +    +C  +     + C+ + N+        C C   ++  P               T+ C+N+ +C +P    C   A C        C C  G++  P  +C    E           +       AD F+ +C+    +       C    ECT    C       CM N     CV P                  P  CG N+VC        CSC  G    P  +C  +   +E+  I+ C     G++S C D+     C C +G++     P  C  +        + QA  N +CVD   +                C     CE+   S +                C CP G   + +  C+ +   ++  V S   D C       N  C N   G  C C   F         +C+   +CQ   +C++  C+N                   C +   C  N++         C     +  C C  GY  +      P Q           C  NA+C++R+    C C D YQ +    CR                 N+CQ  D C  +    A C   +    C C  GY GD   SC+ +           C P+ C     C++ NG
Sbjct: 9308 VLNSDC--PAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNP-----------FYLPPPERPH----------------PCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVP-SPC-GPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCG----------------------------------HNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAE--NAVCTPYNNAARCTCIEPYNGDPYSTGCRP----ECIYSSECPSSLACIKQH----------CR--DPCTAA----CGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCR--PECVVS--------SECAQHLSCINQKCMDPCVG---TCGFNAKCQVNNHN--------------PICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQ----DCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMRE--INVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEY--NGDPYT---ECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSV-SSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSG----DPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRA-PNCRP---------ECTINTEC-----PANLACINERCQDPCPGSCGFNAFCSVVNH-----SPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQ-PSPCGPNAECRERNGAGSCTCLPEYFGDPYSGC-RPECVVNS---------------------DCSRDKSCVNQKCV---DPCPGV-CGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGF-------IGSAPNCRPECIISSDCAQNLNCQNQ------KCVDPCPG----TCGIEARCQ--------------VINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCI---PSPCGPNSKCLDVRGSPACSCLPDYLGRPPNC---RPECL--SSADCPANLACVN-----------------------QRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGA--CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK-PSPCGPYSQCL--DTNSHAVCSCLEGYIGAPPSCKPE----------------CV-----VSSECPQNRACINQKCED--------------PCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV--------KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPEC---VVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSP------ACSCLPNFIGAPPRCRPECVLNSECGPTEACINQ-KCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCR--PECTLSADCPR--DKACMRN----RCVDP-----------------CPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCR-VKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIG---APPQCRPECVVSSECSALQACVNKKCVDPCAAA---------------CGLEARCEVINHSPI----------------CGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSN------------------PCPE--SCGTNAE---------CRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQ--DPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANG 11628          

HSP 15 Score: 96.2857 bits (238), Expect = 1.270e-18
Identity = 201/864 (23.26%), Postives = 290/864 (33.56%), Query Frame = -1
Query: 4238 TSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKS---NKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNE-NVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--------GSC--SCLMGLNSQTD----DDGNLN-----CSKNSAS--------CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQD----------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP-----------VNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCH---EDASCIVNVESSIYECQCHTEFSGDGITS----------CIKNNLCFVNGK------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND-------NTHNCSSLEKCVNSNGQYNCVCGDGAV----------YVDDICVDIDECSSNQ-----TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDI----------DECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DEC 6457
            T C  N+ C   H   ICYC   +IG    C  + T    C ++ YC +  C D    CP     ++    +     C  VCP +   +                       ++ DE N      C  NS C    G   C C P Y      G      P    +  CP  + C N        GSC  S L  + + +      +G +      CS+   S        C P  C +NA C+      +C+C PGY G   + CR           CT+N DC +     +  C     R+   G+C  N +C   +H     + +C+C +G+  NP   C+           VN CQ  SPC   +QC  + G   C C   F G P +                C   KC+      C     C +  +  +C      + + L    CLP           +   C    CG ++ C++ NG A C C   Y G    C    EC+  +  CP+N  C N+     C    GF                            +C     +  C C  G+ GD    CR+              + + C  N   +  +C C  E+ GD  T           C +N  C VN K        C  NA+C+ VN    C CP+   G+ +  C  I +               C +  +C+  NG   C C  G            Y    C  +  C +N+       KC  NA+CQ  +    C+C   + G+  + C+ I          D C+   + C  N+ C N  G   C C     G    C  E    DEC
Sbjct: 19135 TPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRD---PCPGACGIRAICHVQNHGPLC--VCPPHLTGNPLLACQPIVIPP-----------VERDEVNPCQPSPCGPNSECQATSGGARCSCLPQY-----HGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP---------ECTVNSDCPSHRACMSEKC-----RDPCPGVCGLNALCQVINH-----SPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQ-PSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAL--TRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNC--RPECTI-NAECPSNLACINEKCRDPCPGACGFA--------------------------AQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRAC-VNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQ--PSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDEC 19923          

HSP 16 Score: 91.2781 bits (225), Expect = 3.780e-17
Identity = 439/1941 (22.62%), Postives = 634/1941 (32.66%), Query Frame = -1
Query: 1901 CDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN-CFKKDTDTDA----------------CQIENYCTDGDCYDG-------ICH--------CPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDE--CNENVDDCQE-----NSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINN----------CTINEDCSNTEGSFTCSCKRGYSRNS-------------SSGLCETNNVCNCGSHGICG---------PNYICQCKSGYEINPSGMCQDV----------NECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE------DKCKTKALQCQ------AGEVCKLSLYGSVCEKISCNSSEILINN---ECLPVN---------QVCQNINCGNHAFCKIENGRADCFCDSGYYGD----------GELCVDVDECSNGDV--SCPN----NSFCQNKDGSFHCACNV-----GFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCR---------------IDSKCEK--YGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNL------------CFVNGKSSCHENAICEQVNATYRCICPD-GFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNC--VCGDGAVYVDDICVDIDECSSNQTN----------------------KCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAP--ECDENAVCKNKDPGYTCECQSG-----YKGTG----------------WFCIKQTPCDVP--NACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCEC---------KPGFNMV-GNTCQDKNECDPTSP---DFAAQKCLASGGGCLNT-KGSFVCTCNQEQMNENNSSC---KPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR------INGSCVDVDECADKIDSCKNNA---TCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPG----SCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDG----------KTTCEDQNECALETH--------TCNLNTSYCENLDNTVNVLAPF-----------QCHCFNGYVKI----PGTQICLNKNECLNPVEN---DCVENAICIDTEGSYECRCKSGFKQLP-----SGKCENINECEEK---------------SDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCE---DIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQ-------------------GGYCNDINECLIP-------NSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVF---------PQV----CENQNEC--------EINIHSCQASN----SECVDTYGSFKCVCKPGFSKNSDGDCV-DYDECEISEQSNMKFCNNGKCINTAGGFTCDC 6685
            C  N++C  T G   C C   Y G+   C P    E      CP +  C N  C+               D C    SC  +A C     S +CYC EGY+G+    C + +    A                CQ  N  +   C  G       IC         CPS     S KC D  C  VC  NA+C + + SPVC C  G   +   S  I   E    E V+ CQ      NS C    G   C C P ++      +     P    +  CP  + C N  C                          PG C LNA C  R    +C C+PG+ G  +  C  +       +N          C     C    G  +CSC   Y   +              S L   N  C     G CG             C C +GY  +P   C+ +          + CQ  SPC   A C N     +C C   ++GDP   C        D  + +A   Q       G     +L  +V     C+  E +  N    C P+            CQ   CG +A C   NG A C C +GY+G              C  V  C N      CP     N+ CQ      HC C        F +     V      + +      C  N +C N  G  +C C   F G    +CR               ++ KC     G C + A C V++   I  CQC    +GD    C+                C+    S C  NA+C      Y C C    + G+ Y  C    EC  ++   C + + C+ S  Q  C  VCG  A+   +  + I  C    T                        C  N+IC+ +     C+C  GF+G+ L      EC    ++C+++  CIN     AC  + G      T      C  P    G P  +C+E    +  DP     C+S      Y G                    C+ Q  C  P  NAC  N  C   N    A+C C P+F        P  +C  +              +P  K EC         K   N V  N C+  N C P +          C+ + G   N  +  ++  C  +     N +C   + +D C  G   C      C +  +    C C++G++           C   DECA  + +C+N      CN  IG+         +++  +  C        NP +  DL        + + +C +     G  C+  + C + THPC   A C  V      +  C C PG+ G+    C +    P RD                    CT+  +  +   C G  C   C D        S C + A+C       +C+CP    GD           KT C   +EC   T          C        N +  V    P            Q  C+    KI    P  + CLN+N C++P  +    C   A C+       C C +G +  P     +G C+   +C +                 + C++N++C  +     C+C+PG++ +     +        +C     C S     C+N   +  C  PH  + Q                   G    DI+   +P       + C  NS CANT    N +C +  R                ++RC    G ++ C        C CP GF  +            P++    C   ++C        EI I  C A +    + C        C C PG++ N    C+   D   +  +S+    +N  CINT     C+C
Sbjct: 19244 CGPNSECQATSGGARCSCLPQYHGTPPFCRP----ECVNSADCPADKACRNYKCI---------------DPCPG--SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDP-CPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCR-----PECVISAECPADRACINQKCQ----------------------DPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQ-PSPCGANALCNNG----QCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPP-NCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLH--IPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCY---PSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCR--PECVGNS--ECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLS-SDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQK-CRDPCLNACGINAICRAINHK--AVCSCPPEFYGS-----PYAQCLRQLP------------EPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPC--GFTQCGTGA-ICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHL-ACRNERCEDPCNCGIGA-------QCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECK--NPCDV-THPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKE---PPRDQ------------------GCTSHDQCQDTEACRGGNCVNPCLD-------ASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNEN-CVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPS--KLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACR----------------LERC----GVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNC 21034          

HSP 17 Score: 83.5741 bits (205), Expect = 8.714e-15
Identity = 511/2328 (21.95%), Postives = 746/2328 (32.04%), Query Frame = -1
Query: 2264 TCSNDAFCDFKDDDYGCHCKNGFMGDGIMCKDIDECSN--------NTSVCDSNAFCKNTIGSFSCSCKEGFEGNG-----VTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCA--------GRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDI--DECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDG----SVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALC--VNSTCLCKSGYENSTN-----QCINTDECE-------SQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKC-FDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQC--IDIDECNENVDD------CQENSICFNRFGSYDCKC-------PPN------YLDVFKDGKVCMAVPLSQCNQSCPT--GQYC------NNGSCSCLMGLNS-------QTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKP------GYEG-----VGIKSCRD---------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNS---------SSGLCETNNVCNCGSHGIC---GPNYICQCKSGYEINPSGM-CQDVNECQTQSPCHILAQCINTP-------------------GSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLP----VNQVCQNI---NCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQ-VNATYRCICPDGFQGDGYNFCNDI-----DECAN---------DNTHNCSSLEKCVNSNGQYNCVC-----GDGAVYVDDI------CVDIDECSS-------------NQTNKCSSNAICQNKEG----TYSCQCAEGFYGDGLL-----------------CHDIDECKFG--------VANCSENALCINKPGTFACECQAGTLGNG-TTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFN-MVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC------------------------NQEQMNENNSSCKPI---DSCAMGLDNCDRKVE---DCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMIC---GDLSKCLNTDGSYECQCVTGYK-----WNGTNCEDIDEC-------AIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIET---------------DSCPARDDV-------------KCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRKSA----------CHKFAECTNNDGAYVCTCPSYLTGDGK-----TTCEDQNECA--------------LETHTCNLNTSYCENLDNTVNVLAP-----------FQCHCFNGYVKIPGTQICLNKNECLNP--VENDCVENAICIDTEGSYECRCKSGFKQLPSGK-------------CENINECEEK--------SDNCSINSVCQDKAD----------GFSCQCK---------------PGFKWSDETNLNCEDID-----ECTNPTSCSSMPHSICMNNPGSFECVCPHGFS------------LQGGYCND---------INECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELI 8056
            +C   A C        C+C  G++G+        E S         N S C  NAFC+       C C  G+ GN        CT  ++C     C   +E+C D  PG       G        N     EC  TG++         N + S    C+   R  P   +V    N C     C  N ++C  + G   C+C   + G   +C    EC  +  C   D  C+N       +C D  PG  G N     QC   N   +   C C+ GF  +  T            +ND          G  ++C  ++G   C CL  Y  ++ N   E          +C  N  CI+                 ++CRD     C F+        A C     + +C C  GY+GD      V             C  S      +    +C CL  Y  D    C    EC   ++ C  N  C+N      C+            DP  G   CG     LNALC  VN   +C      + N     Q I  D            + C  NA C++ +G+ IC C  GY G   NC  +   +  C   + C +  C D    CP        KC  +  C+ +                   +     +   QC  I +    E V D      C  NS C N  G  +C+C       PPN        D   +   CM     +C   CP   GQ        +  +C C +G+             D           C P  C  NA C  +   Y+C+C         YEG     VG   C            D C G    C +   C+       CSC  GY+ N+              +      CG + IC       +C+C  G+  NP    C+   EC   S C     CIN+                     S  C CP N  G+P  +C E +       CQ        +        +C+  E +IN +C      V+Q C++     CG +A C+  N +A C C   +YG     C+           C ++  C N     +  C                   + C  S  CA    C   +    C C +G+ G+   +C +        GC  D  C  N                    +C+        G + C   AIC    N   RC C DG++G+    C        DECA          ++  NC    +C   N +  C C     G+ AV  D +      C    EC S             + T+ C +NAIC+  +     T  C C  G+ G+  +                 C D + C+ G         + C+ +A C+ +     C C   T G+  T C +  E K   G     EC     C NK       CQ              PC   N C  N  C    +NS  IC C   +  +     P+ +C                    +K ECK   +     TC ++N  DP +     Q    +G  CL      VC C                        + E  +  N  C+P+   ++CA+      R+ +   +C      +   QC    +     C+   +C  K+ +C N    +     +VC           ++ CT  +   +  M C   GD      TD S  C  +T  K      + + C + + C       A +   C   A+C+      +C C  GF G+    C  T               D CP RD +              C  G+YC++      C C  GY  + Q  C+   DV    C    +C + ++           C   AECT  +   +C C    +G+ +       C   +EC+              L +  C LN + C   ++  N   P            +  C + Y     + +    NEC++P    N C +NAIC   +    CRC     QLP G              C +  +C  K         D CS+ S C   A              C+C                P      E++ +C D +     +C NP +C +  +++C        C C  GF                G C+          IN CLI + CG N+ C    +   C C +G R  P   C +I
Sbjct: 19300 SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRAC--MSEKCRDPCPGV-----CGLNALCQVINHSPVCEC-HTGHV--------GNPYHS----CRIPQREPPAPEYV----NPCQP-SPCGAN-SQCRESQGQAICSCLPEFVGTPPSCRP--ECVISAECPA-DRACINQ------KCQDPCPGACGLN----AQCHVRN---HSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINA-----ECPSNLACIN-----------------EKCRDPCPGACGFA--------AQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGC--RPEC-VLNSDCPRNRACVNQK----CV------------DPCPG--HCG-----LNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVD---PCP-------GKCGLNAVCQAI-----------QHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMN---QKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGV---CGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRP--ECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCR------------------NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLL-------GCRSDGECAAN-------------------EACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIK--TGCTHDSECQPTTACINK------RCQD-------------PCAEANPCAGNAEC--RVQNSRPICFCPAGWGGD-----PQVQC--------------------YKPECKINADCPYDKTCLNENCVDPCT---HGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKL-ACINERCADPCATPHVC---------TPQQTCTVLDTLPKRAMACKCPGDTV----TDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCP-RDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALN-AECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDC--ASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCP---DQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGT--NAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI 21382          

HSP 18 Score: 83.1889 bits (204), Expect = 1.056e-14
Identity = 303/1339 (22.63%), Postives = 432/1339 (32.26%), Query Frame = -1
Query: 2486 CPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG---LCETNNVCNCGSHG-ICGPNYICQCKSGYEINPSG--------MCQD---------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNIN-CGNHAFCKIENGRADCFCDSGYYGDGEL------------------CVD---VDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVT---------DSCTDIDECLL----------SESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL---CHDIDECKFGVANCSEN------ALCINKPGTFACECQAGTLGNGTTCGDEDE---CKKPKGSPGAPE------------------------------------CDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKC---ECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTC-NQEQMNENNSSCKPIDSCAMGLDNCDRKVED-CISSKDSSYTCQCIEGFQRINGSCVDVDECADK---IDSCKNNATCNNM----IGSYVCKC----------------PDNLKLDLSKKACTDRNECQ----ENPMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMEC--IGDVCYKKCSDIDECVTRKS--------------ACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE--DQNECALETHTCNLNTSYCENLDNTVNVLAPFQ-----------------CHCFNGYV--------KIPGTQI---------CLNKNECLNPVEND---CVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSD-------------------NCSINSVCQDKADGFSCQCKPGFKWSDE---TNLNCEDIDECTNPTSC 5842
            C + A C        C+C  G+ G     C   D    +   CT++ +C +    F   CK         G   +CE  +     +    C P Y+ +   G    P           CQD         VN C   SPC   AQC+       C CPE   GDP   C+E             E+     + S C+  +       IN  C      C   N C  +A C+++N R  CFC +G+ GD ++                  C++   VD C++G V C N + C  ++    C C  G Q   N  ++         + C D + C             E+CA N  C       +CEC+ G+ G+    C I  K  K   C +DA C   +        C  E   D    C   ++C    + +C    +         C CP     D    C  I            ++ K V S  Q+N  C +  V  +  C+D     + +  +C  NA C  ++    C C +GF G+  +     ++D  +     CS N       +C N+       C A   G G  C  +     C+ P G  G P+                                    C  NA C  K+    C C+ G+ G   F      C   + C  ++ C   N   +  C       L +D C    EC  +    +      ++ DP  +C   EC   ++   N     NEC   SP      C A    C   +   VC C +Q  +    + C+P            R VE  C    D      CI+            D+C D    +  C   A C+ +    + + VC+C                P  L    S + C D+  C      NP  CG  + C  T     C C  G++ N   +C  I  C +    C     C N              GD I  C+  D C    +        C +  N   C C +GY  +    C  IG      CS  ++C T K+               C   AEC   +   VC CP    G+    C    Q  C L+T          E   +   VL P Q                 C C +GYV          PG +          C     CLN V  D   C  NA C   +    C C+ GF+  P  +C  I EC   SD                    C  N+ C        C+C PG   +     T L C   DEC    +C
Sbjct: 20437 CGIGAQCRVENHRAQCRCPAGFSGNPAVRC---DLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPP-----------EIKTGCTHDSECQPTT-----ACINKRC---QDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ--GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPK-PQCIQDADCPSKLA-------CINERCAD---PCATPHVC--TPQQTC--TVLDTLPKRAMACKCPGDTVTDISRNCVPI------------TVPK-VISGCQHNSECANTEVCSNGNCLD-----ACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNE--ICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCV--NRECINPC-------LASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC--VSPCGQRNPC-AQNAICQALQHRAVCRCPDQLPLGNPYAYCEP------------RPVEPVCRDDGDCPSKLACID------------DKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG-CRVDGE-CDSGKACIN--------------GDCINPCLINDPCGPNAE--------CYVQSNRAQCRCLSGYRGNPYERCRVIG------CSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKI-ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKAC 21649          

HSP 19 Score: 82.4185 bits (202), Expect = 1.960e-14
Identity = 160/684 (23.39%), Postives = 216/684 (31.58%), Query Frame = -1
Query: 4091 NANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQ----------DVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQ---------------NKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQV-----------CQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCH------EDASCIVNVESSIYECQCHTEFSGDGITSCIK---------------NNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLE-----KCVNSNGQYNCVCGDG----AVYVDDICVDIDECSS-----NQ------TNKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CH------------DIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE----DECKKPKG-------SPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-FCIKQTPCDVP 5833
            NA C ER     C+C P Y G   + CR           C +N DCS+       +C   + R+   G C  N  C   +H        C C  GY  +P   C             N CQ  SPC   +QC  + G   C+C  ++YG P                  C   +C    A  C    +C+   + + C      + +  +  + LP  Q            C    CG  A C++E  +A C C + YYG    C    EC+            QN D   H AC           V   C  +D C    +C  N  C        C C +G++GD  Y C                   + + C  N + S   C C   + GD    C                  N C      +C   A C+  N    C CP G+QG+ +  C      A    H C         +C     Q  C C  G           CV   EC       NQ         C   A C     +  C C  G+ G     CH             ID C    + C  +A C N+ G   C C    LG    C  E     EC   +         P    C  NA+C+  +    C C  G  G  +  C+  T  ++P
Sbjct: 17256 NAVCRERGEAASCQCLPEYYGNPYEGCRP---------ECVLNSDCSSH-----LACLNQHCRDPCPGSCAPNAQCQVVNH-----VPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQ-PSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRP--ECT------------QNSDCPSHRAC-----------VNQRC--VDPC--PGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCL--PSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIP 17888          

HSP 20 Score: 81.6481 bits (200), Expect = 3.078e-14
Identity = 269/1185 (22.70%), Postives = 380/1185 (32.07%), Query Frame = -1
Query: 3983 CGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEEC-GKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGIN---------------CFKKDTDTDA------------CQIENYCTDGDCYDGICHCPSGFVFKSN-----KCFDERCENVCPKNAXXXXXXXXXXXXXXXX-------------XSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINED------------CSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH-------------GICGPNYIC---------QCKSGYEINPSGMCQDV-------------NECQTQSPCHILAQCINTPGSYKCQCPENFYGDP----------------QNKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCE---------KISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNK-------------------DGSFHCACNVGFQ----------RLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-FC-----IKQ---TPCDVPNACKANQTCTPS-NENSLAICECKPDFKLENDTCIPK 7063
            CG NA+C + +    C C  GF G   +CR   EC       +SD   C   +     +C +   G    C +  +C +  H    S    F+ N  F C+ L              N C  + + C  NA+C N +   +C C   YIG+  NC P     EC     CP+   C+   C                D C     C + A C        C C   YIGD                  C++    ++A            C  E Y   G+ Y+G   C    V  S+      C ++ C + CP +   +          S                   ++  Q +  + C  +   C  NS C    G   C+C P+Y      G      P    N  CP  + C +  C         TD                G C  NA C        C C PGY G     C+ +       ++  I  D            C        CSC   Y         E     +C SH             G CG N  C          C  GY  +P   C                + CQ  SPC   AQC N      C C   + GDP                   C  ++C       C +G  C++  + ++C+          + C  + +    E  P    CQ   CG+H  C+    +A C C  GYYG    C    EC + D  CP +  C N+                   + S  C C  G+           R +++ +      ID CL S  C  + +C N  G+  C C   ++G   Y CR   +C     C  D +CI                          N  C       C  NAIC   N    C+C  G  G+ +N C          T   ++++                  Y +     I+ C   + N C +NA C  + G  SC C   ++G+       + C+     C  N+ C   P + AC               + +C+ P   PG   C  NA C   D    C C SGY G    +C     I++   TPCD P+ C  N  C PS NE   A+C C P+F      C P+
Sbjct: 17040 CGNNAQCREVNDQAVCSCLPGFFGVPPKCRP--ECTI-----NSD---CAPHLACLNQQCRDPCPG---ACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPI---NPC--YPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRP-----ECITSSECPIQLACIGQKC---------------KDPCSGL--CGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYY---GNPYEG---CRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPS--PCGPNSQCTESQGQAVCRCLPDYY-----GSPPACRPECTTNPECPNDKACVSRRC---------TDPCA-------------GACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQ-PSPCGPNAQCSNG----VCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHP----CQPSPCGHHGECREVGSQAICTCRLGYYGSPPAC--RPECVS-DPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQ--PIDPCLPS-PCGPHAQCSNEGGNAVCRCLTEYLGVPPY-CR--PECIANSECPSDRACI--------------------------NRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQV---------------LQYEEPF---INGC---EPNPCGANAQCNQRRGVVSCVCLPDYFGN-----PYEACR---PECILNSDC---PLSRACV--------------QQKCRDP--CPGT--CGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCD-PSPCGPNAQCHPSLNE---AVCSCLPEFYGTPPNCRPE 18051          

HSP 21 Score: 78.5666 bits (192), Expect = 2.507e-13
Identity = 50/122 (40.98%), Postives = 66/122 (54.10%), Query Frame = -1
Query: 9266 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGF 9631
            D +ECS   + C   A CTNL+  +RCDC  G+ G G +E       C+D DECA   C   +DC NT GSF C C  G+       C D++EC+ N+  C   A+C+N  GS+ C C  GF
Sbjct:  255 DVDECSYP-NVCGPGAICTNLEGSYRCDCPPGYDGDGRSES-----GCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 22 Score: 77.7962 bits (190), Expect = 4.812e-13
Identity = 401/1829 (21.92%), Postives = 585/1829 (31.98%), Query Frame = -1
Query: 1157 CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEIN-------PSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---KCFEDKCKTKALQCQAGE-------------VCKLSLYGSVC---EKISCNS-----SEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC---RIDSKCEKYGGCHED---ASCIVNVESSIYECQCHTEFSGDGITSC----IKNNLCFVNG-----------KSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHN------CSSLEKCVNSNGQYNCVCGDGAVYVD----DICVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGL-LCHDIDECKFG----------VANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFC------IKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLE-----NDTCIPKTECENKTDNCDRETSNCVQLDPG--------------FKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGG----CLNTKGSFVCTCNQEQMNENNSSCKPI----DSCAMGLDNCDRKVEDCISSK----------DSSYTCQCIEGF--------QRINGSCV---DVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLS--KKACTDRNECQEN------------PMICGDLSKCLNTDGSYECQCVTGYKWNG-TNCE---DIDECAIK--THPCHDLARCSNVPGSCKCKCQPGFTGDGI----YSCIETDSCPA---------RDDVK--CPTGSYCNMIGNFIYCNCTNGYEDSNQMEC--IGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINEC-------EEKSDNCSINS-----VCQDKADGFSCQCKPGFKWSDE-------TNLNCEDIDECTN-------PTSCSSMPHSICMNNPGSFECVCPHGF---------SLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCAN--------GARQ--LPNGDCELINECLEN--IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQAS----NSECVDTYGSFKCVCKPGF---SKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFT----------CDCPEGFIYNNY----DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQ--SVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKAICGPNSCLPGQLCQIVN 5857
            C P  C  NA C+       C C P Y+G     CR           C +N DC         +C R    +   G C  N +C+  +H       +C+C      N       P       + C   SPC   ++C     +  C C E+F G P N   +C  +      L CQ                +C +  +  +C    K + N       E +  +E +P N  CQ   CG +A C     +A C C   Y G    C            C  NS C     SF  AC        N    D C        S +C +N  C     +  C C  GF GD    C    +  + E    C  +   A+ +   E  +  CQC  E+ G+   +C    + NN C  N               C  NA+C  +N    C C +GF GD Y +C   ++       N      C    +C  +N Q  C C    V         CV   EC  ++              C SNA C+  +    C C  GF GD    C  +   +             + C + A C +  GT  C C     G    C  E                 C+ P   PGA  C  NA+C   +   TC+C  G+ G  +        I + P  + + C    TC P+   +   C C P+F           C+  TEC+  +  C R  + C+   PG                C C P   M GN         P         C  S  G    C N  G  VC+C ++ +     SC+P       C + L    R   D               + S  C CI  F         R     +    +D C  +   C  NA C     +  C C           +  C   ++C  N            P +CG  ++C   + +  C C+ G   N   +C+   D+ E        PC   A CS   G+  CKC P F G+        C+    CP+         RD     C   + C +  +   CNC  GY+ +  + C  + D   +    +     + S C   ++C  ++   +C C     G        + EC + +  C+L              LA  Q H                   C++P    C  +A C     S  C C  GF       C+ I          E   D C  +       C+ + +   C C PG+  +          N +C     C +       P SC        +N+  +  C CP G+                  +++   P+ CG N++C+    G  CSC          G R   + N DC     C  +   D C    G  +VC        C CP G  +   F Q    Q+   + ++ CQ S    N++C +      C C PGF         +C    +C        + C +  C    G F           C CP GF  N +              + ++    +    N  C N      C C + ++        +C+   EC    +C+   C               D  +G C     C   S +     + ICI           +G   +G  +  P Q   +N C +    C SNA C +R     C C   Y  +    CR   EC +   C     CL+                    C+  C P SC P   CQ+VN
Sbjct: 15655 CNPSPCGANAVCQNGQ----CSCIPEYQGDPYTGCRP---------ECVLNADCPRNR-----ACVRHKCVDPCPGTCAPNAICDVINH-----IAMCRCPERMTGNAFIQCETPPVSLAPPDPCY-PSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNP-CQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNC---------RPECITNSEC-----SFDKAC-------LNQRCRDPC--------SGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDP--CPGA--CGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDL-ITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECD-WSKACVR--NKCIDPCPGTCGSNAICEVHRHIAMCHCPP--EMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGV-PPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPC--QPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEP---VPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPAC---RPECTISSE-CDL-------------TLACVQQH-------------------CVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINH--TPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICS---PGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPG-TSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRD-PCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCK--------------DPCSGLCGIAATCQVVSHV----PSCICIADY--------IGDPYTGCYARPPIQREQINPCYQN--PCGSNAVCRERGEAASCQCLPEYYGNPYEGCR--PECVLNSDCSSHLACLNQH------------------CRDPC-PGSCAPNAQCQVVN 17321          

HSP 23 Score: 77.7962 bits (190), Expect = 4.975e-13
Identity = 55/166 (33.13%), Postives = 79/166 (47.59%), Query Frame = -1
Query: 15605 DPNVQCHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEGSFGD 16102
            D N+ C    +C N+    E++C C  G+E    +C DIDEC   + VC  +  C+N  G+Y C C+ G+VG+         CE     C A+A C        C+C++G+  N    S +    V+ D+ +       SC Q ATC + A G FTC C  G  GD
Sbjct:  543 DVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCED--VRCGAHAYCKPDQNEAYCVCEDGWTYNP---SDVAAGCVDIDECDVMHGPFGSCGQNATCTNSA-GGFTCACPPGFSGD 702          

HSP 24 Score: 77.7962 bits (190), Expect = 4.975e-13
Identity = 404/1793 (22.53%), Postives = 620/1793 (34.58%), Query Frame = -1
Query: 2261 LHQCGENAEC-IDTDGGYYCQCKTGFTG----HCD--ECRDIDECAFSLNNCDSDR----------ATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLGLHNCSR-----SHQFCFNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDG----SFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI-NCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVC----PKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVC---MAVPLSQCNQS---CPTGQYCNNGSCSCLMGLNSQTDD-DGNLNCSKNSASCLP----GICPLNANCEERLFGYICKCKPGYEG-------VGIKS----CRDIDECGGKINNCTINEDCSNT-------EGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH--GICGPNYICQCKSGYEINPSGMCQD---VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEK-ISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDG-ELCVDVDECS----NGDVSCPNNSFCQN-----------------KDGSFHCACNVGFQ------------RLENALVTDS-CTD---IDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDC-RIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQ-GDGYNFC--NDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDED-----ECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNECDPTSPDFAAQKCL---------ASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQR-INGSCVDVDECADKIDSCKNNATC----NNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCL-NTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIE-----------TDSC------PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKS--------ACHKFAECTNNDGAYV------CTCPSYLTGDGKTTCEDQNECAL-----------------------ETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQ-----ICLNKNECLNPVENDCV-ENAICIDT-EGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELIN 7072
              QCG  A C  D +    C C  G+ G     C+  ECR  DECAF L  C ++R          A C        CRC  G+SG+ +V    D        C+      S   CF    G EC+                N C    + C  NA C   D     + +C C  GY+G       +E   + G   C  +  C ++   C+ G  N  N C++   C        +A C+      IC C E   GD   NC++        +I+  CT    +D  C         +  C ++RC++ C    P          +    C        D        EC  N D C  +  C N           N +D    G+V     A  L+Q +Q+   CPTG    N   SC+ G     +D   +  C + +  C P      C LNA C  R     C+C+PGY+G       + +K+    C    +C  K+    INE C++            TC+      + + +  C  + V +   +   I  P  I  C+   E   + +C +   ++ C+ +  C + AQC       +C CP+ F G+P+            ++C   EV    +    C +   C   +I  N  C+     C   +CG  A+C ++  +A C C  GY G+  E C+   +           CP+N  C N                 K+    C C  GF             R ++    D  C +   I+ CL S+ CA N EC        C C  G  GD    C R++        CH D  C  N+     EC          ++ C + N         C +NAIC+ +     C CPD    G+ Y +C    ++    D+  +C S   C++   Q             D C  +  C  + T +CS   +      T  C+CAE                + V + S     +  P    CE       +   C D++     +C+ P        C  NAVC+       C CQ G++G  +   +   C V   C + + C   N + +  C       L ND C P  EC  +++       +  + +P  +C       ++G  C   N+C PT      ++C+         A    C       VC C  + +      C+P       LD       DC              G Q  IN  CVD   C   ++ C+  A C     + + + +C CPD     +S+     +  C+  P I  ++  C+ ++D   +  C+     +  NC    EC IK H                C C+ GF G+  + C +           T  C      PA    +C + + C  I +   C C  G+  + ++ C        C   DEC T K+         C   A C  ++   V      C CP   T  GK  CE +    +                        T  C +N ++C ++ +T+ V     C C  GY   P  Q     +C+ +   +  V+  CV      +D  E    CR + GF+   SG C    E            +  D+    +C    G++ +       E+  ECT+   C+   +  C               +L    C D   CL    CG N+ C        C C  G    P+  C   N
Sbjct: 20376 FTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLA-CRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAV--RCDLVPTQPEGCTMDAECPSKLACF----GGECK----------------NPCDV-THPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQG---CTSHDQCQDTE-ACRGG--NCVNPCLDASPCAR------SAQCLAQQHRAICSCPERTQGDPFTNCYEPP------EIKTGCT----HDSECQ-------PTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINAD-CPYDKTCLNE----------NCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQ-GNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLA--CINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPR------------IECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICI---SPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLE--------CHSDYDCASNLACVSNEC----------VSPCGQRN--------PCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDD-GDCPSKLACIDDKCQ-------------DPCSVLSPC--HPTAQCS--VLNSVPVRTMVCECAE----------------YEVPDASGACRKMMPPRLPGCE-------SDQDCPDQEACIHAQCRNPCN------CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACI--NGDCINPC-------LINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCR------VIG--CSSNNDC-PTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDT------DC-------------PGRQACINEQCVD--PCV-VLEPCQRPAICEVTPTSPVRTMLCICPDGY---VSR----GKGGCKPTPGI-KEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDH-------------KPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTP----LGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPG-TVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVN-AFC-SVRDTLPVRT-MICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALE----------RGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCAD--NRFC---------------NLDTKTCED--PCLT-KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTN 21913          

HSP 25 Score: 75.8702 bits (185), Expect = 1.975e-12
Identity = 173/759 (22.79%), Postives = 257/759 (33.86%), Query Frame = -1
Query: 3983 PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDI-------DECGG-KINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKAL--------QCQAGEVCKLSLYGSVCEKIS---CNSSEI-----LINNECLPVNQVCQNIN--------CGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNG---------DVSCPNNSFCQNKDGSFHCACNVGFQRLENA-----LVTDSCTDIDECLLSE-------SCATNGECQNTIGSFKCECKDGFIGDGKYDCR-----------------IDSKCEKYGGCH-----EDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGK------SSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAND-------NTHNCSSLEKCVNSNGQYNCVC---GDGAVYVDDICVDIDECSSNQT-----------NKCSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDE--------CKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGW-----FCIKQTPCDV-----PNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK 5851
            PG C + A C  +  G +C C P   G  + +C+ I       DE    + + C  N +C  T G   CSC   Y         E  N  +C +   C  NY C       I+P         C   + C ++A       S  C CPE + G+    C   +    A+         C     C+     SVC+ +     N SEI      +N++C P ++ C +          CG +A C++ N    C C +G+ G+      + +                C  NS C+   G   C+C   F     +     +++  C     C+  +       +C  N +C     S  C C+ GF GD    C                  + S C  Y  C         SC+ N   +   C+     + +       +NL  +N K       +C   A C  +N T  C CP G+ GD +  C  +                 C +   C  +NGQ +C+    GD        CV   +C  N+              C  NA+C        C C E   G+  + C  I +             + C  NA C+ + G   C C AG  G    C  E               ++C  P   PG  +C  NAVC+       CEC   Y G  +       + + P  V     P+ C  N  CT  N N  A C C  +F+     C P+
Sbjct: 19191 PGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACR-NYKC-------IDPCP-----GSCGFSALCRVVAH------SPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDC-PSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAE-----CPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALC--NNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDP--CPG--KCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCT--NVNGQAECRCLQEFQGTPPNCRPE 19916          

HSP 26 Score: 74.7146 bits (182), Expect = 4.672e-12
Identity = 175/742 (23.58%), Postives = 248/742 (33.42%), Query Frame = -1
Query: 3983 SCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQD--------VNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINC--------GNHAFCKIENGRADCFCDSGYYGDG-ELCVD--VDECSNG--DVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNG---ECQNTIG----------SFKCECKDGFIGDGKYDCR------------------IDSKCEKYGGCHEDA-----SCIVNVESSIYEC--QCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDI-----------DECANDNTHNCSSLEKCVNSNGQYNCVC---GDGAVYVDDICVDIDECSSN---QTNK--------CSSNAICQNKEGTYSCQCAEGFYGDGLL-CHDIDECKF----GVANCSENALCINKPGTFACECQAGTLGNGTTCGDE---------------DECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWF------------CIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPK 5860
            +CLP  C   + C E      C C P Y G    +CR           C  + +C   +     +C +   R+   GLC  +  C   SH        C C  G E +P  +C++        ++ C + SPC I A+C +   +  CQC  +++G+P   C                                   E ++N++C P N+ CQ   C        G +A C + N    C C SGY GD    CV   V E  N      C  NS C+  +    C+C   +      +    CT   EC   ++C        C NT G          S  C C+ G+ GD  + C                   + + C  Y  C         SC+V    +   C  +C          +CI N  C      SC   AIC  +N T  C CP G+ GD ++ C  +           D C   N   C    +C  +NG   C+    GD        C+   +CS       NK        C+ NAIC        C C EG+ G+  + C              + C  N+ C        C C  G +G    C  E                +C  P   PG+  C  NA C   +    C C   + G  +              + Q PC  P+ C  N  C  + E   A C C  DF      C P+
Sbjct: 13951 TCLPSPCGPYSQCREVNESPSCTCLPEYIG-APPNCRP---------ECVTSSECPTNQ-----ACIQQKCRDPCPGLCGQSAECRVLSH-----TPSCVCPEGMEGDPFTLCKEKRIQELDQLDPC-SPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGC---------------------------------RPECVLNSDC-PSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAP-PVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACI-NEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPC---NPSPCGPNAQC--NNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDP--CPGS--CGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCR-PSPCGPNSECRAAGET--ATCTCLGDFVGSPPYCKPE 14623          

HSP 27 Score: 70.8626 bits (172), Expect = 6.497e-11
Identity = 47/128 (36.72%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9260 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECA----LLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRG 9631
            D NEC      CD+ A+CTN    F C C  G++G        NG  C D DEC       +C   ++C N P  F+C C  G+      +C D++EC  N   C  NA C NT G+Y C+C  G+ G
Sbjct:  129 DENECKQ--RPCDVFAHCTNTLGSFTCTCFPGYRG--------NGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG 245          

HSP 28 Score: 69.707 bits (169), Expect = 1.511e-10
Identity = 557/2614 (21.31%), Postives = 818/2614 (31.29%), Query Frame = -1
Query: 1328 TCSNDAFCDFKDDDYGCHCKNGFMGDG-IMCK-------DIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTC----TNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNP-CNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSVCSEIDECLLG---LHNCSRS----HQFCFNVNGGFECRCLSGY---KSDTNGSCVDENECRF----FDNGCDD--------NADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAXXXXXXXXXXXXXXXXXSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYL-DVFKDGKVCMAVPLSQCNQS-------CPTGQYCNNGSCSCL--------MGLNSQ----TDDDGNLNCSKNSASCL---PGICPLNANCEERLFGYICKCKPGYEGVGIKSCRD---------IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSH-------------GICGPNYICQ---------CKSGYEINPSGMC----------QDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQN---------------KCFEDKCKTK-ALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECL---PVNQV-CQNINCGNHAFCKIENGRADCFCDSGYYGDG-----ELCVDVDECSNGDV--------SCPN----NSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESC-----ATNGECQNTIGSFKCECKDGFIGDG---KYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDV---------PNACKANQTCTPSNENSLAICECKPDFKLE-----NDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQDKNE-----CDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNE--NNSSCKPID-----SCAMGLDNCDRK-VEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLK-------LDLSKKACTDR---NECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCED----IDECAIKTH--------PCHDL----ARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDV------KCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGD-VCYKKCSDIDECVTR------KSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCE-DQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGT--------------QICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSI-NSVCQDKADGFSCQCKPGFKWSD--------ETNLNCEDIDECTNPTSCSSMPHSICMNN------PGS-------------FECVCPHGFSLQGGY-------------CNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLP----------NGDCELINECLEN--IDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQN-ECEINIHSCQAS----NSECVDTYGSFKCVCKPGFSKNSDG---DCVDYDECEISEQSNMKFCNNGKCINTAGGF--------------TCDCPEGFIYNNYDCIDVDECSLDQVSS-----------LADNCDQVNGHCINTVGGFQCYCNRGFVMIEN--STKCVDIDECQFPNSCLDGLCNNL-PG-------------SFECLCNIGY-------------------------DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRS-------------------NGYECICKDGYQEDQIGICRNI 8056
            TC+ +A CD  +    C C     G+  I C+         D C    S C  N+ C+    +  CSC E F G    C    T+ ++C P   C    + C D  PG       GF        C   N       +C     +  N F         G  P P+        N C     C   YAKCT+      C+C   Y G   NC    EC +N  C   D  C+N       RC D   G  G N  C+ +  T    +CY    F    F + V   + +  +     + +  G  A C        C+CL  Y  +                       EC+  +      C +       +CRD      +LN      A C       TC C  G+ GD     +I E  +    ++ C  S    +  C   N    C CL  Y     +    CV   EC          C+D        NADC     + +C CRAG+ G        +    C  L  P +              +   N C+        + C   A C D  G+  C C   Y G   NC  +      C I               CPS        C  +RC + CP                                         C  N++C     +  C+C P ++ + F    V   +       S       C     CN G C+CL        +G   +    T+ D +  C +N   C+   PG C  NA CE      +C C P   G     CR          ID C  + + C  N  C N  G   CSC R +     S   E  +   C  H             G+CG N  C+         C   +  NP   C          + ++ CQ  SPC   A+C     + +C C   F G P N                C   KC+      C +   C +  +  +C  ++  +    ++ + +   P  Q  C    CG +A C   NG   C C   +YG+        CV   +C +            CP     N+ CQ +D    C C+VG+Q       +     + E + S  C       N +C+ +     C+C   FIG     + +C I S+C                               D   +C++ + C       C  +A C  +N +  C C  GF GD  + C  I      +  N +  + CV S                                C +   C+ +     C C  G+YG    C    EC     +C+ +  CI+                       ++C+ P   PG+  C   A C   +    C C SGY+G  +   ++TP            P+ C +N  C+P  +     C C PDF           C+  T+C  +   C R  S C   DP       PG   +G  C+ +N      C P +   A  +C          + S V   N  Q +   NN+ C+ ++     SC  G      K   +C  + D      C      +N  C D   C     +C   A C  +     C CP             L       R   N C  +P  CG  ++C N +    C+C+  Y     NC        EC I+          PC  L    A C  V     C C   + GD    C        R+ +       C + + C   G    C C   Y  +    C  + V    CS    C+ +        +C   A+C   +    C+C    +GD    C   Q E     H      S C              C C   Y   P                + C+++  C +P    C +NAIC   +    C C  G+      +C+++   +   D+  I    C     G   QC+  ++ +          T   C    ECT  + C S  H  C+N       PG+               C CP G+     Y                 ++   P+ CG N+ C+N V    CSC    +  P          + +C     C+ N  +D C    G+ + C        C CP G+  +     +C+    +  + +H CQ S    + EC +      C C+ G+  +      +CV   EC  S       C N KC +   G                C CP G+  + Y      EC L +  S           L   C   +  C N  G   C C   ++ +      +C+   EC    +C++  C +  PG                C+C  G                           ++  +   IN C  N   CG  A   C    G   C C   Y    G  Y  C+   EC+ LN  CP +  CV +                    +  +C C  GY  + +  C  +
Sbjct: 15713 TCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCY--PSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQR--QHCIDPCPGT-----CGF-----NALCHVVNH----APICSCPPKHNGNPF--------LGCFPEPVRRDEVIPKNPCQP-SPCGP-YAKCTSVGDQAQCSCLPEYIGTPPNCRP--ECITNSECSF-DKACLNQ------RCRDPCSGTCGSNANCHVISHTA---MCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETC----------------RPECVTNN-----DCPSNKACQQQKCRDPCPGVCALN------ALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTG--------DAFSRCLPL--PPSR---------PPQLDVYRNPCV-------PSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPE------CTINP------------DCPSHL-----SCQQQRCRDPCP---------------------------------------GACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNK--CIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPC--QPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQ-PSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSEC-------------------------------DLTLACVQQH-CVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPS-------------------------------PCGAFGQCRAQGNQAICSCLPGYYGAPPNCRP--ECAIN-PDCASHLACIS-----------------------EKCRDP--CPGS--CGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQ-----CSCLPDFDGNPYVGCRPECVLNTDCA-RDKACQR--SKCT--DPC------PGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTL-------VQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSD------CAPHLACLNQQCRD--PCPG---ACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSP--CGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPI-QREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSR-RCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRP--ECTQNSDCPS--HRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGV----CSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFV--LCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPS-----LACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYS-----ECHLIRADSSPIQRQPIDPCLPSPCGP-HAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNP--CG--ANAQCNQRRGVVSCVCLPDY---FGNPYEACRP--ECI-LNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPV 18004          

HSP 29 Score: 67.3958 bits (163), Expect = 6.255e-10
Identity = 54/148 (36.49%), Postives = 76/148 (51.35%), Query Frame = -1
Query: 9176 CDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTV--CNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG----DCEAVAICGCWGDPHCLSFDGNW 9598
            C  +A C NL + F C C  G++G G  E+      C D DEC   + C   + CTNTPG++ C+C  G+V   P    C D++ECS   ++C   A C N  GSY C+C PG+ G G       D +  A   C  +  CL+ DG++
Sbjct:  181 CVENAECCNLPAHFLCKCKDGYEGDG--EVL-----CTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-PNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSF 320          

HSP 30 Score: 66.2402 bits (160), Expect = 1.467e-9
Identity = 168/732 (22.95%), Postives = 228/732 (31.15%), Query Frame = -1
Query: 4013 CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQS-PCHILAQCINT---PGSY----KCQCPENFYGDP----------------QNKCFEDKCKTK-ALQCQAGEVCKLSLYGSVCE---------KISCNSSEIL-------------INNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDEC-SNGDVSCPNNSFCQNKDGSFHCACNVGFQRL-----------------ENALVTDSCTDIDECLLSE-------SCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDG-----LLCHDIDECKFGVANCSE------------NALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPE---------CDENAVCKNKDPGYTCECQSGYKGTGWFCIK-------------------QTPCDVPNACKANQTCTPSNENSLAICECKPDF 5857
            C P  C   ++C  R     C C P Y G    +CR           C IN DC ++       C     R+   G C  N VC    H    PN  C C++GY  NP   CQ       Q  P      C  +   P +     KC C   + GDP                   C + KCK      C    +C +  + + C           + C+                  I  +  P+N  CQ   CG ++ C+  + +A C+C   + G    C    EC SN D  CP + +C N      C    G + +                  N L+      I      E        C  N ECQ T G  +C C   + G   + CR   +C     C  D +C                          +N  C      SC  +A+C  V  +  C CP+G+ G+ Y  C+  +                                      V I  C+    + C  NA CQ       CQC  G+YG+        C    +C    A  SE            NALC     +  CEC  G +GN         C+ P+  P APE         C  N+ C+       C C   + GT   C                     Q PC  P AC  N  C   N + L  C C+P F
Sbjct: 18904 CYPSPCGPYSHCHNRFGVAACVCLPNYRGTP-PNCRP---------ECVINSDCPSSLACINEKC-----RDPCPGSCAYNAVCRVHEHV---PN--CYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINP-CQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRP--ECTSNSD--CPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF-CR--PECVNSADCPADKAC--------------------------RNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEP---------------------------------SPPAVVILPCNP---SPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGN-----PYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC--PGACGLNAQCHVRNHSPL--CSCQPGF 19536          

HSP 31 Score: 65.0846 bits (157), Expect = 2.887e-9
Identity = 63/198 (31.82%), Postives = 88/198 (44.44%), Query Frame = -1
Query: 15770 VDSCHLRDTSGCVCNDGFLRSGTT-------CTPKEQCG----CYDGDNNYKA------VGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEG--RADN-CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGY 16300
             + C+L     C C DG+   G         C   E CG    C +   NY        VG+  + + C   + CS        PNV C     C N    G   C C  GY+G  R+++ C D DEC+R    C  N DC+N  G++ CLC  G+ G+ +N C D +EC +    C   A C N  GS++C C +G+
Sbjct:  185 AECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSY-------PNV-CGPGAICTN--LEGSYRCDCPPGYDGDGRSESGCVDQDECARTP--CGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNP-CGLGAECVNLGGSFQCRCPSGF 369          

HSP 32 Score: 61.6178 bits (148), Expect = 3.483e-8
Identity = 54/160 (33.75%), Postives = 81/160 (50.62%), Query Frame = -1
Query: 13910 DCNKDG------ECHFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLNNGTCQNKLFCLGDADCAKSGKCFQN----------LCSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGD 14341
            DC+KDG       C  G CHC  G+ G    NC + +E   +  PC +  +C++T GS++C C   + R N   C++   C    D A + +C +N          LC C  G+EGDG++LC   +     N  NC  +A CT+  G+YTC C +G+ G+
Sbjct:   96 DCDKDGTKCTHGACLNGVCHCNDGYGG---CNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGY-RGNGFHCEDIDEC---QDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCT--DVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGN 246          

HSP 33 Score: 60.8474 bits (146), Expect = 6.518e-8
Identity = 152/651 (23.35%), Postives = 220/651 (33.79%), Query Frame = -1
Query: 4382 DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLS----QCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQTQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKI-ENGRADCFCDSGYYGDGEL---CV------DVDECSNGDV---------SCPNNS----------------FCQNKDGSFHCACNVGFQRLE----NALVTDS----------CTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGK-------YDCRIDSKCEKY-------------GGCHEDASCIVNVESSIYECQCHTEFSGDGITSCI-----KNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLL 6100
            D C  N++C N   + DC C     D F+        P      Q N+ CP  + C+  +  C+              C ++S       C  NA C     G  C+C PG+ G     C     C    + C  ++ C N + S  C C        +  LC+  N              +C+C  GY  NP   C    +    +PC + A C    G+  C CP+   G+P   C  +  +     C     C+      VC  +     +       LP N  C    CG +  C +  NG + C C   Y         CV      D + C  G +          CP+N                  CQ      +  C V   R E    +  V D+            D + C  + +C   G+     G   C C DG  GD         Y+C++D+ C                G C + A C V     +  C C++  +G+    C      K N C     S C  N+ C+ +N    C C  G+ GD  + C    EC              +NS+      CGD    ++  CV  D C+      C  NAIC  ++ T  C C +GF GD  L
Sbjct: 8575 DPCATNAVCINSNHAADCSC----ADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINP------------CQEDS-------CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSD-SECDSSQACINGKCSSPCQC-------GAYALCDVVNH-----------RGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNP-CDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGD-----GQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV--CSCNSGLTGNPGIRCYALDHPKKNPCV---PSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQ--PECD-------------INSD------CGDTLSCINHKCV--DPCAG---AICGINAICNVRQHTPVCLCLDGFVGDAFL 9146          

HSP 34 Score: 60.4622 bits (145), Expect = 7.145e-8
Identity = 64/220 (29.09%), Postives = 89/220 (40.45%), Query Frame = -1
Query: 9224 PCGLKNGCAGILGESKSSMMSRQCSCDTPDSSAAFSDSVLITNKTLLPIKSFILKLPPNAD---PVNSLVIGSLMCSSSKIDFNECST--NFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPG-DCEAVAI 9865
            PCGL   C  + G       S QC C     S    +     ++   P+ +  L   P A    P        L C    +D +EC+       C  +A C N    +RC C  G+QG G    Y +   C + +EC    C   + CT+T GSF+C C   +       C DI+EC+     C  +A C NT   Y C C  G+ G  +P   CE V +
Sbjct:  347 PCGLGAECVNLGG-------SFQCRC----PSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLAC----LDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQG----YLH---CENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDV 544          

HSP 35 Score: 60.077 bits (144), Expect = 9.336e-8
Identity = 47/164 (28.66%), Postives = 64/164 (39.02%), Query Frame = -1
Query: 9275 SSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGG-----------------------NEMY------------SNGRSCIDDDECALLKCP-----STSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTY-GSYICNCK 9643
            SS +D +EC T+   C  HA C N    + C+C  G+ G                          NE Y                 C+D DEC ++  P       + CTN+ G F C C  GF     + C D++EC   +S C A A+C+N   G Y C C 
Sbjct:  576 SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCP 739          

HSP 36 Score: 59.6918 bits (143), Expect = 1.383e-7
Identity = 66/201 (32.84%), Postives = 96/201 (47.76%), Query Frame = -1
Query: 9089 GSLMCSSSKIDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVK--AAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGD-CEAVAICG----CWGDPHCLSFDGNWLHYQGRCK--YTLVRDECRNGLPIESSTANF 9661
            G ++C+    D +EC  N  +C  +A CTN    + C C  G+ G   N  Y  G  C D DEC+    C   + CTN  GS+ C+C  G+     + + C D +EC+   + C  NADC+NT GS+ C C  G+  SG+P + CE V  C     C     C++  G+   +Q RC   + L  D   + LP   +T   
Sbjct:  206 GEVLCT----DVDECR-NPENCGPNALCTNTPGNYTCSCPDGYVG---NNPYREG--CQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECA--RTPCGRNADCLNTDGSFRCLCPDGY--SGDPMNGCEDVDECATNNPCGLGAECVNLGGS---FQCRCPSGFVLEHDPHADQLPQPLNTQQL 389          

HSP 37 Score: 59.3066 bits (142), Expect = 1.621e-7
Identity = 51/206 (24.76%), Postives = 84/206 (40.78%), Query Frame = -1
Query: 15575 VQCHEYGECFNSTASGESECRCKKGYEGRA-DNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGS---ICSQIPIIAVNPDQTNCSFHQD----------------ASCDQLATCVDHAD------------GSFTCDCTEGSFGDGLQGANQTGC 16093
             +C    +C N    G   C C  G++G+   +C +I+EC      C +N  C + +G++ C CK  + G+    C D +EC +    C  +A C NT   Y C C  GY+G       C Q+ +  +     +C+ + +                +SC  +  C  HA+            GS+ C+C  G  G   + A +  C
Sbjct:  424 AKCGTNAKCIN--FPGSYRCLCPSGFQGQGYLHCENINECQDNP--CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPC 625          

HSP 38 Score: 58.5362 bits (140), Expect = 2.813e-7
Identity = 43/128 (33.59%), Postives = 62/128 (48.44%), Query Frame = -1
Query: 9257 IDFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSDCTNTPGSF--ICNCHVGFVKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGS 9634
            +D +EC+     C  HA C N   G+ C C +G+ G    ++     +C   D    + C S  DCTN        C C  GF     + C DI+EC  ++ +C  +A C+NT GSY C C+ G+ GS
Sbjct:  496 VDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKV-----ACEQVD--VNILCSSNFDCTNNAECIENQCFCLDGFEPIG-SSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGS 615          

HSP 39 Score: 57.7658 bits (138), Expect = 5.629e-7
Identity = 217/957 (22.68%), Postives = 314/957 (32.81%), Query Frame = -1
Query: 1133 SSKDSSYTCQCIEGFQ---RINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCE-----DIDECAIKT----HPCHDLARCSNVPGSCKCK-------------CQPGFTGD---GIYSCIETDSC--PARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECI--GDVCYKKCSDIDECVTRK--SACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNP-VENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENIN----ECEEKSD--------NCSINSVCQDKADGFS---CQ---CKPGFKWSDE-------TNLNCED-------------------IDECTNPTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPN-SCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCEN---QNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLAD-NCDQVNGHCINTVGGFQ-CYCNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPG-SFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSG-----------------------GKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGDGIVSCKA------ICGPNSCLPGQLCQIVNGNQYDCGC 3658
            +++     C C  GF    R+   C  +D C D    C   A C N  GSY C CP  L  D   + C    EC+ N   C   + C  T+G  +C+ V      G N E      + +CA ++     P   +A C  +P  C+               C+P    D   G +   +   C  P      C   + C M  +   C+C  G+   +  EC+     C  +C     C        CH   EC +N+          L G    TC   N+C L  H C  N                + CH  +       ++ C N ++C+NP +EN C  NA C  +     C C       P+ +   +     EC E  D              +C D A   +   CQ   CKP  +  +E         LNC                     +D C +PT+C +  H  C       +C+CP G             C +P  +CG+N  C +    +  SC    R   + +C     C+     C+ +   D  C                      Q+CEN   Q  C  ++ SC A++  CV+     KC   P  +    G C D                   C+    G  C CP  F+ +      +  C L       D  CD+   +C       + C C +     +   KC    +C     C  G C  + G      C      VNGKC+D   C+N  + CG  A  +C  +     C C  GYE                          GK  NPC     C        +NAQC       +C C   +  +    CR +        C   + C +  G Y+C C  G  GD    C         C    C     C ++  NQ +C C
Sbjct: 2726 TTEHHQQVCHCQPGFSGDPRVR--CDVIDFCRDA--PCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETN-EDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKC--------LKGSCMLTCRVDNDCFL-GHVCLHNKCV-------------YGCHVDDDCS---ASESCRN-DKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAH--CQTIDHRKQCLCPEGLDGNANV-----ACKVPRIACGRNEDCQSNQLCYAGSCQGKCRN--DQNCLADERCMRGT--CRTVCNTDEACAQG-------------------QICENRMCQTGCRTDL-SC-ATDEACVNK----KCQ-NPCRTPGQCGQCAD-------------------CLVVNHGVQCQCPAAFMGDG-----LTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGAC--IAGCKSNGDCAADQSCVNGKCSD--PCANE-KACGRNA--LCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACG-------TNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYC 3576          

HSP 40 Score: 56.9954 bits (136), Expect = 8.693e-7
Identity = 41/119 (34.45%), Postives = 57/119 (47.90%), Query Frame = -1
Query: 15875 TPKEQCGCYDGDNNYKAVGDIWFTDFCSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGRAD-NCTDIDECS-RGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN 16225
            TP+ QC      + YK VG+      CS+   C                  EC  S A G S C C KGY+ + D +C D+DEC  RG+ +C+    CVN+ G+Y+C C  G+ G+  N
Sbjct:  963 TPECQC-----QSPYKLVGNSCVLSGCSSGQACPSG--------------AECI-SIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYN 1061          

HSP 41 Score: 56.9954 bits (136), Expect = 1.002e-6
Identity = 52/166 (31.33%), Postives = 78/166 (46.99%), Query Frame = -1
Query: 13892 AKDSDCNKDGEC-----HFGQCHCKVGFKGDGLANCSNINECLNEVNPCSINENCSDTNGSYSCNCKTDFVRLN--NGTCQNKLFCLGDADCAKSGKCFQNL-----CSCNLGFEGDGKLLCKXXXXXXXXXXXXXXESATCTDQIGSYTCKCNNGFQGDGTHDCH 14353
            A  + C ++ EC     HF  C CK G++GDG   C++++EC N  N C  N  C++T G+Y+C+C   +V  N     CQ+   C     C     C  NL     C C  G++GDG+       +        C  +A C +  GS+ C C +G+ GD  + C 
Sbjct:  176 AIAARCVENAECCNLPAHF-LCKCKDGYEGDGEVLCTDVDECRNPEN-CGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICT-NLEGSYRCDCPPGYDGDGRSE-SGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE 337          

HSP 42 Score: 56.225 bits (134), Expect = 1.739e-6
Identity = 166/695 (23.88%), Postives = 227/695 (32.66%), Query Frame = -1
Query: 6371 CSNDAFCDFKDDDYGCHCKNGFMGD----------GIMCKDIDECSNNTS--------------VCDSNAFCKNTIGSFSCSCKEGFEGNGV---------TCTNINECYPLSPCDNATEECFDK------------VP---GYECRCQKGFMKNT-----------TTGNCDDRNECAD----------TGNLCDRVSTNCNNTFGSYRCDCKYGFRP-----SPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDG-RNC-TDIDECSSNKVCQRPDATCVNLPGSYECRCL---DGTP---GCD-GDNPCNTVQCTKPNEICYL-----GQCFCKHGF--QNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSXXXXXXXXXXXXXNLHQ---CGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGDGSV--------------CSEIDECL-------------LGLH-NCSRSHQFC-----FNVNGGFECRCLSGYKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLE-------ECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGI 8053
            C+  A C  K     C C  G  G+           I C D  +C    +               C +NA C N+  +  CSC +GF+GNG           C    +C P   CD     C +             +P   G ECRC  GF+ N            +   CD    C +             LCD V     N  G  +C   Y   P      P D     D N C L   C+ +        G+  C C  G  G+  +NC  + DEC+ N     P++ C  + G+  C CL   +G P    C+   NPC+   C  PN  C +      +C C   +    N      E I+ CD   N C G  A C   D S    C              +       L Q   CG NAEC        C C++G+ G   + CR+        N C  +        G   C C +G SGD +               C     C+              G H      H  C        N G  C  L   K         +N C    + C  N++C   +   +C C  GY+G     DPQ G +       +CG  L      C+N  C+               D C     C +NA C     + +C C +G++GD  
Sbjct: 8512 CAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVV-----NHRGVCKCPPGYNGNPKVGCSPPQDPC---DPNPCGLNALCELDN-------GNPICYCPKGLTGNPFKNCIPEGDECTPNPC--GPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPC-GPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCD--PNPC-GTGAIC---DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPK---------KNPC--VPSPCGRNSECKLLNNRAVCSCIPGYLG-----DPQSGCQPECDINSDCGDTL-----SCINHKCV---------------DPCAGAI-CGINAICNVRQHTPVCLCLDGFVGDAF 9145          

HSP 43 Score: 55.0694 bits (131), Expect = 3.599e-6
Identity = 157/695 (22.59%), Postives = 222/695 (31.94%), Query Frame = -1
Query: 4385 CQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNN--------GSCS----CLMGLNS-----QTDDDGN--LNCSKNSAS------------CLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNN