SMED30010552

Overview
NameSMED30010552
Smed IDSMED30010552
Length (bp)3094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010552 (SMED30010552) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010552 (SMED30010552) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010552 (SMED30010552) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010552 (SMED30010552) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010552

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010552h1SMcG0017922 dd_Smed_v6_46853_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30010552h1SMcG0017922 Contig17811uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010552h1SMcG0017922 Contig17811newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010552 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003655:30795..48050 -15127
Homology
BLAST of SMED30010552 vs. Planmine SMEST
Match: SMESG000020174.1 (SMESG000020174.1)

HSP 1 Score: 1201.81 bits (3108), Expect = 0.000e+0
Identity = 632/704 (89.77%), Postives = 642/704 (91.19%), Query Frame = 2
Query:  398 NATQFL-NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNMEINFEYALIHAQCVKRLEENTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNIMSKKHLKLMXXXXXXXXXXXXXNDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEKSKFKILDQINPESFKQESSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDKLYEVVQDRDNLIKHAKVMEEHLYKLRSENNYYQVMMSSGVLPDNYMQRVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 2506
            N+ +FL NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFN EINFEYAL HAQCV RLEE+TSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNI SKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK                +SSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK                      +  R+   + Q+            ++VPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF
Sbjct:  232 NSLKFLKNITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNTEINFEYALFHAQCVTRLEESTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNITSKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK----------------KSSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK----------------------FNGRA---FIQI------------EKVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 882          

HSP 2 Score: 226.868 bits (577), Expect = 6.985e-61
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 1
Query:   70 TKDSGAISKISENDQNDQNDISKYVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 414
            TKDSGAISKISENDQNDQNDISK VKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS
Sbjct:   41 TKDSGAISKISENDQNDQNDISKNVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 155          

HSP 3 Score: 160.229 bits (404), Expect = 1.089e-39
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 2
Query: 2714 EIAKSDPVNMNQNANVPVSSGTVIEMPKSRXXXXXXXXXYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMRXXXXXXXXXXXXXXXXATLRKILRQCKVFKMVP 3031
            EIAKSDPVNMNQNANVPVSSGTVIEMPKSREELKELEKLYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMREQELLEEDLDQCDKKLATLRKILRQCKVFKMVP
Sbjct:  952 EIAKSDPVNMNQNANVPVSSGTVIEMPKSREELKELEKLYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMREQELLEEDLDQCDKKLATLRKILRQCKVFKMVP 1057          
BLAST of SMED30010552 vs. Planmine SMEST
Match: SMESG000020174.1 (SMESG000020174.1)

HSP 1 Score: 1201.04 bits (3106), Expect = 0.000e+0
Identity = 632/704 (89.77%), Postives = 642/704 (91.19%), Query Frame = 2
Query:  398 NATQFL-NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNMEINFEYALIHAQCVKRLEENTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNIMSKKHLKLMXXXXXXXXXXXXXNDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEKSKFKILDQINPESFKQESSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDKLYEVVQDRDNLIKHAKVMEEHLYKLRSENNYYQVMMSSGVLPDNYMQRVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 2506
            N+ +FL NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFN EINFEYAL HAQCV RLEE+TSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNI SKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK                +SSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK                      +  R+   + Q+            ++VPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF
Sbjct:  231 NSLKFLKNITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNTEINFEYALFHAQCVTRLEESTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNITSKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK----------------KSSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK----------------------FNGRA---FIQI------------EKVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 881          

HSP 2 Score: 226.868 bits (577), Expect = 6.171e-61
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 1
Query:   70 TKDSGAISKISENDQNDQNDISKYVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 414
            TKDSGAISKISENDQNDQNDISK VKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS
Sbjct:   40 TKDSGAISKISENDQNDQNDISKNVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 154          

HSP 3 Score: 160.229 bits (404), Expect = 1.060e-39
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 2
Query: 2714 EIAKSDPVNMNQNANVPVSSGTVIEMPKSRXXXXXXXXXYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMRXXXXXXXXXXXXXXXXATLRKILRQCKVFKMVP 3031
            EIAKSDPVNMNQNANVPVSSGTVIEMPKSREELKELEKLYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMREQELLEEDLDQCDKKLATLRKILRQCKVFKMVP
Sbjct:  951 EIAKSDPVNMNQNANVPVSSGTVIEMPKSREELKELEKLYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMREQELLEEDLDQCDKKLATLRKILRQCKVFKMVP 1056          
BLAST of SMED30010552 vs. Planmine SMEST
Match: SMESG000020174.1 (SMESG000020174.1)

HSP 1 Score: 1200.65 bits (3105), Expect = 0.000e+0
Identity = 632/704 (89.77%), Postives = 642/704 (91.19%), Query Frame = 2
Query:  398 NATQFL-NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNMEINFEYALIHAQCVKRLEENTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNIMSKKHLKLMXXXXXXXXXXXXXNDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEKSKFKILDQINPESFKQESSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDKLYEVVQDRDNLIKHAKVMEEHLYKLRSENNYYQVMMSSGVLPDNYMQRVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 2506
            N+ +FL NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFN EINFEYAL HAQCV RLEE+TSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNI SKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK                +SSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK                      +  R+   + Q+            ++VPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF
Sbjct:  231 NSLKFLKNITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNTEINFEYALFHAQCVTRLEESTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNITSKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK----------------KSSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK----------------------FNGRA---FIQI------------EKVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 881          

HSP 2 Score: 226.483 bits (576), Expect = 4.868e-61
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 1
Query:   70 TKDSGAISKISENDQNDQNDISKYVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 414
            TKDSGAISKISENDQNDQNDISK VKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS
Sbjct:   40 TKDSGAISKISENDQNDQNDISKNVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 154          

HSP 3 Score: 53.1434 bits (126), Expect = 1.112e-6
Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 2
Query: 2714 EIAKSDPVNMNQNANVPVSSGTVI 2785
            EIAKSDPVNMNQNANVPVSSGTVI
Sbjct:  951 EIAKSDPVNMNQNANVPVSSGTVI 974          
BLAST of SMED30010552 vs. Planmine SMEST
Match: SMESG000020174.1 (SMESG000020174.1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 632/704 (89.77%), Postives = 642/704 (91.19%), Query Frame = 2
Query:  398 NATQFL-NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNMEINFEYALIHAQCVKRLEENTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNIMSKKHLKLMXXXXXXXXXXXXXNDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEKSKFKILDQINPESFKQESSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDKLYEVVQDRDNLIKHAKVMEEHLYKLRSENNYYQVMMSSGVLPDNYMQRVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 2506
            N+ +FL NITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFN EINFEYAL HAQCV RLEE+TSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNI SKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK                +SSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK                      +  R+   + Q+            ++VPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF
Sbjct:  232 NSLKFLKNITENQTQQSIAKSEVTEQRGNRSKSLILPKYSQKGLNNVIKQPSVSVSPIIKIRNKFQNKELNFRGEISNSEIKRYNFKILESHKIFDKNSNSDFLTKIDMKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLFTCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEASEAFLDKFPYEKLNSSFNTEINFEYALFHAQCVTRLEESTSKNLSLSFEQEYNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMRVKNDNLLVAVNEKCKQKMNITSKKHLKLMEITIQQEIILELINDKISDIFNNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSFSVNESRPNHGESLSNIMHQRLQNNEK----------------KSSMLISFKQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEKREIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQLFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITLEETEDK----------------------FNGRA---FIQI------------EKVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHF 882          

HSP 2 Score: 226.483 bits (576), Expect = 5.329e-61
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 1
Query:   70 TKDSGAISKISENDQNDQNDISKYVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 414
            TKDSGAISKISENDQNDQNDISK VKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS
Sbjct:   41 TKDSGAISKISENDQNDQNDISKNVKAQPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKSSNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAIS 155          

HSP 3 Score: 53.1434 bits (126), Expect = 1.161e-6
Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 2
Query: 2714 EIAKSDPVNMNQNANVPVSSGTVI 2785
            EIAKSDPVNMNQNANVPVSSGTVI
Sbjct:  952 EIAKSDPVNMNQNANVPVSSGTVI 975          
The following BLAST results are available for this feature:
BLAST of SMED30010552 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010552 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020174.16.985e-6189.77SMESG000020174.1[more]
SMESG000020174.16.171e-6189.77SMESG000020174.1[more]
SMESG000020174.14.868e-6189.77SMESG000020174.1[more]
SMESG000020174.15.329e-6189.77SMESG000020174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010552 ID=SMED30010552|Name=SMED30010552|organism=Schmidtea mediterranea sexual|type=transcript|length=3094bp
AAATCTTATATGAGTGAGATTTCAAATAATTCTGAACTCCACAATGAAAA
TGAATCTCTCAATAAAGAAACAAAAGATTCAGGTGCAATTAGCAAAATAT
CGGAAAATGATCAAAATGATCAAAACGATATCAGTAAATATGTTAAAGCT
CAACCATCCAATCAAATTAAGCGTAGAAGCGTTTTACAGCGGTCAATAAA
TGGAAAATCGAAATTTAATTCAGAAAATGTCGAAATCCTTCACGAGTCAA
CTGGAAAGGAACTAAACATTTTTGGCCAAAGAAATTTGCATGCTAAAAGT
TCAAACCGAATACCAAGTTATGACAAAAGTTTAATCTCAAATCAAAACAA
TAAACTTTTATCAAACAGATCAAATACGGATTTTCATAACAAATTGAAAT
GCGACGCAATTTCTAAACATTACAGAAAATCAGACGCAGCAAAGCATAGC
AAAATCAGAAGTCACTGAACAACGTGGAAACAGGTCTAAATCACTCATAC
TGCCTAAATATTCACAAAAGGGTTTAAATAATGTTATTAAGCAGCCGAGT
GTTTCTGTATCACCAATAATAAAAATTCGAAATAAATTCCAAAATAAGGA
GTTAAATTTTAGAGGAGAAATCTCTAACTCAGAGATTAAAAGATATAATT
TCAAAATCTTAGAAAGTCATAAAATTTTTGATAAAAATTCTAATTCCGAT
TTCTTAACAAAAATTGATATGAAAAATCAAAGTGATTTAAATGGTAAAAT
TATAAAAAAAGAATTAGACAATGTTAAAGAGGAAATGAAGCGTATATCTA
AAGTTAAAAATCCTATGTCCATAATATCTGATAATAGTGATACTTTAAAC
ACTTTTGAGTCCCTCTTCACTTGTGATGAAATCTCTAAATTAAATGGGAC
AGACGAATCTGATTACGTTGAATCTTTCACAAAAGTGAAATTTGCTAGAA
ATTTCGAATGTGAAATAGAGGATATGTTATTCGACGTCGAAAATACAATT
GAATGTAATGAGGCTTCTGAAGCTTTTCTAGACAAGTTTCCATATGAAAA
ATTAAATTCATCTTTTAACATGGAAATTAATTTCGAATACGCATTAATTC
ATGCGCAATGTGTCAAGCGTTTAGAAGAGAATACTTCGAAAAATCTGAGT
CTGTCATTTGAACAAGAATACAACAAAGAAATAGAAAAACATAGAAAACC
TCCAATGGTTCCGCTTAAAGAACCTGAAATAGAAAGAAAACGAATATATG
TGACAGTTTTAGAGGATGTTTTTCAGTTTTTTCTCGATATATTTGTCGAT
TTTATCGTAGCTATGAGAGTAAAAAATGACAATCTTCTAGTTGCTGTCAA
TGAAAAATGCAAACAAAAAATGAATATAATGAGTAAAAAACATTTGAAAT
TAATGGAAATTACCATCCAACAAGAAATAATATTGGAATTAATAAATGAT
AAAATTAGTGACATATTCAACAACAACGAATATATGCGAAATGTTTCCAA
TCCGAAATGTTTATCATCGAAATGGCTAGATGATATCGCTAATTTGAAGT
CCACAACGAATGGTTTTAAGGCCTTGGAGAATAACGGGGAAAATAAATCA
TATCTTTCCAGCTCCTTTTCTGTGAATGAATCAAGGCCAAACCACGGTGA
ATCATTATCGAATATAATGCACCAACGACTTCAAAATAATGAAAAAAGTA
AATTCAAAATTTTAGATCAAATTAATCCAGAATCATTTAAACAAGAATCA
TCTATGCTTATCTCATTTAAACAAGCAATACTAAAATACGAAATGAAATT
CCGAAAATTGAGTGAAGAAAAAAGCATTCTTTTAAAAGAAAACACAGATT
TATTGGAGCAAAACAGAAATCTTCAAAAGCGTCACAGTGTCCTGCTAAAT
GAATATAAACAAGAAAAACGAGAGATCATATTCATCAAAACTCAGATTGA
TGTGATGATTTCCAGGCTGCAATCCATTCCTGAAAAACTAATTCAACTCG
AAGATGAAAATGAAAATCTCAAATCTGAAGTTAGCGATTTAGAGCGCACT
CTAGTTCAAAGAGACCAACTTTTTAACAGTGAGCGTCAAATAAACGCAAA
CCTCAGTGAAGAGATCATAAAGCTAGAAGCTGATACGGTTGACAAGGAAT
TGATGAAAAATGTTTGTGACGAATTTGAGAATCTAAATGATGAATATGAA
ACATTGAAAATCACATTGGAGGAGACAGAGGATAAATTGTATGAAGTTGT
TCAAGATAGAGATAATTTAATTAAACATGCCAAAGTAATGGAAGAGCATT
TATACAAATTGAGAAGTGAAAATAATTATTATCAAGTCATGATGTCGTCA
GGAGTACTTCCGGATAATTATATGCAAAGAGTTCCAGATAACAGAGAGAA
TATTGATTCAATGCAAAATAATCAAAATGTGCCGCAAGCAAATGAAAAAC
ATGAATACGAAAACAGGGCGAAGATGTACCATGAACCGCGTAGTTGCAGA
CATTTTAGGAGCAGAGGTCATTCACATCGTTCAAATCACTCGTATAGCTC
ATCATCCACATCTTCGGGATATTCAAATTCTTCCTCGGGATCAGAAAAAA
GACATAAGAAAAAAAGGAAAAAGTCTCACAAGCACAAGCATAAAGAAAGT
CATTCACATAAGCATTCGTCCCATAAAAAGAATAAAAAACACTCACGACA
CAGTAAAAATGAAGAAATTGCAAAATCGGACCCAGTAAACATGAATCAAA
ATGCAAACGTCCCAGTCTCATCAGGAACCGTTATAGAAATGCCGAAAAGC
CGAGAAGAGTTAAAGGAGTTGGAAAAGTTATATGACAGTTTACAGATGAA
GAAAAATAAATTAGAAGGTGAACTTAGCCATGTTCCTATAAGTAAAGGAA
CTTCCAATACATCAAATTTGACAAATATGAGAGAGCAGGAATTATTGGAA
GAGGACTTAGATCAGTGTGATAAAAAATTAGCAACATTACGTAAAATTTT
GAGGCAATGCAAGGTATTCAAAATGGTACCTTAAAAGGCATTACATTTAT
TTAAAATAAATTTTATTGGTGGCTTTTACTGCAGATCGGAAGAG
back to top

protein sequence of SMED30010552-orf-1

>SMED30010552-orf-1 ID=SMED30010552-orf-1|Name=SMED30010552-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=772bp
MKNQSDLNGKIIKKELDNVKEEMKRISKVKNPMSIISDNSDTLNTFESLF
TCDEISKLNGTDESDYVESFTKVKFARNFECEIEDMLFDVENTIECNEAS
EAFLDKFPYEKLNSSFNMEINFEYALIHAQCVKRLEENTSKNLSLSFEQE
YNKEIEKHRKPPMVPLKEPEIERKRIYVTVLEDVFQFFLDIFVDFIVAMR
VKNDNLLVAVNEKCKQKMNIMSKKHLKLMEITIQQEIILELINDKISDIF
NNNEYMRNVSNPKCLSSKWLDDIANLKSTTNGFKALENNGENKSYLSSSF
SVNESRPNHGESLSNIMHQRLQNNEKSKFKILDQINPESFKQESSMLISF
KQAILKYEMKFRKLSEEKSILLKENTDLLEQNRNLQKRHSVLLNEYKQEK
REIIFIKTQIDVMISRLQSIPEKLIQLEDENENLKSEVSDLERTLVQRDQ
LFNSERQINANLSEEIIKLEADTVDKELMKNVCDEFENLNDEYETLKITL
EETEDKLYEVVQDRDNLIKHAKVMEEHLYKLRSENNYYQVMMSSGVLPDN
YMQRVPDNRENIDSMQNNQNVPQANEKHEYENRAKMYHEPRSCRHFRSRG
HSHRSNHSYSSSSTSSGYSNSSSGSEKRHKKKRKKSHKHKHKESHSHKHS
SHKKNKKHSRHSKNEEIAKSDPVNMNQNANVPVSSGTVIEMPKSREELKE
LEKLYDSLQMKKNKLEGELSHVPISKGTSNTSNLTNMREQELLEEDLDQC
DKKLATLRKILRQCKVFKMVP*
back to top

protein sequence of SMED30010552-orf-2

>SMED30010552-orf-2 ID=SMED30010552-orf-2|Name=SMED30010552-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
KSYMSEISNNSELHNENESLNKETKDSGAISKISENDQNDQNDISKYVKA
QPSNQIKRRSVLQRSINGKSKFNSENVEILHESTGKELNIFGQRNLHAKS
SNRIPSYDKSLISNQNNKLLSNRSNTDFHNKLKCDAISKHYRKSDAAKHS
KIRSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 368..402
NoneNo IPR availableCOILSCoilCoilcoord: 479..506
NoneNo IPR availableCOILSCoilCoilcoord: 691..718
NoneNo IPR availableCOILSCoilCoilcoord: 417..451
NoneNo IPR availableCOILSCoilCoilcoord: 740..760
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 605..623
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 626..660
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 596..679