C-ets-1-like

Overview
NameC-ets-1-like
Smed IDSMED30010549
Length (bp)1773
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-ets-1-like (SMED30010549) t-SNE clustered cells

Violin plots show distribution of expression levels for C-ets-1-like (SMED30010549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-ets-1-like (SMED30010549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-ets-1-like (SMED30010549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30010549SMESG000065612.1 dd_Smed_v4_2092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-ets-1-like vs. Ensembl Human
Match: ETS1 (ETS proto-oncogene 1, transcription factor [Source:HGNC Symbol;Acc:HGNC:3488])

HSP 1 Score: 150.214 bits (378), Expect = 3.488e-41
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  117 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 209          
BLAST of C-ets-1-like vs. Ensembl Human
Match: ETS1 (ETS proto-oncogene 1, transcription factor [Source:HGNC Symbol;Acc:HGNC:3488])

HSP 1 Score: 150.599 bits (379), Expect = 6.029e-40
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  246 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 338          
BLAST of C-ets-1-like vs. Ensembl Human
Match: ETS2 (ETS proto-oncogene 2, transcription factor [Source:HGNC Symbol;Acc:HGNC:3489])

HSP 1 Score: 151.754 bits (382), Expect = 2.081e-39
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N +
Sbjct:  361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 450          
BLAST of C-ets-1-like vs. Ensembl Human
Match: ETS2 (ETS proto-oncogene 2, transcription factor [Source:HGNC Symbol;Acc:HGNC:3489])

HSP 1 Score: 151.754 bits (382), Expect = 2.081e-39
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N +
Sbjct:  361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 450          
BLAST of C-ets-1-like vs. Ensembl Human
Match: ETS2 (ETS proto-oncogene 2, transcription factor [Source:HGNC Symbol;Acc:HGNC:3489])

HSP 1 Score: 151.754 bits (382), Expect = 2.081e-39
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N +
Sbjct:  361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 450          
BLAST of C-ets-1-like vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 120.939 bits (302), Expect = 8.592e-31
Identity = 62/127 (48.82%), Postives = 77/127 (60.63%), Query Frame = 2
Query: 1064 NADSTQLKVNEQGLASTSNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            N D+T+L       AS  + +    ST  +  P  I  +      G IQLWQFLL  L +  +   I+W G+  EFKL +PDEVAR+WG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   28 NPDTTRLADGCMQYASALSRIPSSNSTSASKGPMAIALSAT--GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKF 152          
BLAST of C-ets-1-like vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 117.087 bits (292), Expect = 8.027e-30
Identity = 58/113 (51.33%), Postives = 71/113 (62.83%), Query Frame = 2
Query: 1106 ASTSNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            AS  + +    ST  +  P  I  +      G IQLWQFLL  L +  +   I+W G+  EFKL +PDEVAR+WG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:    4 ASALSRIPSSNSTSASKGPMAIALSAT--GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKF 114          
BLAST of C-ets-1-like vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 115.161 bits (287), Expect = 1.062e-27
Identity = 51/86 (59.30%), Postives = 60/86 (69.77%), Query Frame = 2
Query: 1187 HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            H   G  QLWQFLL  L +    + I+W G   EFKL +PDEVAR+WG RK+KP MNY+K+SR LRYYYDK I+ K  GKRY YKF
Sbjct:  208 HSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKF 293          
BLAST of C-ets-1-like vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 98.5969 bits (244), Expect = 6.839e-22
Identity = 45/82 (54.88%), Postives = 57/82 (69.51%), Query Frame = 2
Query: 1205 IQLWQFLLGELCNPSSEQFISWT-GNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFI 1447
            I LWQFLL  L    +   I WT G   EF+L + + VAR+WG RK KP MNY+KLSR LRYYY+K II+K  GK++VY+F+
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRFV 105          
BLAST of C-ets-1-like vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 98.5969 bits (244), Expect = 6.839e-22
Identity = 45/82 (54.88%), Postives = 57/82 (69.51%), Query Frame = 2
Query: 1205 IQLWQFLLGELCNPSSEQFISWT-GNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFI 1447
            I LWQFLL  L    +   I WT G   EF+L + + VAR+WG RK KP MNY+KLSR LRYYY+K II+K  GK++VY+F+
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRFV 105          
BLAST of C-ets-1-like vs. Ensembl Fly
Match: pnt (gene:FBgn0003118 transcript:FBtr0334554)

HSP 1 Score: 153.68 bits (387), Expect = 1.977e-39
Identity = 71/112 (63.39%), Postives = 84/112 (75.00%), Query Frame = 2
Query: 1142 TDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            T    +PC           GPIQLWQFLL  L + + + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + H+
Sbjct:  503 TTQGGVPCFT-------GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHT 607          
BLAST of C-ets-1-like vs. Ensembl Fly
Match: pnt (gene:FBgn0003118 transcript:FBtr0089715)

HSP 1 Score: 153.295 bits (386), Expect = 2.156e-39
Identity = 71/112 (63.39%), Postives = 84/112 (75.00%), Query Frame = 2
Query: 1142 TDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            T    +PC           GPIQLWQFLL  L + + + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + H+
Sbjct:  501 TTQGGVPCFT-------GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHT 605          
BLAST of C-ets-1-like vs. Ensembl Fly
Match: pnt (gene:FBgn0003118 transcript:FBtr0089717)

HSP 1 Score: 151.754 bits (382), Expect = 1.702e-38
Identity = 71/112 (63.39%), Postives = 84/112 (75.00%), Query Frame = 2
Query: 1142 TDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            T    +PC           GPIQLWQFLL  L + + + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + H+
Sbjct:  596 TTQGGVPCFT-------GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHT 700          
BLAST of C-ets-1-like vs. Ensembl Fly
Match: pnt (gene:FBgn0003118 transcript:FBtr0089716)

HSP 1 Score: 150.599 bits (379), Expect = 2.445e-38
Identity = 71/112 (63.39%), Postives = 84/112 (75.00%), Query Frame = 2
Query: 1142 TDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            T    +PC           GPIQLWQFLL  L + + + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + H+
Sbjct:  514 TTQGGVPCFT-------GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHT 618          
BLAST of C-ets-1-like vs. Ensembl Fly
Match: Ets96B (gene:FBgn0039225 transcript:FBtr0339254)

HSP 1 Score: 130.183 bits (326), Expect = 1.735e-31
Identity = 55/87 (63.22%), Postives = 69/87 (79.31%), Query Frame = 2
Query: 1196 RGPIQLWQFLLGELCNPS-SEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMD 1453
            RG +QLWQFL+  L  P+ S   I+WTG G EFKL EP+EVARRWGL+KN+P MNY+KLSR LRYYY+K I++K  G+RYVY+F+ D
Sbjct:  486 RGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCD 572          
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Match: ets2 (v-ets avian erythroblastosis virus E26 oncogene homolog 2 [Source:ZFIN;Acc:ZDB-GENE-050522-552])

HSP 1 Score: 148.673 bits (374), Expect = 1.290e-38
Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + + +  ISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N + ++
Sbjct:  331 GPIQLWQFLLELLTDSTCQSIISWTGDGWEFKLTDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGYT 423          
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Match: etv5a (ETS variant transcription factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-9572])

HSP 1 Score: 138.272 bits (347), Expect = 1.480e-34
Identity = 67/137 (48.91%), Postives = 91/137 (66.42%), Query Frame = 2
Query: 1187 HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESYAV 1597
            +  RG +QLWQFL+  L +PS+  FI+WTG G EFKL EP+EVARRWG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+ D       +    ++P+L A    G  +V+    T P +  +   SY V
Sbjct:  371 YQRRGSLQLWQFLVTLLDDPSNGHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPNLKA-DPDGLPTVDD--DTLPLAHYDDGSSYLV 504          
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Match: etv2 (ETS variant transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-050622-14])

HSP 1 Score: 134.42 bits (337), Expect = 2.347e-34
Identity = 62/90 (68.89%), Postives = 72/90 (80.00%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + +   FISWTG+G+EFK+ +P EVA+RWG  KNKPKMNYEKLSRGLRYYY K II KTAGKRYVY+F+ DV   +
Sbjct:  228 GPIQLWQFLLELLLDSACHTFISWTGDGWEFKMSDPAEVAKRWGQCKNKPKMNYEKLSRGLRYYYHKNIIHKTAGKRYVYRFVCDVQGML 317          
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Match: etv2 (ETS variant transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-050622-14])

HSP 1 Score: 134.42 bits (337), Expect = 2.942e-34
Identity = 62/90 (68.89%), Postives = 72/90 (80.00%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + +   FISWTG+G+EFK+ +P EVA+RWG  KNKPKMNYEKLSRGLRYYY K II KTAGKRYVY+F+ DV   +
Sbjct:  239 GPIQLWQFLLELLLDSACHTFISWTGDGWEFKMSDPAEVAKRWGQCKNKPKMNYEKLSRGLRYYYHKNIIHKTAGKRYVYRFVCDVQGML 328          
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:30700])

HSP 1 Score: 137.117 bits (344), Expect = 3.047e-34
Identity = 67/135 (49.63%), Postives = 91/135 (67.41%), Query Frame = 2
Query: 1187 HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESY 1591
            +  RG +QLWQFL+  L +PS+  FI+WTG G EFKL EP+EVAR WG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+ +    I  +    ++P L   K+  +  VN  + T P S L+   SY
Sbjct:  344 YQRRGSLQLWQFLVALLDDPSNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALISLAFPDNQRPSL---KAEFERYVNE-EDTVPLSHLDEGVSY 474          
BLAST of C-ets-1-like vs. Ensembl Xenopus
Match: fbxo24 (F-box protein 24 [Source:Xenbase;Acc:XB-GENE-970294])

HSP 1 Score: 150.214 bits (378), Expect = 7.614e-40
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRH 1474
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + +
Sbjct:  242 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGY 333          
BLAST of C-ets-1-like vs. Ensembl Xenopus
Match: ets2 (v-ets avian erythroblastosis virus E26 oncogene homolog 2 [Source:NCBI gene;Acc:100145687])

HSP 1 Score: 152.14 bits (383), Expect = 1.802e-39
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N + ++
Sbjct:  363 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLTDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLHNLLGYT 455          
BLAST of C-ets-1-like vs. Ensembl Xenopus
Match: fbxo24 (F-box protein 24 [Source:Xenbase;Acc:XB-GENE-970294])

HSP 1 Score: 150.599 bits (379), Expect = 3.378e-39
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRH 1474
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + +
Sbjct:  330 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGY 421          
BLAST of C-ets-1-like vs. Ensembl Xenopus
Match: dchs2 (dachsous cadherin-related 2 [Source:Xenbase;Acc:XB-GENE-6048959])

HSP 1 Score: 143.28 bits (360), Expect = 2.404e-38
Identity = 65/98 (66.33%), Postives = 81/98 (82.65%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI-RHSKSSQ 1489
            GPIQLWQFLL  L + S ++ ISWTGNG+EFKL +P+EVARRWG RKNKP+MNYEKLSRGLRYYY K II KT G+RYVY+F+ D+ + + R +++SQ
Sbjct:  144 GPIQLWQFLLELLQDSSCQKLISWTGNGWEFKLSDPNEVARRWGRRKNKPRMNYEKLSRGLRYYYHKNIIHKTGGQRYVYRFVCDLQDLLSRPTQASQ 241          
BLAST of C-ets-1-like vs. Ensembl Xenopus
Match: dchs2 (dachsous cadherin-related 2 [Source:Xenbase;Acc:XB-GENE-6048959])

HSP 1 Score: 143.28 bits (360), Expect = 3.585e-37
Identity = 65/98 (66.33%), Postives = 81/98 (82.65%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI-RHSKSSQ 1489
            GPIQLWQFLL  L + S ++ ISWTGNG+EFKL +P+EVARRWG RKNKP+MNYEKLSRGLRYYY K II KT G+RYVY+F+ D+ + + R +++SQ
Sbjct:  260 GPIQLWQFLLELLQDSSCQKLISWTGNGWEFKLSDPNEVARRWGRRKNKPRMNYEKLSRGLRYYYHKNIIHKTGGQRYVYRFVCDLQDLLSRPTQASQ 357          
BLAST of C-ets-1-like vs. Ensembl Mouse
Match: Ets1 (E26 avian leukemia oncogene 1, 5' domain [Source:MGI Symbol;Acc:MGI:95455])

HSP 1 Score: 149.828 bits (377), Expect = 2.824e-41
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  117 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 209          
BLAST of C-ets-1-like vs. Ensembl Mouse
Match: Ets1 (E26 avian leukemia oncogene 1, 5' domain [Source:MGI Symbol;Acc:MGI:95455])

HSP 1 Score: 150.984 bits (380), Expect = 3.089e-40
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  246 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 338          
BLAST of C-ets-1-like vs. Ensembl Mouse
Match: Ets1 (E26 avian leukemia oncogene 1, 5' domain [Source:MGI Symbol;Acc:MGI:95455])

HSP 1 Score: 151.369 bits (381), Expect = 1.525e-39
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  333 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 425          
BLAST of C-ets-1-like vs. Ensembl Mouse
Match: Ets2 (E26 avian leukemia oncogene 2, 3' domain [Source:MGI Symbol;Acc:MGI:95456])

HSP 1 Score: 151.754 bits (382), Expect = 1.661e-39
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N +
Sbjct:  360 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 449          
BLAST of C-ets-1-like vs. Ensembl Mouse
Match: Ets1 (E26 avian leukemia oncogene 1, 5' domain [Source:MGI Symbol;Acc:MGI:95455])

HSP 1 Score: 150.984 bits (380), Expect = 3.406e-39
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  377 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 469          
BLAST of C-ets-1-like vs. UniProt/SwissProt
Match: sp|P29773|ETS2_LYTVA (Protein C-ets-2 (Fragment) OS=Lytechinus variegatus OX=7654 GN=ETS-2 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.962e-40
Identity = 66/93 (70.97%), Postives = 78/93 (83.87%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + + +  ISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + +S
Sbjct:    2 GPIQLWQFLLELLTDKTCQHIISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYS 94          
BLAST of C-ets-1-like vs. UniProt/SwissProt
Match: sp|P18756|ETS1B_XENLA (Protein c-ets-1-B (Fragment) OS=Xenopus laevis OX=8355 GN=ets1-b PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 7.921e-40
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + +
Sbjct:  160 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLL 249          
BLAST of C-ets-1-like vs. UniProt/SwissProt
Match: sp|P10157|ETS2_CHICK (Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.686e-39
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N + ++
Sbjct:  371 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLADPDEVARRWGRRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGYT 463          
BLAST of C-ets-1-like vs. UniProt/SwissProt
Match: sp|P15036|ETS2_HUMAN (Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 9.995e-39
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYI 1468
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N +
Sbjct:  361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 450          
BLAST of C-ets-1-like vs. UniProt/SwissProt
Match: sp|P13474|ETS1A_CHICK (Transforming protein p54/c-ets-1 OS=Gallus gallus OX=9031 GN=ETS1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.023e-38
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ + + ++
Sbjct:  333 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 425          
BLAST of C-ets-1-like vs. TrEMBL
Match: E9G6P4 (ETS domain-containing protein (Fragment) OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_46545 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.967e-40
Identity = 68/93 (73.12%), Postives = 80/93 (86.02%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + ++
Sbjct:    3 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLLGYT 95          
BLAST of C-ets-1-like vs. TrEMBL
Match: A0A3Q8PZ75 (C-ets-1-like (Fragment) OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.903e-40
Identity = 68/93 (73.12%), Postives = 82/93 (88.17%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL +L + S + FISWTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+++ + +S
Sbjct:   93 GPIQLWQFLLEQLTDKSCQHFISWTGDGWEFKLSDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLNSLLGYS 185          
BLAST of C-ets-1-like vs. TrEMBL
Match: A0A444UDN1 (Protein C-ets-2 OS=Acipenser ruthenus OX=7906 GN=EOD39_15208 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 9.754e-40
Identity = 77/140 (55.00%), Postives = 99/140 (70.71%), Query Frame = 2
Query: 1064 NADSTQLKVNEQGLASTSNTVTKPESTDNNN--IPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            +  +  L VN+QGL+       + ++T+++   IP  +         GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N + +S
Sbjct:  189 DCSAGTLCVNKQGLSFKDYIQERNDATEHDKPFIPAAV--LAGFTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLTDPDEVARRWGRRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGYS 326          
BLAST of C-ets-1-like vs. TrEMBL
Match: A0A3S0ZW85 (ETS domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_003988 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.563e-39
Identity = 66/93 (70.97%), Postives = 81/93 (87.10%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL +L + + + FI+WTG+G+EFKL +PDEVARRWG+RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ D+ N + ++
Sbjct:   45 GPIQLWQFLLEQLTDKTCQHFIAWTGDGWEFKLSDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLLGYT 137          
BLAST of C-ets-1-like vs. TrEMBL
Match: A0A5J4NX47 (ETS domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011498 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.785e-39
Identity = 67/92 (72.83%), Postives = 79/92 (85.87%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRH 1474
            GPIQLWQFLL EL NP ++ +ISWTG G EFKLKEP++VA+RWG RKNKPKMNYEKLSRGLRYYYDKRII+K +GKRYVY+F   V + +R+
Sbjct:   36 GPIQLWQFLLEELQNPEAKDYISWTGQGAEFKLKEPNQVAKRWGARKNKPKMNYEKLSRGLRYYYDKRIIQKVSGKRYVYRFTQSVDDLLRN 127          
BLAST of C-ets-1-like vs. Ensembl Cavefish
Match: ets1 (protein C-ets-1 [Source:NCBI gene;Acc:103024969])

HSP 1 Score: 149.058 bits (375), Expect = 1.509e-39
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  248 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 340          
BLAST of C-ets-1-like vs. Ensembl Cavefish
Match: ETS2 (ETS proto-oncogene 2, transcription factor [Source:NCBI gene;Acc:103045442])

HSP 1 Score: 151.369 bits (381), Expect = 1.673e-39
Identity = 73/137 (53.28%), Postives = 93/137 (67.88%), Query Frame = 2
Query: 1073 STQLKVNEQGLASTSNTVTKPESTDNNN--IPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            +T L + +QGL+       + E  +     IP  +         GPIQLWQFLL  L + + +  ISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ N + ++
Sbjct:  314 ATPLSLGKQGLSFKDYVQERNEPLEQGKPVIPAAV--LAGFTGSGPIQLWQFLLELLTDTTCQGIISWTGDGWEFKLTDPDEVARRWGRRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGYT 448          
BLAST of C-ets-1-like vs. Ensembl Cavefish
Match: ets1 (protein C-ets-1 [Source:NCBI gene;Acc:103024969])

HSP 1 Score: 149.828 bits (377), Expect = 2.767e-39
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  322 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 414          
BLAST of C-ets-1-like vs. Ensembl Cavefish
Match: ets1 (protein C-ets-1 [Source:NCBI gene;Acc:103024969])

HSP 1 Score: 149.828 bits (377), Expect = 7.687e-39
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  374 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 466          
BLAST of C-ets-1-like vs. Ensembl Cavefish
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:103024366])

HSP 1 Score: 139.428 bits (350), Expect = 1.365e-35
Identity = 65/136 (47.79%), Postives = 91/136 (66.91%), Query Frame = 2
Query: 1187 HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESYA 1594
            +  RG +QLWQFL+  L +PS+  FI+WTG G EFKL EP+EVARRWG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+ D       +    ++   P +K+  +  +N  + T P S  + S +Y 
Sbjct:  284 YQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQR---PVLKTDMERQINE-EDTVPLSHFDESVAYV 415          
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 132.88 bits (333), Expect = 5.409e-35
Identity = 74/178 (41.57%), Postives = 107/178 (60.11%), Query Frame = 2
Query: 1079 QLKVNEQGLAST-SNTVTKPESTDNNNIPCKIENT--KD----HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESY 1591
            ++ VNE  L     +T   PE   N  + CK E+   +D    +  RG +QLWQFL+  L +P++   I+WTG G EFKL EP+EVAR+WG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+ D       +    ++   P +K+  +  V SG  T P +    + +Y
Sbjct:  119 EVCVNECNLRCVYDDTCVVPE---NYEVNCKHESGPFRDGPPPYQRRGSLQLWQFLVALLDDPANGHLITWTGRGMEFKLLEPEEVARKWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSLAFPDNQR---PLLKADIERQV-SGADTVPLTHFEENTTY 289          
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002472.1 (pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 gene:ENSPMAG00000002241.1 transcript:ENSPMAT00000002472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.909e-30
Identity = 53/95 (55.79%), Postives = 69/95 (72.63%), Query Frame = 2
Query: 1193 NRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
             RG +QLWQFL+  L +P+    I WTG G EFKL +P+EVAR WG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+        H+
Sbjct:  373 RRGSLQLWQFLVALLEDPAHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCHPEVVFSHA 467          
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006723.1 (pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gene:ENSPMAG00000006043.1 transcript:ENSPMAT00000006723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 2.928e-30
Identity = 52/89 (58.43%), Postives = 68/89 (76.40%), Query Frame = 2
Query: 1187 HHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMD 1453
            +  RG +QLWQFL+  L +P     I WTG G EFKL +P+EVAR WG++KN+P MNY+KLSR LRYYY+K I++K AG+RYVY+F+ D
Sbjct:  365 YQRRGSLQLWQFLVALLEDPVHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYRFVCD 453          
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 115.546 bits (288), Expect = 8.228e-30
Identity = 53/82 (64.63%), Postives = 61/82 (74.39%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L + S+   I+W G   EFK+ +PDEVARRWG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   32 GQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 113          
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 114.39 bits (285), Expect = 1.642e-29
Identity = 52/86 (60.47%), Postives = 61/86 (70.93%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDV 1456
            G IQLWQFLL  L + ++   I+W G   EFKL +PDEVAR+WG RK KP MNY+KLSR LRYYYDK I+ K  GKRY Y+F   V
Sbjct:    4 GQIQLWQFLLELLSDAANAHCIAWEGACGEFKLTDPDEVARQWGKRKAKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQV 89          
BLAST of C-ets-1-like vs. Ensembl Nematostella
Match: EDO37550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF5])

HSP 1 Score: 125.561 bits (314), Expect = 2.115e-34
Identity = 57/101 (56.44%), Postives = 72/101 (71.29%), Query Frame = 2
Query: 1196 RGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKP 1498
            RG +QLWQFL+  L  P    FI+WTG G EFKL +P+EVARRWGL+KN+P MNY+KLSR LRYYY+K I++K AG+RYVYKF+         +    +KP
Sbjct:    4 RGSLQLWQFLVALLDEPECSSFIAWTGRGLEFKLIDPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCSPEALFSMAFPDSQKP 104          
BLAST of C-ets-1-like vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 115.931 bits (289), Expect = 6.561e-31
Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L +P +   I+W G   EFKL +PDEVARRWG RKNKP MNY+KLSR LRYYYDK I+ K  GKRY YK+
Sbjct:   13 GQIQLWQFLLELLSDPKNANCIAWEGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKY 94          
BLAST of C-ets-1-like vs. Ensembl Nematostella
Match: EDO43493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB7])

HSP 1 Score: 114.775 bits (286), Expect = 2.048e-30
Identity = 51/97 (52.58%), Postives = 66/97 (68.04%), Query Frame = 2
Query: 1205 IQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKK 1495
            IQLWQFLL  L + +    I W G   EFKL +P++VA++WG RKNKP MNYEKLSR LRYYYD  +I K  GKR+VYKF+ ++ N + ++     K
Sbjct:    1 IQLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKFVCNLKNLLGYTAGELNK 97          
BLAST of C-ets-1-like vs. Ensembl Nematostella
Match: EDO43494 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB8])

HSP 1 Score: 108.997 bits (271), Expect = 1.340e-28
Identity = 56/93 (60.22%), Postives = 67/93 (72.04%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGN-GYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRH 1474
            GPIQLWQFLL  L  P S++ I WT +  +EFKL  P  +A  WG RKNKP MNYEKLSRGLRYYYDK II+K  GKRYVY+F+ D+   + +
Sbjct:    3 GPIQLWQFLLELLLCPQSQRLIEWTYDEKFEFKLLNPPVIATMWGKRKNKPNMNYEKLSRGLRYYYDKNIIDKVHGKRYVYQFVCDIEKILGY 95          
BLAST of C-ets-1-like vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 92.0485 bits (227), Expect = 1.094e-22
Identity = 46/82 (56.10%), Postives = 56/82 (68.29%), Query Frame = 2
Query: 1205 IQLWQFLLGELCNPSSEQFISWTGNGY-EFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFI 1447
            + LW+FLL  L + S    ISWT     EFKL+  +EVARRWG  K +P MNY+KLSR LRYYY K II+K  G+R VYKF+
Sbjct:    3 VHLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKFV 84          
BLAST of C-ets-1-like vs. Ensembl Medaka
Match: ets1 (protein c-ets-1-B [Source:NCBI gene;Acc:101159690])

HSP 1 Score: 149.443 bits (376), Expect = 7.928e-40
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  240 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 332          
BLAST of C-ets-1-like vs. Ensembl Medaka
Match: ets1 (protein c-ets-1-B [Source:NCBI gene;Acc:101159690])

HSP 1 Score: 150.214 bits (378), Expect = 2.893e-39
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  327 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 419          
BLAST of C-ets-1-like vs. Ensembl Medaka
Match: ets1 (protein c-ets-1-B [Source:NCBI gene;Acc:101159690])

HSP 1 Score: 149.443 bits (376), Expect = 4.244e-39
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  328 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 420          
BLAST of C-ets-1-like vs. Ensembl Medaka
Match: ENSORLT00000040012.1 (pep primary_assembly:ASM223467v1:18:29973395:29977350:-1 gene:ENSORLG00000028709.1 transcript:ENSORLT00000040012.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 7.623e-39
Identity = 63/86 (73.26%), Postives = 72/86 (83.72%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDV 1456
            GPIQLWQFLL  L + S +  ISWTG+G+EFKL +PDEVA  WG RKNKPKMNYEKLSRGLRYYYDK II KTAGKRYVY+F+ ++
Sbjct:  262 GPIQLWQFLLELLTDRSCQSCISWTGDGWEFKLTDPDEVALLWGRRKNKPKMNYEKLSRGLRYYYDKNIIRKTAGKRYVYRFVCNL 347          
BLAST of C-ets-1-like vs. Ensembl Medaka
Match: ets1 (protein c-ets-1-B [Source:NCBI gene;Acc:101159690])

HSP 1 Score: 149.443 bits (376), Expect = 1.062e-38
Identity = 66/93 (70.97%), Postives = 79/93 (84.95%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHS 1477
            GPIQLWQFLL  L + S + FISWTG+G+EFKL +PDEVARRWG RKNKPKMNYEKLSRGLRYYYDK II KT+GKRYVY+F+ D+ + + ++
Sbjct:  377 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSLLGYT 469          
BLAST of C-ets-1-like vs. Planmine SMEST
Match: SMESG000065612.1 (SMESG000065612.1)

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 468/472 (99.15%), Postives = 470/472 (99.58%), Query Frame = 2
Query:  197 FVDSESNSPEFNQASFETNSNEVPILPTLNLFGLSQYNESHLGIYSQDVPSTFQQNGFPNLTXXXXXXXGSYILQSDPTTNRPTLSGPKTLHLITEFPKSEEEKPLYIHDQTSNFRKQEWTVNPDSITQVHQGQFAPEITNEDIRNILDTSSIIQLHQQYHPHNWTLFHSNSPTNFSDQNWFQNPSNPYQELPNLTTAIDSQELPNYCVQHPQSNFDQTGEPVFLTVFPNGSSKFCLDSYPNQTADVYYNQEYTNSYSSQSHYIPTSNFNEQTWNRPDNNFSQSDWSQINADSTQLKVNEQGLASTSNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESYAVQDSLQ 1612
            F + ESNSPEFNQASFETNSNEVPILPTLNLFGLSQYNESHLGIYSQDVPSTFQQNGFPNLTNNNNNNNGSYILQSDPTTNRPTLSGPKTLHLITEFPKSEEEKPLYIHDQTSNFRKQEWTVNPDSITQVHQGQFAPEITNEDIRNILDTSSIIQLHQQYHPHNWTLFHSNSPTNFS+QNWFQNPSNPYQELPNLTTAIDSQELPNYCVQHPQSNFDQTGEPVFLTVFPNGSSKFCLDSYPNQTADVYYNQEYTNSYSSQSHYIPTSNFNEQTWNRPDNNFSQSDWSQINADSTQLKVNEQGLASTSNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESYAVQDSLQ
Sbjct:   11 FSEKESNSPEFNQASFETNSNEVPILPTLNLFGLSQYNESHLGIYSQDVPSTFQQNGFPNLTNNNNNNNGSYILQSDPTTNRPTLSGPKTLHLITEFPKSEEEKPLYIHDQTSNFRKQEWTVNPDSITQVHQGQFAPEITNEDIRNILDTSSIIQLHQQYHPHNWTLFHSNSPTNFSNQNWFQNPSNPYQELPNLTTAIDSQELPNYCVQHPQSNFDQTGEPVFLTVFPNGSSKFCLDSYPNQTADVYYNQEYTNSYSSQSHYIPTSNFNEQTWNRPDNNFSQSDWSQINADSTQLKVNEQGLASTSNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPESKLNSSESYAVQDSLQ 482          
BLAST of C-ets-1-like vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 122.094 bits (305), Expect = 9.555e-31
Identity = 56/82 (68.29%), Postives = 62/82 (75.61%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L +  +  FISW GN  EFKL +PDEVARRWG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   54 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 135          
BLAST of C-ets-1-like vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.411e-30
Identity = 56/82 (68.29%), Postives = 62/82 (75.61%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L +  +  FISW GN  EFKL +PDEVARRWG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   80 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 161          
BLAST of C-ets-1-like vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.332e-28
Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L +  +  FI+W G   EFKL +PDEVARRWG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   79 GQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 160          
BLAST of C-ets-1-like vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.407e-28
Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 2
Query: 1199 GPIQLWQFLLGELCNPSSEQFISWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEKTAGKRYVYKF 1444
            G IQLWQFLL  L +  +  FI+W G   EFKL +PDEVARRWG RK+KP MNY+KLSR LRYYYDK I+ K  GKRY YKF
Sbjct:   76 GQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 157          
The following BLAST results are available for this feature:
BLAST of C-ets-1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETS13.488e-4172.04ETS proto-oncogene 1, transcription factor [Source... [more]
ETS16.029e-4072.04ETS proto-oncogene 1, transcription factor [Source... [more]
ETS22.081e-3974.44ETS proto-oncogene 2, transcription factor [Source... [more]
ETS22.081e-3974.44ETS proto-oncogene 2, transcription factor [Source... [more]
ETS22.081e-3974.44ETS proto-oncogene 2, transcription factor [Source... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets-58.592e-3148.82ETS domain-containing transcription factor ets-5 ... [more]
ets-58.027e-3051.33ETS domain-containing transcription factor ets-5 ... [more]
ast-11.062e-2759.30Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
lin-16.839e-2254.88LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
lin-16.839e-2254.88LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
back to top
BLAST of C-ets-1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnt1.977e-3963.39gene:FBgn0003118 transcript:FBtr0334554[more]
pnt2.156e-3963.39gene:FBgn0003118 transcript:FBtr0089715[more]
pnt1.702e-3863.39gene:FBgn0003118 transcript:FBtr0089717[more]
pnt2.445e-3863.39gene:FBgn0003118 transcript:FBtr0089716[more]
Ets96B1.735e-3163.22gene:FBgn0039225 transcript:FBtr0339254[more]
back to top
BLAST of C-ets-1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets21.290e-3869.89v-ets avian erythroblastosis virus E26 oncogene ho... [more]
etv5a1.480e-3448.91ETS variant transcription factor 5a [Source:ZFIN;A... [more]
etv22.347e-3468.89ETS variant transcription factor 2 [Source:ZFIN;Ac... [more]
etv22.942e-3468.89ETS variant transcription factor 2 [Source:ZFIN;Ac... [more]
etv43.047e-3449.63ETS variant transcription factor 4 [Source:NCBI ge... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo247.614e-4072.83F-box protein 24 [Source:Xenbase;Acc:XB-GENE-97029... [more]
ets21.802e-3972.04v-ets avian erythroblastosis virus E26 oncogene ho... [more]
fbxo243.378e-3972.83F-box protein 24 [Source:Xenbase;Acc:XB-GENE-97029... [more]
dchs22.404e-3866.33dachsous cadherin-related 2 [Source:Xenbase;Acc:XB... [more]
dchs23.585e-3766.33dachsous cadherin-related 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets12.824e-4172.04E26 avian leukemia oncogene 1, 5' domain [Source:M... [more]
Ets13.089e-4072.04E26 avian leukemia oncogene 1, 5' domain [Source:M... [more]
Ets11.525e-3972.04E26 avian leukemia oncogene 1, 5' domain [Source:M... [more]
Ets21.661e-3974.44E26 avian leukemia oncogene 2, 3' domain [Source:M... [more]
Ets13.406e-3972.04E26 avian leukemia oncogene 1, 5' domain [Source:M... [more]
back to top
BLAST of C-ets-1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29773|ETS2_LYTVA2.962e-4070.97Protein C-ets-2 (Fragment) OS=Lytechinus variegatu... [more]
sp|P18756|ETS1B_XENLA7.921e-4074.44Protein c-ets-1-B (Fragment) OS=Xenopus laevis OX=... [more]
sp|P10157|ETS2_CHICK3.686e-3972.04Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 P... [more]
sp|P15036|ETS2_HUMAN9.995e-3974.44Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE... [more]
sp|P13474|ETS1A_CHICK1.023e-3872.04Transforming protein p54/c-ets-1 OS=Gallus gallus ... [more]
back to top
BLAST of C-ets-1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9G6P42.967e-4073.12ETS domain-containing protein (Fragment) OS=Daphni... [more]
A0A3Q8PZ754.903e-4073.12C-ets-1-like (Fragment) OS=Crepidula fornicata OX=... [more]
A0A444UDN19.754e-4055.00Protein C-ets-2 OS=Acipenser ruthenus OX=7906 GN=E... [more]
A0A3S0ZW851.563e-3970.97ETS domain-containing protein OS=Elysia chlorotica... [more]
A0A5J4NX471.785e-3972.83ETS domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets11.509e-3970.97protein C-ets-1 [Source:NCBI gene;Acc:103024969][more]
ETS21.673e-3953.28ETS proto-oncogene 2, transcription factor [Source... [more]
ets12.767e-3970.97protein C-ets-1 [Source:NCBI gene;Acc:103024969][more]
ets17.687e-3970.97protein C-ets-1 [Source:NCBI gene;Acc:103024969][more]
etv11.365e-3547.79ETS variant transcription factor 1 [Source:NCBI ge... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etv15.409e-3541.57ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000002472.11.909e-3055.79pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 ... [more]
ENSPMAT00000006723.12.928e-3058.43pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gen... [more]
fli1a8.228e-3064.63Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fev1.642e-2960.47FEV transcription factor, ETS family member [Sourc... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-ets-1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375502.115e-3456.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399736.561e-3165.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434932.048e-3052.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434941.340e-2860.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453101.094e-2256.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-ets-1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets17.928e-4070.97protein c-ets-1-B [Source:NCBI gene;Acc:101159690][more]
ets12.893e-3970.97protein c-ets-1-B [Source:NCBI gene;Acc:101159690][more]
ets14.244e-3970.97protein c-ets-1-B [Source:NCBI gene;Acc:101159690][more]
ENSORLT00000040012.17.623e-3973.26pep primary_assembly:ASM223467v1:18:29973395:29977... [more]
ets11.062e-3870.97protein c-ets-1-B [Source:NCBI gene;Acc:101159690][more]
back to top
BLAST of C-ets-1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065612.10.000e+099.15SMESG000065612.1[more]
SMESG000036336.19.555e-3168.29SMESG000036336.1[more]
SMESG000036336.11.411e-3068.29SMESG000036336.1[more]
SMESG000078333.11.332e-2865.85SMESG000078333.1[more]
SMESG000078333.11.407e-2865.85SMESG000078333.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010549 ID=SMED30010549|Name=C-ets-1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1773bp
GATAGATTCTGGCATATCATAACATATGAATATTTTTTTTCATTGAAGTC
ATTTCCTGCAAAAAATGATAAACTTACACAAACCCGACTTTCAAGCACCG
GAACTGAGTTCCGGAAATCAAAACCGCTATTTCACTTGGTGTGAGCTCAG
TCCATCGAGCAAAGAAAGCAGCAATGGTACATATTTTGATGGGAATTTTG
TTGATTCAGAGAGCAACAGTCCTGAATTCAATCAAGCAAGCTTCGAAACT
AATTCTAATGAGGTTCCGATTTTACCAACTTTGAATTTGTTTGGTTTGTC
TCAGTATAATGAATCCCATCTTGGCATATATTCTCAAGATGTTCCTTCAA
CTTTTCAACAGAACGGGTTTCCGAACCTAACAAACAACAATAATAACAAC
AACGGCTCATATATTTTGCAGTCAGATCCGACAACAAATCGGCCAACTTT
ATCGGGTCCGAAAACTTTGCATTTGATAACAGAGTTTCCAAAATCCGAAG
AAGAAAAACCATTATATATACATGATCAAACATCAAACTTTCGAAAACAA
GAATGGACTGTCAATCCAGATTCGATAACACAAGTTCACCAAGGTCAATT
TGCGCCAGAAATTACCAATGAAGACATCAGAAACATTCTTGATACGAGTT
CAATTATTCAACTCCATCAACAGTATCATCCTCATAATTGGACTTTGTTC
CATTCAAATAGTCCGACAAATTTCTCCGATCAGAATTGGTTTCAAAACCC
TTCGAACCCTTACCAGGAATTACCGAATCTCACGACTGCAATCGACTCGC
AAGAACTGCCGAATTATTGCGTTCAACATCCGCAATCAAATTTTGATCAA
ACCGGTGAGCCAGTGTTTTTGACAGTTTTTCCCAATGGGTCTTCGAAATT
CTGCCTTGATTCCTACCCGAATCAAACAGCTGATGTGTATTACAACCAGG
AGTATACCAATTCTTATAGCTCTCAATCTCATTACATACCGACTTCAAAT
TTCAATGAGCAAACTTGGAACAGACCCGACAATAACTTTTCCCAATCCGA
CTGGTCACAAATAAATGCCGATTCAACCCAACTGAAAGTTAATGAACAAG
GCTTAGCGTCTACTAGCAACACGGTTACAAAACCGGAGAGTACGGATAAT
AATAATATCCCTTGCAAAATCGAGAATACCAAAGATCATCATAATCGAGG
CCCGATTCAATTGTGGCAATTTCTTCTTGGAGAACTTTGCAATCCTTCGT
CTGAGCAGTTCATTTCATGGACCGGCAATGGATACGAATTCAAATTGAAA
GAACCGGACGAAGTCGCTCGTCGATGGGGTTTAAGAAAGAACAAACCGAA
AATGAATTACGAGAAACTCAGCCGTGGATTGCGATATTACTATGATAAAA
GAATCATTGAAAAAACTGCTGGCAAACGATACGTTTACAAATTTATCATG
GACGTCTCGAATTATATAAGACACTCAAAATCCAGTCAAAAGAAACCCGA
TTTACCGGCGATTAAGTCCACCGGGAAAAGCTCAGTAAACTCTGGAAAGT
CTACGACGCCAGAATCGAAACTCAATTCATCAGAATCATATGCAGTCCAG
GATTCTTTACAATAAAAAAAACTGAATATATATTAAATGTATTAATTTTA
TTTGTAACCCCCCCCCCACCACCACTACCACAACCACCCTTCACCCCTCC
CCAAATGCAAAAACAACTGAAAATGTGATAACGTAACTAATTTTCCATTT
CCAATATCGAATTTTCGAACAAT
back to top

protein sequence of SMED30010549-orf-1

>SMED30010549-orf-1 ID=SMED30010549-orf-1|Name=SMED30010549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=517bp
MINLHKPDFQAPELSSGNQNRYFTWCELSPSSKESSNGTYFDGNFVDSES
NSPEFNQASFETNSNEVPILPTLNLFGLSQYNESHLGIYSQDVPSTFQQN
GFPNLTNNNNNNNGSYILQSDPTTNRPTLSGPKTLHLITEFPKSEEEKPL
YIHDQTSNFRKQEWTVNPDSITQVHQGQFAPEITNEDIRNILDTSSIIQL
HQQYHPHNWTLFHSNSPTNFSDQNWFQNPSNPYQELPNLTTAIDSQELPN
YCVQHPQSNFDQTGEPVFLTVFPNGSSKFCLDSYPNQTADVYYNQEYTNS
YSSQSHYIPTSNFNEQTWNRPDNNFSQSDWSQINADSTQLKVNEQGLAST
SNTVTKPESTDNNNIPCKIENTKDHHNRGPIQLWQFLLGELCNPSSEQFI
SWTGNGYEFKLKEPDEVARRWGLRKNKPKMNYEKLSRGLRYYYDKRIIEK
TAGKRYVYKFIMDVSNYIRHSKSSQKKPDLPAIKSTGKSSVNSGKSTTPE
SKLNSSESYAVQDSLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0035259glucocorticoid receptor binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001712ectodermal cell fate commitment
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007498mesoderm development
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0090009primitive streak formation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 381..394
score: 52.06
coord: 424..442
score: 73.05
coord: 443..461
score: 50.91
coord: 405..423
score: 49.09
IPR000418Ets domainSMARTSM00413etsneu2coord: 380..465
e-value: 6.4E-48
score: 175.2
IPR000418Ets domainPFAMPF00178Etscoord: 382..461
e-value: 5.5E-33
score: 113.3
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 427..442
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 381..461
score: 41.303
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 342..478
e-value: 7.4E-47
score: 160.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 472..516
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 485..516
NoneNo IPR availablePANTHERPTHR11849:SF209PROTEIN C-ETS-1coord: 348..471
NoneNo IPR availablePANTHERPTHR11849ETScoord: 348..471
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 379..493