La-domain-containing protein

Overview
NameLa-domain-containing protein
Smed IDSMED30010543
Length (bp)2020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of La-domain-containing protein (SMED30010543) t-SNE clustered cells

Violin plots show distribution of expression levels for La-domain-containing protein (SMED30010543) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of La-domain-containing protein (SMED30010543) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for La-domain-containing protein (SMED30010543) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of La-domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 75.8702 bits (185), Expect = 2.481e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          
BLAST of La-domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 77.0258 bits (188), Expect = 5.188e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          

HSP 2 Score: 71.633 bits (174), Expect = 2.687e-12
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQ--HQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ   +S   T+    Q+  +K E+T N++  + T   V     Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  376 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPQNTGMKNEKTANREECR-TQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAK 543          
BLAST of La-domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 77.0258 bits (188), Expect = 5.188e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          

HSP 2 Score: 71.633 bits (174), Expect = 2.687e-12
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQ--HQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ   +S   T+    Q+  +K E+T N++  + T   V     Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  376 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPQNTGMKNEKTANREECR-TQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAK 543          
BLAST of La-domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 77.0258 bits (188), Expect = 5.188e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          

HSP 2 Score: 71.633 bits (174), Expect = 2.687e-12
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQ--HQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ   +S   T+    Q+  +K E+T N++  + T   V     Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  376 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPQNTGMKNEKTANREECR-TQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAK 543          
BLAST of La-domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 77.0258 bits (188), Expect = 5.351e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   39 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 190          

HSP 2 Score: 71.633 bits (174), Expect = 2.765e-12
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQ--HQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ   +S   T+    Q+  +K E+T N++  + T   V     Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  383 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPQNTGMKNEKTANREECR-TQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAK 550          
BLAST of La-domain-containing protein vs. Ensembl Celegans
Match: ssb-1 (Sjogren Syndrome antigen B homolog [Source:UniProtKB/TrEMBL;Acc:O01806])

HSP 1 Score: 66.6254 bits (161), Expect = 2.041e-11
Identity = 59/201 (29.35%), Postives = 97/201 (48.26%), Query Frame = 1
Query:   73 SALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAV--NKSKILIFDEENKGIKRKIE-------LENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKY-PSSQTLRGFGFIEFMTK-TETRKALNEYKISEFELRKAESWKYFSFSNSQ 642
            +A + D    K+IK QLE+YF   NLPRD+F+Q+ +K   +  + I  +L FN+L  +    + I +AV  + S I+   E+N+ I+R  E       LE  + +  RT+++ GF        S D    DI +    FG+   + + +  P  +T +G  FI + T+         E K  E EL K    +Y++  N +
Sbjct:    5 AAAVHDDADQKIIK-QLEYYFGNINLPRDKFLQEKLK-EDDGWVPITTMLNFNRLASISKDTEKIANAVKNSGSGIISVSEDNQKIRRNEENPVPENSLEYWQKIKHRTVYMKGF--------STDTQLDDIIQWANQFGETENVLMRRLKPGDRTFKGSVFITYKTREEAEAAQKAEVKFGETELTKMMQDEYWTLKNKE 195          
BLAST of La-domain-containing protein vs. Ensembl Celegans
Match: ssb-1 (Sjogren Syndrome antigen B homolog [Source:UniProtKB/TrEMBL;Acc:O01806])

HSP 1 Score: 66.6254 bits (161), Expect = 2.041e-11
Identity = 59/201 (29.35%), Postives = 97/201 (48.26%), Query Frame = 1
Query:   73 SALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAV--NKSKILIFDEENKGIKRKIE-------LENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKY-PSSQTLRGFGFIEFMTK-TETRKALNEYKISEFELRKAESWKYFSFSNSQ 642
            +A + D    K+IK QLE+YF   NLPRD+F+Q+ +K   +  + I  +L FN+L  +    + I +AV  + S I+   E+N+ I+R  E       LE  + +  RT+++ GF        S D    DI +    FG+   + + +  P  +T +G  FI + T+         E K  E EL K    +Y++  N +
Sbjct:    5 AAAVHDDADQKIIK-QLEYYFGNINLPRDKFLQEKLK-EDDGWVPITTMLNFNRLASISKDTEKIANAVKNSGSGIISVSEDNQKIRRNEENPVPENSLEYWQKIKHRTVYMKGF--------STDTQLDDIIQWANQFGETENVLMRRLKPGDRTFKGSVFITYKTREEAEAAQKAEVKFGETELTKMMQDEYWTLKNKE 195          
BLAST of La-domain-containing protein vs. Ensembl Fly
Match: Larp7 (gene:FBgn0260771 transcript:FBtr0301275)

HSP 1 Score: 82.0333 bits (201), Expect = 7.293e-16
Identity = 46/157 (29.30%), Postives = 84/157 (53.50%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEY 576
            I+ Q+EFYF + NL +D F+++ ++  Q+  + +E  L FNK+  L      I  A++ S++L  DE    +KR+ +L + + VN +T+++            P + T D +K+ F  +G +  + LP YP ++ ++ F FIEF       KA+  +
Sbjct:   63 IRGQMEFYFGDANLSKDRFLRRYVE--QDPYVPLEIFLTFNKIKTLTQDVQQIAKALSNSQLLELDETELKVKRRTKLPDQRDVNDKTLYVEAL---------PANATHDWLKEVFSRYGPVAYVSLPHYPGTKKIKEFAFIEFEKSGSLEKAVKAF 208          
BLAST of La-domain-containing protein vs. Ensembl Zebrafish
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:334956])

HSP 1 Score: 85.1149 bits (209), Expect = 7.714e-17
Identity = 64/199 (32.16%), Postives = 106/199 (53.27%), Query Frame = 1
Query:   16 RDC-TIQFQKVSTVNI*KMASALISDKK------------LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            R C TI  +K+S+V     A A +S+KK            L+  +K Q+EF+F + NL +D FM+  I+ S++  I I  L  FN++  L A   LI  A+  S I+  ++E   I+RK  L E  K V++RT+++            P  VT   +++ F   G ++ I +P+Y S++  +GF F+EF T+ + +KA+
Sbjct:    4 RHCKTIDTEKMSSVG--DTACADLSEKKDNEKKKRSRVKQLLSDVKKQVEFWFGDVNLHKDRFMKSIIEQSRDGYIDIAVLTTFNRMKNLTADVKLIARALKNSTIVEVNDEGTRIRRKEPLGETPKDVDSRTVYVELL---------PKTVTHIWLERVFSKCGHVVYISIPRYKSTRHSKGFAFVEFETQEQAQKAV 191          

HSP 2 Score: 52.7582 bits (125), Expect = 1.113e-6
Identity = 50/179 (27.93%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD--QIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF--ADIEVSNLS--DLHVLNARQEQEYMEKILLDKQSKQESQKRK 1260
            +  +SKKEW+  +  +   Q++ +A ++      QS+         +  VK ++       + T    KEL+   + +SG IV     +   +K+ IK  L++L     +AY+D  D    GH RFK+SE+A K   A  E       +L +L+   E+ Y +KIL+D+Q+K  + + K
Sbjct:  358 LRVLSKKEWLDLKQEYLTLQKRCMAHLK------QSVFQINQKPTNYHIVKLKEDDTNAFYKDTPK--KELTSGPEFLSGVIVKISYNQPLPSKRCIKDMLSELS---PVAYVDLLDGDTEGHVRFKSSEDAQKVIKARFEFQKKYNWNLELLSGDHERRYWQKILVDRQAKLNTPREK 525          
BLAST of La-domain-containing protein vs. Ensembl Zebrafish
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:334956])

HSP 1 Score: 83.5741 bits (205), Expect = 2.209e-16
Identity = 62/195 (31.79%), Postives = 104/195 (53.33%), Query Frame = 1
Query:   25 TIQFQKVSTVNI*KMASALISDKK------------LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            TI  +K+S+V     A A +S+KK            L+  +K Q+EF+F + NL +D FM+  I+ S++  I I  L  FN++  L A   LI  A+  S I+  ++E   I+RK  L E  K V++RT+++            P  VT   +++ F   G ++ I +P+Y S++  +GF F+EF T+ + +KA+
Sbjct:    8 TIDTEKMSSVG--DTACADLSEKKDNEKKKRSRVKQLLSDVKKQVEFWFGDVNLHKDRFMKSIIEQSRDGYIDIAVLTTFNRMKNLTADVKLIARALKNSTIVEVNDEGTRIRRKEPLGETPKDVDSRTVYVELL---------PKTVTHIWLERVFSKCGHVVYISIPRYKSTRHSKGFAFVEFETQEQAQKAV 191          

HSP 2 Score: 52.7582 bits (125), Expect = 1.075e-6
Identity = 50/179 (27.93%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD--QIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF--ADIEVSNLS--DLHVLNARQEQEYMEKILLDKQSKQESQKRK 1260
            +  +SKKEW+  +  +   Q++ +A ++      QS+         +  VK ++       + T    KEL+   + +SG IV     +   +K+ IK  L++L     +AY+D  D    GH RFK+SE+A K   A  E       +L +L+   E+ Y +KIL+D+Q+K  + + K
Sbjct:  358 LRVLSKKEWLDLKQEYLTLQKRCMAHLK------QSVFQINQKPTNYHIVKLKEDDTNAFYKDTPK--KELTSGPEFLSGVIVKISYNQPLPSKRCIKDMLSELS---PVAYVDLLDGDTEGHVRFKSSEDAQKVIKARFEFQKKYNWNLELLSGDHERRYWQKILVDRQAKLNTPREK 525          
BLAST of La-domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 97.4413 bits (241), Expect = 9.662e-21
Identity = 99/426 (23.24%), Postives = 192/426 (45.07%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLE--LLGYPQKIFFEP-IIGEQRKEKTNSK---------------------------ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD-----QIVSGSIVGFVCPENS--TKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF----ADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            K+L+  I  Q++F+F + NL +D F+++ I+ +++  I I  L  FNK+ ++     LI  AV  S ++  +     I+R+  L E  + V++RT+++            P +VT   I++ F  +G ++ + +P+Y S+   +GF FIEF T+ +  KA+        E  +    K   F  +     L  +E  +L +   I  E  +  E+ K+  + K                           +  +SK EW++ +  +   Q+  +A ++  +S        E +H   E ++ + ++  QS       V+ L +     Q V G ++G +   +    +K +K + + +    E+ Y+D  +     H RFK+ E+A       +D++  +   L +L    EQ Y +KIL+D+Q+K
Sbjct:   32 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDSKLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELL---------PKNVTHSWIERVFGKYGMVVYVSIPRYKSTGDPKGFAFIEFETQEQAAKAIEVLNNPPEEAPR----KAGMFPKTVKNKHLPPVEYGMLWFLHLIVHETELSTEEEKDAVDKKEISVPKVKRKRKKKHKERHRVGEEVIPLRVLSKTEWLVLKAEYLTLQRASMASLKKSMS--------EMNHISEEEMQTQPSM--QSFDIKNGKVETLKNEPLGPQFVCG-VIGKITSSDPLQGRKYVKDAFSGVC---EVVYVDMLEGDTECHVRFKSPEDAQTAVKTRSDLQGKHNWKLQILAGDNEQRYWQKILVDRQAK 430          
BLAST of La-domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 92.0485 bits (227), Expect = 5.368e-19
Identity = 97/430 (22.56%), Postives = 187/430 (43.49%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKE----------------------------------WMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD-----QIVSGSIVGFVCPENS--TKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF----ADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            K+L+  I  Q++F+F + NL +D F+++ I+ +++  I I  L  FNK+ ++     LI  AV  S ++  +     I+R+  L E  + V++RT+++            P +VT   I++ F  +G ++ + +P+Y S+   +GF FIEF T+ +  KA+        E  +    K   F  +     L  +E+  +          G  +K  T  +  A+ KKE                                  W++ +  +   Q+  +A ++  +S        E +H   E ++ + ++  QS       V+ L +     Q V G ++G +   +    +K +K + + +    E+ Y+D  +     H RFK+ E+A       +D++  +   L +L    EQ Y +KIL+D+Q+K
Sbjct:   34 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDSKLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELL---------PKNVTHSWIERVFGKYGMVVYVSIPRYKSTGDPKGFAFIEFETQEQAAKAIEVLNNPPEEAPR----KAGMFPKTVKNKHLPPVEVTEHS----ITEGCGTGKKLSTEEEKDAVDKKEISVPKVKRKRKKKHKERHRVGEEVIPLRVLSKTEWLVLKAEYLTLQRASMASLKKSMS--------EMNHISEEEMQTQPSM--QSFDIKNGKVETLKNEPLGPQFVCG-VIGKITSSDPLQGRKYVKDAFSGVC---EVVYVDMLEGDTECHVRFKSPEDAQTAVKTRSDLQGKHNWKLQILAGDNEQRYWQKILVDRQAK 432          
BLAST of La-domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 91.6633 bits (226), Expect = 6.097e-19
Identity = 97/430 (22.56%), Postives = 187/430 (43.49%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKE----------------------------------WMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD-----QIVSGSIVGFVCPENS--TKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF----ADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            K+L+  I  Q++F+F + NL +D F+++ I+ +++  I I  L  FNK+ ++     LI  AV  S ++  +     I+R+  L E  + V++RT+++            P +VT   I++ F  +G ++ + +P+Y S+   +GF FIEF T+ +  KA+        E  +    K   F  +     L  +E+  +          G  +K  T  +  A+ KKE                                  W++ +  +   Q+  +A ++  +S        E +H   E ++ + ++  QS       V+ L +     Q V G ++G +   +    +K +K + + +    E+ Y+D  +     H RFK+ E+A       +D++  +   L +L    EQ Y +KIL+D+Q+K
Sbjct:   30 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDSKLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELL---------PKNVTHSWIERVFGKYGMVVYVSIPRYKSTGDPKGFAFIEFETQEQAAKAIEVLNNPPEEAPR----KAGMFPKTVKNKHLPPVEVTEHS----ITEGCGTGKKLSTEEEKDAVDKKEISVPKVKRKRKKKHKERHRVGEEVIPLRVLSKTEWLVLKAEYLTLQRASMASLKKSMS--------EMNHISEEEMQTQPSM--QSFDIKNGKVETLKNEPLGPQFVCG-VIGKITSSDPLQGRKYVKDAFSGVC---EVVYVDMLEGDTECHVRFKSPEDAQTAVKTRSDLQGKHNWKLQILAGDNEQRYWQKILVDRQAK 428          
BLAST of La-domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 74.7146 bits (182), Expect = 2.150e-13
Identity = 47/161 (29.19%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+L+  I  Q++F+F + NL +D F+++ I+ +++  I I  L  FNK+ ++     LI  AV  S ++  +     I+R+  L E  + V++RT+++            P +VT   I++ F  +G ++ + +P+Y S+   +GF FIEF T+ +  KA+
Sbjct:   34 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDSKLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELL---------PKNVTHSWIERVFGKYGMVVYVSIPRYKSTGDPKGFAFIEFETQEQAAKAI 185          
BLAST of La-domain-containing protein vs. Ensembl Mouse
Match: Larp7 (La ribonucleoprotein domain family, member 7 [Source:MGI Symbol;Acc:MGI:107634])

HSP 1 Score: 75.485 bits (184), Expect = 9.306e-14
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D+F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K    RT+++            P +VT   I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   26 KQVLADIAKQVDFWFGDANLHKDKFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEEERTVYVELL---------PKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 177          

HSP 2 Score: 62.3882 bits (150), Expect = 1.304e-9
Identity = 48/170 (28.24%), Postives = 77/170 (45.29%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ +     E   K       ++   ++ + A G        Q V+G IV  V  E    +K +K  L     + E+ YID  +     H RFK  E+A    N   +I   +  +L VL+   EQ Y +KIL+D+Q+K
Sbjct:  372 LRVLSKTEWMDLKKEYLALQKASMASLKKTISQIKLESEMETDCKAPTAGSGQECSTQEKVSAQGP-------QFVTGVIVKIVSGEPLPGRKQVKDIL---ATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKKHSWNLEVLSGDHEQRYWQKILVDRQAK 531          
BLAST of La-domain-containing protein vs. Ensembl Mouse
Match: Ssb (Sjogren syndrome antigen B [Source:MGI Symbol;Acc:MGI:98423])

HSP 1 Score: 54.299 bits (129), Expect = 4.128e-8
Identity = 45/138 (32.61%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP-----------VNTRTIFISGFLNNENQKKSPDDVT-KDIKKKFKVFGQILRIDL 486
            I  Q+E+YF + NLPRD+F+++ IK  +   + +E ++KFN+L  L    ++I  A++KSK  +   E    K KI     +P           V  R+++I GF         P D T  DIK+     GQIL I +
Sbjct:   17 ICHQIEYYFGDFNLPRDKFLKEQIKLDEG-WVPLETMIKFNRLNRLTTDFNVIVQALSKSKAKLM--EVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGF---------PTDATLDDIKEWLDDKGQILNIQM 142          
BLAST of La-domain-containing protein vs. Ensembl Mouse
Match: Ssb (Sjogren syndrome antigen B [Source:MGI Symbol;Acc:MGI:98423])

HSP 1 Score: 53.9138 bits (128), Expect = 7.156e-8
Identity = 49/155 (31.61%), Postives = 76/155 (49.03%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP-----------VNTRTIFISGFLNNENQKKSPDDVT-KDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEF 537
            I  Q+E+YF + NLPRD+F+++ IK  +   + +E ++KFN+L  L    ++I  A++KSK  +   E    K KI     +P           V  R+++I GF         P D T  DIK+     GQIL I + +    +T +G  F  F
Sbjct:   17 ICHQIEYYFGDFNLPRDKFLKEQIKLDEG-WVPLETMIKFNRLNRLTTDFNVIVQALSKSKAKLM--EVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGF---------PTDATLDDIKEWLDDKGQILNIQM-RRTLHKTFKGSIFAVF 158          
BLAST of La-domain-containing protein vs. Ensembl Mouse
Match: Ssb (Sjogren syndrome antigen B [Source:MGI Symbol;Acc:MGI:98423])

HSP 1 Score: 56.225 bits (134), Expect = 9.325e-8
Identity = 45/138 (32.61%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP-----------VNTRTIFISGFLNNENQKKSPDDVT-KDIKKKFKVFGQILRIDL 486
            I  Q+E+YF + NLPRD+F+++ IK  +   + +E ++KFN+L  L    ++I  A++KSK  +   E    K KI     +P           V  R+++I GF         P D T  DIK+     GQIL I +
Sbjct:   17 ICHQIEYYFGDFNLPRDKFLKEQIKLDEG-WVPLETMIKFNRLNRLTTDFNVIVQALSKSKAKLM--EVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGF---------PTDATLDDIKEWLDDKGQILNIQM 142          
BLAST of La-domain-containing protein vs. Ensembl Mouse
Match: Ssb (Sjogren syndrome antigen B [Source:MGI Symbol;Acc:MGI:98423])

HSP 1 Score: 56.225 bits (134), Expect = 9.325e-8
Identity = 45/138 (32.61%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP-----------VNTRTIFISGFLNNENQKKSPDDVT-KDIKKKFKVFGQILRIDL 486
            I  Q+E+YF + NLPRD+F+++ IK  +   + +E ++KFN+L  L    ++I  A++KSK  +   E    K KI     +P           V  R+++I GF         P D T  DIK+     GQIL I +
Sbjct:   17 ICHQIEYYFGDFNLPRDKFLKEQIKLDEG-WVPLETMIKFNRLNRLTTDFNVIVQALSKSKAKLM--EVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGF---------PTDATLDDIKEWLDDKGQILNIQM 142          
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7ZWE3|LARP7_DANRE (La-related protein 7 OS=Danio rerio OX=7955 GN=larp7 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.758e-15
Identity = 62/195 (31.79%), Postives = 104/195 (53.33%), Query Frame = 1
Query:   25 TIQFQKVSTVNI*KMASALISDKK------------LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            TI  +K+S+V     A A +S+KK            L+  +K Q+EF+F + NL +D FM+  I+ S++  I I  L  FN++  L A   LI  A+  S I+  ++E   I+RK  L E  K V++RT+++            P  VT   +++ F   G ++ I +P+Y S++  +GF F+EF T+ + +KA+
Sbjct:    8 TIDTEKMSSVG--DTACADLSEKKDNEKKKRSRVKQLLSDVKKQVEFWFGDVNLHKDRFMKSIIEQSRDGYIDIAVLTTFNRMKNLTADVKLIARALKNSTIVEVNDEGTRIRRKEPLGETPKDVDSRTVYVELL---------PKTVTHIWLERVFSKCGHVVYISIPRYKSTRHSKGFAFVEFETQEQAQKAV 191          

HSP 2 Score: 52.7582 bits (125), Expect = 7.842e-6
Identity = 50/179 (27.93%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSD--QIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF--ADIEVSNLS--DLHVLNARQEQEYMEKILLDKQSKQESQKRK 1260
            +  +SKKEW+  +  +   Q++ +A ++      QS+         +  VK ++       + T    KEL+   + +SG IV     +   +K+ IK  L++L     +AY+D  D    GH RFK+SE+A K   A  E       +L +L+   E+ Y +KIL+D+Q+K  + + K
Sbjct:  358 LRVLSKKEWLDLKQEYLTLQKRCMAHLK------QSVFQINQKPTNYHIVKLKEDDTNAFYKDTPK--KELTSGPEFLSGVIVKISYNQPLPSKRCIKDMLSELS---PVAYVDLLDGDTEGHVRFKSSEDAQKVIKARFEFQKKYNWNLELLSGDHERRYWQKILVDRQAKLNTPREK 525          
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4G0J3|LARP7_HUMAN (La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.492e-13
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          

HSP 2 Score: 71.633 bits (174), Expect = 1.290e-11
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQ--HQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ   +S   T+    Q+  +K E+T N++  + T   V     Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  376 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPQNTGMKNEKTANREECR-TQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAK 543          
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R627|LARP7_MACFA (La-related protein 7 OS=Macaca fascicularis OX=9541 GN=LARP7 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.012e-13
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K  + RT+++     N N           I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW--------IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 183          

HSP 2 Score: 69.3218 bits (168), Expect = 5.584e-11
Identity = 48/177 (27.12%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEY-------SHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ +S    E        +  ++E+  +E+   ++ + ATG        Q VSG IV  +  E    +K ++ +L     + E+ Y+D  +     H RFK  E+A    N + +I   +   L +L+   EQ Y +KIL+D+Q+K
Sbjct:  376 LRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDGGVPQKTGMKNEKTNSEECPTQEKVNATGP-------QFVSGVIVKIISTEPLPGRKQVRDTL---AAISEVLYVDLLEGDTECHARFKTPEDAQAVINAYTEISKKHCWKLEILSGDHEQRYWQKILVDRQAK 542          
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q05CL8|LARP7_MOUSE (La-related protein 7 OS=Mus musculus OX=10090 GN=Larp7 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 6.510e-13
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D+F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K    RT+++            P +VT   I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   26 KQVLADIAKQVDFWFGDANLHKDKFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEEERTVYVELL---------PKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 177          

HSP 2 Score: 62.3882 bits (150), Expect = 9.121e-9
Identity = 48/170 (28.24%), Postives = 77/170 (45.29%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SK EWM  +  +   Q+  +A ++  ISQ +     E   K       ++   ++ + A G        Q V+G IV  V  E    +K +K  L     + E+ YID  +     H RFK  E+A    N   +I   +  +L VL+   EQ Y +KIL+D+Q+K
Sbjct:  372 LRVLSKTEWMDLKKEYLALQKASMASLKKTISQIKLESEMETDCKAPTAGSGQECSTQEKVSAQGP-------QFVTGVIVKIVSGEPLPGRKQVKDIL---ATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKKHSWNLEVLSGDHEQRYWQKILVDRQAK 531          
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XI01|LARP7_RAT (La-related protein 7 OS=Rattus norvegicus OX=10116 GN=Larp7 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 9.651e-13
Identity = 50/161 (31.06%), Postives = 86/161 (53.42%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL-ENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+++  I  Q++F+F + NL +D F+++ I+ S++  + I  L+ FNK+ +L     LI  A+  S ++  D E   I+RK  L E  K    RT+++            P +VT   I++ F   G ++ I +P Y S+   +GF F+EF TK +  KA+
Sbjct:   27 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEEERTVYVELL---------PKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAI 178          

HSP 2 Score: 60.4622 bits (145), Expect = 3.520e-8
Identity = 49/183 (26.78%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENA----NKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK--QESQKRKNDRK 1272
            +  +SK EWM  +  +   Q+  +A ++  ISQ + +ES   +  +      +Q   ++ + A G        Q V+G IV  +  +    +K +K  L     + E+ YID  +     H RFK  E+A    N   +I+  +  +L +L+   EQ Y +KIL+D+Q+K  Q  +K++   K
Sbjct:  374 LRVLSKTEWMDLKKEYLALQKASMASLKKTISQIK-LESEMETESKAPPGSGQQCSTQEKVSAQGP-------QFVTGVIVKILSEDPLPGRKQVKDIL---ATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIKKKHSWNLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEK 545          
BLAST of La-domain-containing protein vs. TrEMBL
Match: A0A267FR07 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001906g5 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.707e-21
Identity = 97/408 (23.77%), Postives = 174/408 (42.65%), Query Frame = 1
Query:   94 KLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDL---------IRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNS--QYTHALK----QLELLGYPQKIFFEP----IIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRF---KNSENANKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSKQES 1248
            +L + +K QLEFY  EGNL +D F++  +  +++  + +   L+FN++IE      +         +R A+  S++L  D++   ++R   L  L+PV+ RT+++ G         S   V +D + K F   GQ+L I LP Y ++   +GF F+EF T  E + A++          +A   K+ S   S  +    LK    QLE   Y Q    +              +  +++ + K EW   R     A+ + +A+++   S+ Q  +S E S    E      T     ++ +   +  L+D    G +         T+K I+  L      D +AYID  +       R      ++       +    LS   +L  ++E++Y +KI  D + K  +
Sbjct:   23 ELTEQLKRQLEFYLGEGNLLKDRFLRSELDKTEDGYLPLRLFLRFNRVIEFCHRAGVKQRDQILARLRVAIGASRLLALDDDGLRVRRAAPLRQLEPVDERTVYVDGLCGTGASGGSGCKVDRDSVAKMFSTVGQVLYISLPCYRTTGDSKGFAFVEFETSAEAQLAVDRLNSVPRSQWRARLPKFSSQVRSLLRAAQVLKIDTTQLETALYDQGCGGDSGDSAGTSSTSGSASGKRLAVMPKAEWERLRQEMKSARDREVAKLK---SRVQKAKSAEASRANVEDAAGGATGPPAHLRFSAGLIVRLTD--ADGGL---------TRKRIRDQLPLGEARDAVAYIDIDEDGRGACLRCRDAAAADRLLALPQLTTPPLS-AELLVGQRERDYWDKIRRDWEEKHRT 415          
BLAST of La-domain-containing protein vs. TrEMBL
Match: A0A430QKE3 (La-related protein 7 OS=Schistosoma bovis OX=6184 GN=DC041_0012483 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.627e-20
Identity = 97/399 (24.31%), Postives = 167/399 (41.85%), Query Frame = 1
Query:   85 SDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGF------------LNNENQKKS--PD------------DVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKA----------------------LNEYKISEFELRKAES--------------WKYFSFSNSQYTHALKQLELLGYP-----QKIFFEPIIGEQRK-------------EKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMR----VLISQHQSIESTEY----SHKQHERVKAEQTINKQSIQA-----TGSAVKELSDQIVSGSIVGFVCP 1002
            +D+  +K+++ Q+EFY SEGNL RD F ++ ++   +  I I+ LLK N++I +  T D++++ V  SKI+    +   I R + L  L P   RTI ++G             ++N   ++S  P             ++   I+  F+ +G++L + LP+Y  S + RGF F+EF T    RKA                      ++E   S ++ R A                W+  S  N Q   A K L  +GY       K ++  I+G+                E   SK+      +W+ ++  FY  QQ  +A M     +L++      + EY    + ++ E  + +  IN+ S+       + +  K L +  V  SIV    P
Sbjct:   10 NDQNNLKILR-QVEFYLSEGNLNRDSFFKQEMQKRDDGGIPIDLLLKCNRMIAMNVTEDILKNVVGTSKIVSLSNDGLAIVRVLPLSELGPRERRTILVTGLPRLSIGITEKVGVDNTPHRQSSKPSENELKNITSASWELGDWIRNVFEEYGEVLFVSLPRYHHSNSFRGFAFVEFRTSKSARKAAKHMCVFMENENWLVQPTETNEVSECPESAWKPRLASKVSFSPQQMLARRHIWRCCSRKNKQLIAAFKHLRQVGYTASNPCDKEYYSIILGDNSTEAILNYVKNNRSYEPCQSKLRVFRYSDWIFWKQKFYLWQQAWIARMHHKTELLMTNKNISSNDEYDEDATMEEKECYQIDSEINRNSLPVKCLDESSTRPKALPNNFVPNSIVQIYWP 407          
BLAST of La-domain-containing protein vs. TrEMBL
Match: A0A1I8I253 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.632e-20
Identity = 90/351 (25.64%), Postives = 154/351 (43.87%), Query Frame = 1
Query:   97 LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDL---------IRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKA---LNEYKISEFELRKAESWKYFSFSNS--QYTHALK----QLELLGYPQKIFFEP----IIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDF 1080
            L + +K QLEFY  EGNL +D F++  +  +++  + +   L+FN++IE      +         +R A+  S++L  D++   ++R   L  L+PV+ RT+++ G         S   V +D + K F   GQ+L I LP Y ++   +GF F+EF T  E + A   LN    S++   +A   K+ S   S  +    LK    QLE   Y Q    +              +  +++ + K EW   R     A+ + +A+++   S+ Q  +S E S    E      T     ++ +   +  L+D    G +         T+K I+  L      D +AYID 
Sbjct:  437 LTEQLKRQLEFYLGEGNLLKDRFLRSELDKTEDGYLPLRLFLRFNRVIEFCHRAGVKQRDQILARLRVAIGASRLLALDDDGLRVRRAAPLRQLEPVDERTVYVDGLCGTGASGGSGCKVDRDSVAKMFSTVGQVLYISLPCYRTTGDSKGFAFVEFETSAEAQLAVDRLNSVPRSQW---RARLPKFSSQVRSLLRAAQVLKIDTTQLETALYDQGCGGDSGDSAGTSSTSGSASGKRLAVMPKAEWERLRQEMKSARDREVAKLK---SRVQKAKSAEASRANVEDAAGGATGPPAHLRFSAGLIVRLTD--ADGGL---------TRKRIRDQLPLGEARDAVAYIDI 770          
BLAST of La-domain-containing protein vs. TrEMBL
Match: A0A1I8HDK8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 8.402e-20
Identity = 90/351 (25.64%), Postives = 154/351 (43.87%), Query Frame = 1
Query:   97 LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDL---------IRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKA---LNEYKISEFELRKAESWKYFSFSNS--QYTHALK----QLELLGYPQKIFFEP----IIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDF 1080
            L + +K QLEFY  EGNL +D F++  +  +++  + +   L+FN++IE      +         +R A+  S++L  D++   ++R   L  L+PV+ RT+++ G         S   V +D + K F   GQ+L I LP Y ++   +GF F+EF T  E + A   LN    S++   +A   K+ S   S  +    LK    QLE   Y Q    +              +  +++ + K EW   R     A+ + +A+++   S+ Q  +S E S    E      T     ++ +   +  L+D    G +         T+K I+  L      D +AYID 
Sbjct:  652 LTEQLKRQLEFYLGEGNLLKDRFLRSELDKTEDGYLPLRLFLRFNRVIEFCHRAGVKQRDQILARLRVAIGASRLLALDDDGLRVRRAAPLRQLEPVDERTVYVDGLCGTGASGGSGCKVDRDSVAKMFSTVGQVLYISLPCYRTTGDSKGFAFVEFETSAEAQLAVDRLNSVPRSQW---RARLPKFSSQVRSLLRAAQVLKIDTTQLETALYDQGCGGDSGDSAGTSSTSGSASGKRLAVMPKAEWERLRQEMKSARDREVAKLK---SRVQKAKSAEASRANVEDAAGGATGPPAHLRFSAGLIVRLTD--ADGGL---------TRKRIRDQLPLGEARDAVAYIDI 985          
BLAST of La-domain-containing protein vs. TrEMBL
Match: A0A267DEZ2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001906g2 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.706e-20
Identity = 98/413 (23.73%), Postives = 177/413 (42.86%), Query Frame = 1
Query:   94 KLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDL---------IRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKA---LNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYP----QKIFFEPIIGEQRKEKTNS----------KISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRF---KNSENANKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSKQ 1242
            +L + +K QLEFY  EGNL +D F++  +  +++  + +   L+FN++IE      +         +R A+  S++L  D++   ++R   L  L+PV+ RT+++ G   +     S   V +D + K F   GQ+L I LP Y ++   +GF F+EF T  E + A   LN    S++  R  +    FS   SQ    L+  E+L       +   ++   G    +   +          +++ + K EW   R     A+ + +A++R   S+ Q  +S E +    E            ++ +   +  L+D    G +         T+K I+  L      D +AYID  +       R      ++       +    LS   +L  +QE++Y +KI  D + K 
Sbjct:   18 ELTEQLKRQLEFYLGEGNLLKDRFLRSELDKTEDGYLPLRLFLRFNRVIEFCHRAGVKQRDQILARLRVAIGASRLLALDDDGLRVRRAAPLRQLEPVDERTVYVDGLCGSGASGGSGCKVDRDSVAKMFSTVGQVLYISLPCYRTTGDSKGFAFVEFETSAEAQLAVDRLNSVPRSQWRARLPK----FS---SQVRSLLRAAEVLKIDTTQLETALYDQGCGGDSGDSVGTSSTSGSASGKRLAVMPKAEWERLRQEMKSARDREIAKLR---SRVQKAKSAEANRANVEDAAGGAAGPPAHLRFSAGLIVRLTD--ADGGL---------TRKRIRDQLPLGEARDAVAYIDIDEDGRGACLRCRDAAAADRLLALPQLTTPPLS-AELLVGQQERDYWDKIRRDWEEKH 408          
BLAST of La-domain-containing protein vs. Ensembl Cavefish
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:103043855])

HSP 1 Score: 79.7221 bits (195), Expect = 3.928e-15
Identity = 51/162 (31.48%), Postives = 92/162 (56.79%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP--VNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+L+  +K Q+EF+F + NL +D+F+Q  I  S++  + I  L  FNK+ +L     LI  A+  S ++  + +   I+RK +L + KP  +++RT+++            P DVT   I++ F   G ++ I +P+Y  S++ +GF F+EF T  + +KA+
Sbjct:   34 KQLLADVKKQVEFWFDDVNLHKDKFLQNVISKSRDGYVDISLLTTFNKMKKLTTDVKLIARALTNSSVVEVNLKGTQIRRKNQLGD-KPQDIDSRTVYVELL---------PKDVTHVWIERVFSKCGNVVYISIPRYKISESPKGFAFVEFETDAQAQKAI 185          
BLAST of La-domain-containing protein vs. Ensembl Sea Lamprey
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:334956])

HSP 1 Score: 75.485 bits (184), Expect = 1.638e-14
Identity = 48/161 (29.81%), Postives = 88/161 (54.66%), Query Frame = 1
Query:   94 KLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKP--VNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K++  I+ Q+EF+F + NL +D+F+++ + AS +  + +  L+ FN++  L    ++IR AV+ S  L    +   I+R   L   KP   + RT+++         ++ P  VT + + + F   G++L + LP++ SS   +GF FIEF T  E  +A+
Sbjct:   45 KILSEIRRQIEFWFGDTNLHKDKFLRQVVDASPDGFVPLSVLMSFNRMKTLSTDINIIRRAVSTSTQLEVSSDGLKIRRSSPL-GPKPEDEDERTVYV---------ERLPHGVTHEWLSRVFSPCGRVLYVSLPRFRSSGDAKGFAFIEFSTSEEACRAV 195          
BLAST of La-domain-containing protein vs. Ensembl Sea Lamprey
Match: ssb (small RNA binding exonuclease protection factor La [Source:ZFIN;Acc:ZDB-GENE-030131-223])

HSP 1 Score: 53.5286 bits (127), Expect = 9.739e-8
Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 1
Query:   97 LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKS--KILIFDEENKGIKRKIEL 342
            L K I +Q+E+YF   NL RD+FMQ+ +K   +  I +E L+KFN+L  L     +I SAV  S   +L+  E+N  I+RK EL
Sbjct:   13 LQKKIYTQIEYYFGNHNLVRDKFMQEQLKLD-DGWIPLETLVKFNRLSALSKDFAVIASAVKLSPNDLLVVSEDNTKIRRKPEL 95          
BLAST of La-domain-containing protein vs. Ensembl Yeast
Match: LHP1 (RNA binding protein required for maturation of tRNA and U6 snRNA; acts as a molecular chaperone for RNAs transcribed by polymerase III; homologous to human La (SS-B) autoantigen [Source:SGD;Acc:S000002209])

HSP 1 Score: 48.9062 bits (115), Expect = 8.860e-7
Identity = 40/160 (25.00%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  118 QLEFYFSEGNLPRDEFMQKCIKASQNKS-ILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTR------TIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEY 576
            Q+EFYFSE N P D F++    A +N   + I  +  FN++ + +   D +  A+  S+IL    + + +KR++ L+     N R      T+ +  F + + +     ++ ++++  FK  G+I ++ L +   ++   G   +EF T  E    L  Y
Sbjct:   36 QVEFYFSEFNFPYDRFLRTT--AEKNDGWVPISTIATFNRMKKYRPV-DKVIEALRSSEILEVSADGENVKRRVPLDLTAARNARIEQNQRTLAVMNFPHEDVEASQIPELQENLEAFFKKLGEINQVRLRRDHRNKKFNGTVLVEFKTIPECEAFLKSY 192          
BLAST of La-domain-containing protein vs. Ensembl Nematostella
Match: EDO33058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST95])

HSP 1 Score: 72.0182 bits (175), Expect = 5.276e-13
Identity = 43/154 (27.92%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   97 LVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTET 555
            LV  +K Q++FYFS+  L +D F+++ I+   +  + I  +  FNK+ ++     L++ A+  S+ L  +E+   ++R   L   + V+  T+++         +K P     D +KK F  FG++L + LP++  +  ++GF FIEF +K + 
Sbjct:   25 LVNQLKEQIDFYFSDSALLKDRFLKQQIENHPDGYVAISTIASFNKIKQMTDDIKLVKKAMKLSQQLELNEDGTMVRRMAPLPQPRNVDAETVYV---------EKLPFHADHDWLKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQA 169          
BLAST of La-domain-containing protein vs. Ensembl Nematostella
Match: EDO45820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRT7])

HSP 1 Score: 48.521 bits (114), Expect = 6.043e-6
Identity = 43/167 (25.75%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  103 KLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSK--ILIFDEENKGIKR-------KIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNE 573
            K++K Q+EFYF + NLPRD+F+++  +   +  +  E L  FN+L  +    + +   + KS   ++   E+   ++R       ++  E  +    +T+++ GF         P + T D +++ F+  G+I+ I + K   S+  +G  FIEF T  E +  + E
Sbjct:   22 KIVK-QIEFYFGDKNLPRDKFLRQKTE-EDDGWVTFECLATFNRLKSMSDDVNFLAKTMKKSSSDLIEVSEDLTKVRRTKSKPVEELTTEARQKAKAKTVYVKGF---------PKEATLDELQEYFEGKGKIVFIMMRKTLESKEFKGSVFIEFATLPEAKAFVEE 177          
BLAST of La-domain-containing protein vs. Ensembl Medaka
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:101168323])

HSP 1 Score: 73.9442 bits (180), Expect = 2.192e-13
Identity = 45/162 (27.78%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   91 KKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTR--TIFISGFLNNENQKKSPDDVTKD-IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKAL 567
            K+L+  +K Q+EF+F + NL +D F++K I+ S +  + I  L  FN++ +L   P LI  A+  S ++  + E   ++R+  L +  P+N+   T+++            P DV+   I++ F   G +  + +P+Y ++   +GF F+EF  + + +KA+
Sbjct:   34 KQLLGDVKKQVEFWFGDANLHKDRFLKKIIEESDDGYVDISVLTGFNRMKKLTTDPKLIARALKNSTLVEVNLEGNKVRRQQPLGD-PPINSDSCTVYVELL---------PKDVSHSWIERVFSKCGNVTYVSIPRYRTTGDSKGFAFVEFENEEQAQKAI 185          

HSP 2 Score: 50.0618 bits (118), Expect = 5.924e-6
Identity = 43/170 (25.29%), Postives = 77/170 (45.29%), Query Frame = 1
Query:  745 ISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPEN-STKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKF----ADIEVSNLSDLHVLNARQEQEYMEKILLDKQSK 1239
            +  +SKKEW+  +  +   Q+  ++ ++   ++   IES E    +   V++++  N+             S Q VSG IV     +    +K +K  L ++    ++AY+D  D    G+ RF   E A       A ++  +   + +L   QEQ Y  KIL+D+Q K
Sbjct:  356 LRVLSKKEWLQLKQQYLALQKSSMSSLKKCFNK---IESKEQGSAEDRSVESKKENNQ-------------SPQFVSGVIVKITDSKPLPARKIVKEILCEVS---QVAYVDILDGDSEGYVRFLTPEGAKGVCQAKAQLQKEHSWKVEILTGDQEQRYWHKILVDRQVK 506          
BLAST of La-domain-containing protein vs. Ensembl Medaka
Match: ssb (small RNA binding exonuclease protection factor La [Source:NCBI gene;Acc:101158398])

HSP 1 Score: 52.7582 bits (125), Expect = 8.705e-7
Identity = 33/103 (32.04%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSK--ILIFDEENKGIKR-------KIELENLKPVNTRTIFISGF 390
            +  QLE+YF + NLPRD F+++ ++   +  + +E +LKFN+L  L     +I SA+ KSK  +L   E+   ++R       ++  E    V  R+++I GF
Sbjct:   15 VARQLEYYFGDHNLPRDRFLKEQLQLD-DGWVTLETMLKFNRLKSLTTENSVIISALQKSKTGLLEISEDKTKVRRSPDKPLPEVNDEYKDAVKHRSVYIKGF 116          
BLAST of La-domain-containing protein vs. Ensembl Medaka
Match: ssb (small RNA binding exonuclease protection factor La [Source:NCBI gene;Acc:101158398])

HSP 1 Score: 52.373 bits (124), Expect = 9.481e-7
Identity = 33/103 (32.04%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  109 IKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSK--ILIFDEENKGIKR-------KIELENLKPVNTRTIFISGF 390
            +  QLE+YF + NLPRD F+++ ++   +  + +E +LKFN+L  L     +I SA+ KSK  +L   E+   ++R       ++  E    V  R+++I GF
Sbjct:   15 VARQLEYYFGDHNLPRDRFLKEQLQLD-DGWVTLETMLKFNRLKSLTTENSVIISALQKSKTGLLEISEDKTKVRRSPDKPLPEVNDEYKDAVKHRSVYIKGF 116          
BLAST of La-domain-containing protein vs. Planmine SMEST
Match: SMESG000016232.1 (SMESG000016232.1)

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 408/413 (98.79%), Postives = 411/413 (99.52%), Query Frame = 1
Query:   67 MASALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKNSENANKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSKQESQKRKNDRKRKHKEISGVSQ 1305
            MASALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKIL FDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTK+IKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFK+SENA KFA+IEVSNLSDLHVLNARQEQEYMEKILLDKQSKQESQKRKNDRKRKHKEISGVSQ
Sbjct:    1 MASALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILTFDEENKGIKRKIELENLKPVNTRTIFISGFLNNENQKKSPDDVTKEIKKKFKVFGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQLELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHLAEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQIVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFKSSENAKKFAEIEVSNLSDLHVLNARQEQEYMEKILLDKQSKQESQKRKNDRKRKHKEISGVSQ 413          
BLAST of La-domain-containing protein vs. Planmine SMEST
Match: SMESG000028878.1 (SMESG000028878.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.518e-9
Identity = 47/165 (28.48%), Postives = 83/165 (50.30%), Query Frame = 1
Query:  100 VKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIEDLLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIEL---ENLKPVN----TRTIFISGFLNNENQKKSPDDVTKDIKKKFKV-FGQILRIDLPKYPSSQTLRGFGFIEFMTKTETRKALN 570
             KL+K Q+E+YFS+ NL +D+ ++  I  S    +  ++LLKF +L  +    DLI+ AV  SK  I +  ++GI+R   L    NL+ +      R++++ GF        S  D    I +  ++  G  + I + + P  +T +G  F  F  + + +K L+
Sbjct:    6 TKLVK-QIEYYFSDINLVKDKHLKNLIDNSTEGWVSYDELLKFPRLKSISDDKDLIKLAVQNSKSEIVEANDEGIRRNSSLILPSNLQEITEKNIDRSVYVKGF--------STQDTIDSIMEFLELNGGPTMNIHMRRLPKDKTFKGSVFAVFKNQEDAKKFLS 161          
The following BLAST results are available for this feature:
BLAST of La-domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LARP72.481e-1430.63La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.188e-1430.63La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.188e-1430.63La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.188e-1430.63La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.351e-1430.63La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ssb-12.041e-1129.35Sjogren Syndrome antigen B homolog [Source:UniPro... [more]
ssb-12.041e-1129.35Sjogren Syndrome antigen B homolog [Source:UniPro... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Larp77.293e-1629.30gene:FBgn0260771 transcript:FBtr0301275[more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
larp77.714e-1732.16La ribonucleoprotein 7, transcriptional regulator ... [more]
larp72.209e-1631.79La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ybx39.662e-2123.24Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
ybx35.368e-1922.56Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
ybx36.097e-1922.56Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
ybx32.150e-1329.19Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Larp79.306e-1431.06La ribonucleoprotein domain family, member 7 [Sour... [more]
Ssb4.128e-832.61Sjogren syndrome antigen B [Source:MGI Symbol;Acc:... [more]
Ssb7.156e-831.61Sjogren syndrome antigen B [Source:MGI Symbol;Acc:... [more]
Ssb9.325e-832.61Sjogren syndrome antigen B [Source:MGI Symbol;Acc:... [more]
Ssb9.325e-832.61Sjogren syndrome antigen B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of La-domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZWE3|LARP7_DANRE1.758e-1531.79La-related protein 7 OS=Danio rerio OX=7955 GN=lar... [more]
sp|Q4G0J3|LARP7_HUMAN2.492e-1330.63La-related protein 7 OS=Homo sapiens OX=9606 GN=LA... [more]
sp|Q4R627|LARP7_MACFA3.012e-1330.63La-related protein 7 OS=Macaca fascicularis OX=954... [more]
sp|Q05CL8|LARP7_MOUSE6.510e-1331.06La-related protein 7 OS=Mus musculus OX=10090 GN=L... [more]
sp|Q5XI01|LARP7_RAT9.651e-1331.06La-related protein 7 OS=Rattus norvegicus OX=10116... [more]
back to top
BLAST of La-domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FR077.707e-2123.77Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A430QKE32.627e-2024.31La-related protein 7 OS=Schistosoma bovis OX=6184 ... [more]
A0A1I8I2536.632e-2025.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HDK88.402e-2025.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DEZ28.706e-2023.73Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
larp73.928e-1531.48La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
larp71.638e-1429.81La ribonucleoprotein 7, transcriptional regulator ... [more]
ssb9.739e-842.86small RNA binding exonuclease protection factor La... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LHP18.860e-725.00RNA binding protein required for maturation of tRN... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO330585.276e-1327.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458206.043e-625.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of La-domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
larp72.192e-1327.78La ribonucleoprotein 7, transcriptional regulator ... [more]
ssb8.705e-732.04small RNA binding exonuclease protection factor La... [more]
ssb9.481e-732.04small RNA binding exonuclease protection factor La... [more]
back to top
BLAST of La-domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016232.10.000e+098.79SMESG000016232.1[more]
SMESG000028878.12.518e-928.48SMESG000028878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010543 ID=SMED30010543|Name=La-domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2020bp
CTTTGATAATTTAATAGAGATTGTACAATTCAATTTCAAAAAGTATCGAC
AGTAAATATTTAAAAAATGGCCAGTGCTTTGATTAGTGATAAAAAATTAG
TTAAGCTTATTAAAAGTCAGTTAGAGTTTTATTTCAGCGAAGGAAATTTG
CCTCGTGATGAATTCATGCAAAAATGTATAAAAGCTTCACAAAACAAATC
TATACTGATTGAAGATTTGTTGAAATTTAATAAATTAATTGAATTAAAAG
CAACTCCGGATTTAATAAGAAGTGCTGTGAATAAATCAAAAATATTAATT
TTCGACGAAGAAAATAAAGGCATTAAACGAAAAATTGAATTAGAAAATTT
AAAACCTGTAAATACTCGAACAATATTTATTTCAGGATTTCTAAATAATG
AAAACCAGAAAAAGAGCCCTGATGATGTTACAAAAGATATTAAGAAAAAA
TTTAAAGTATTTGGCCAAATTTTACGAATTGATCTGCCAAAATATCCATC
ATCGCAAACTTTAAGAGGATTTGGTTTTATTGAATTTATGACAAAAACAG
AAACTAGGAAAGCATTGAATGAATATAAGATTTCGGAATTTGAATTGAGA
AAGGCTGAATCATGGAAATATTTTTCTTTTTCAAATAGTCAATACACTCA
CGCCTTAAAGCAATTGGAATTATTAGGCTATCCACAGAAAATATTCTTTG
AACCAATCATTGGAGAGCAAAGAAAAGAGAAAACGAATTCAAAAATTTCA
GCTATATCAAAAAAAGAATGGATGATTTTCCGTAATGGATTTTATGAGGC
GCAACAAAAACATTTAGCGGAAATGAGGGTTTTGATTTCCCAGCACCAAT
CGATAGAGAGCACCGAATACAGTCACAAGCAGCATGAACGGGTTAAGGCT
GAACAGACAATTAATAAGCAGTCGATCCAGGCAACTGGATCAGCCGTGAA
AGAGTTATCTGATCAGATCGTTTCTGGATCAATTGTTGGTTTCGTGTGCC
CGGAAAATAGCACGAAGAAAACGATTAAGTCCTCACTGACCCAGTTGGGA
ATGTTAGATGAGATTGCTTATATCGATTTCCGGGATTTTAGTCTGACCGG
GCATTTTCGCTTCAAGAATTCCGAAAACGCCAACAAATTTGCGGATATCG
AAGTATCTAATTTATCCGATCTGCACGTTCTGAATGCCCGTCAAGAACAG
GAATATATGGAAAAGATTCTACTCGATAAACAGTCAAAACAAGAGAGCCA
GAAGCGGAAAAACGATAGAAAAAGAAAACATAAAGAAATTTCAGGAGTTT
CACAGTGAATTCTGTTTGGTTTGTCTATGAAATATATTTCGGCTTGCGAG
TTGTGTTGAAATTAATGATGTGCCAGTGATCTCGTTGGGAATTTATTGGT
GTTGCATGTGGACAAGGGTTATTTGTTGTGCGGTGGATGCACTATTGAAT
GTATTCACATTTCCATGCGGGAAATGCCTGCAATAGGTCTTTCAGATCCC
AGGAATAATAGCTGATATTATGCACAATTATATAGAATTATAATTGATTG
AATGTTGCGTAAAATCGATGCTATTAATCCGATAACCATTATTGATGATA
CGGAGCAAAATGGCGAACACAAGACCAGGAGCATTTATTACCACCACAAA
TTCTATTACACAACACTAATGATAATAATAAACACAATGACGTAATAATA
ATAATAATAATATCGATAATAGCATCACTGTCGTTCCTGAGATAATTAAA
TCTAAATACAGACCGATAAGGAATTCTAATATTATTAATAAAGTATTGGC
AGTATTTACACGCACACACACACACACCGAGAGTGTGAATATCGATCAGG
CTGTTAGTGGTACCGTGATCCAATATTTACAGAAACCAATCAATCGAGCG
CATCTAATCAATAAACCGGACAAGGAGGAACAATTACACCAACAAATTAG
AACTATGACTATTGGCGGATGAAAGACTCGAAGTGGATTGGTGACATTCC
TGCAGTCGACACGAGAGATC
back to top

protein sequence of SMED30010543-orf-1

>SMED30010543-orf-1 ID=SMED30010543-orf-1|Name=SMED30010543-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MASALISDKKLVKLIKSQLEFYFSEGNLPRDEFMQKCIKASQNKSILIED
LLKFNKLIELKATPDLIRSAVNKSKILIFDEENKGIKRKIELENLKPVNT
RTIFISGFLNNENQKKSPDDVTKDIKKKFKVFGQILRIDLPKYPSSQTLR
GFGFIEFMTKTETRKALNEYKISEFELRKAESWKYFSFSNSQYTHALKQL
ELLGYPQKIFFEPIIGEQRKEKTNSKISAISKKEWMIFRNGFYEAQQKHL
AEMRVLISQHQSIESTEYSHKQHERVKAEQTINKQSIQATGSAVKELSDQ
IVSGSIVGFVCPENSTKKTIKSSLTQLGMLDEIAYIDFRDFSLTGHFRFK
NSENANKFADIEVSNLSDLHVLNARQEQEYMEKILLDKQSKQESQKRKND
RKRKHKEISGVSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0005634nucleus
GO:0030529intracellular ribonucleoprotein complex
GO:0019013viral nucleocapsid
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR035979RBD_domain_sf
IPR002344Lupus_La
IPR000504RRM_dom
IPR006630La_HTH
IPR014886La_RRM
IPR011991WHTH_DNA-bd_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002344Lupus La proteinPRINTSPR00302LUPUSLAcoord: 18..35
score: 57.58
coord: 44..59
score: 26.7
coord: 95..111
score: 26.74
coord: 149..167
score: 28.23
IPR006630La-type HTH domainSMARTSM00715lacoord: 9..89
e-value: 1.2E-7
score: 37.8
IPR006630La-type HTH domainPFAMPF05383Lacoord: 15..72
e-value: 4.2E-13
score: 49.1
IPR006630La-type HTH domainPROSITEPS50961HTH_LAcoord: 5..100
score: 16.776
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 102..180
e-value: 2.5E-4
score: 30.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 123..176
e-value: 1.7E-7
score: 31.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 101..182
score: 11.793
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 7..94
e-value: 1.2E-17
score: 65.5
IPR014886La protein, RNA-binding domainPFAMPF08777RRM_3coord: 307..398
e-value: 1.6E-11
score: 44.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 289..400
e-value: 2.5E-8
score: 35.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 95..187
e-value: 1.0E-9
score: 40.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 385..413
NoneNo IPR availablePANTHERPTHR22792LUPUS LA PROTEIN-RELATEDcoord: 9..179
NoneNo IPR availablePANTHERPTHR22792LUPUS LA PROTEIN-RELATEDcoord: 221..406
NoneNo IPR availablePANTHERPTHR22792:SF115LA-RELATED PROTEIN 7coord: 9..179
NoneNo IPR availablePANTHERPTHR22792:SF115LA-RELATED PROTEIN 7coord: 221..406
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 6..91
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 94..170