G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30010542
Length (bp)1604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010542) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010542) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010542) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010542) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010542

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30010542 SmedASXL_007430SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
anterior pole progenitor cellSMED30010542 SMED30010542smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30010542 SMED30010542smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30010542 SmedASXL_007430SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010542 SmedASXL_007430SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30010542 dd_Smed_v4_13860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010542 OX_Smed_1.0.13994ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gpr139 (G protein-coupled receptor 139 [Source:NCBI gene;Acc:798482])

HSP 1 Score: 54.6842 bits (130), Expect = 1.391e-7
Identity = 73/313 (23.32%), Postives = 138/313 (44.09%), Query Frame = 3
Query:  423 IGICVILATIVIIKSKCLGKFTNNY-YLIALGIIDVCSLITILLISPPAQRWIPFLEN--MKELMPPYLSTILQM----TVFISNWITVALALDRHQAICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQXXXXXXXXXXXXTEVLSFLKYTSLGMNTFYSNFH-LWFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASFTKENIKICVLLSCLITSFVFLQIP--FVILIFLINYRPSMFNGNK-IQLYSQIVTFLYVLKHDINFLFYLWLSKRFMR----TIQAFVCFNCNN 1316
            +G+   + T++I+    L +  ++Y YL+AL + D+  L+ I+ +          LE+  +   +P  L+  +Q+    ++  S WITV L +DR+ A+C P  Y++ SY    +   ++ +  GC++   P            + E+   L   S G  +  +  H L +V+   + LLP  +   +N  +++      R  ++ R  S  K+              +L  + + F  L  P   +IL  L   +P+M    + + L + +   L +L   +NF  Y ++SKRF R     ++AF  F C  
Sbjct:   38 LGLPANILTVIILSQLVLRRQKSSYNYLLALAVADILVLLLIVFVDF-------LLEDFILGAPLPHSLNKAVQVLEFSSIHTSIWITVPLTIDRYIAVCHPLRYHTVSYPARTRK-VILAVYAGCLISSVP---------YYWWPELWHGLPGASPGGRSSSAGQHVLVWVHCATVYLLPCSVFFSLNA-IIVRKLRCRRSCFRLRGYSTGKTT------------AILLAITSVFAVLWAPRTLMILYHLYTVQPAMPGPARLLHLVTDVANMLALLNTGVNFFLYCFISKRFRRMAGTVLKAF--FRCRK 318          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0L8FQN5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22010749mg PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.025e-16
Identity = 86/318 (27.04%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  387 LFVSIITPWSCAIGICVILATIVIIKSKCLGKFTNNYYLIALGIIDVCSLITILLISPPAQRWIPFLE----NMKELMPPYLSTILQMTVFISNWITVALALDRHQAICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQXXXXXXXXXXXX-TEVLSFLKYTSLGMNTFYSNFHLWFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASF--TKENIKICVLLSCLITSFVFLQIPFVILIFLINYRPSMFNGNKIQLYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQAFVCFNCNNI 1319
            + V ++ P +C  GI  I+ T++I+  K +   TN Y L  L   D+  LI + L     + W   +     N  E+   Y    L+M   +S W+TV LA++R  AIC P+       T++   C ++ I I   +  +P F  +    S N   E    L  T L     ++  + W +  +  +++P  +IL++N+ L+  +  ST++L +     I  + + SF  + E +KI  +L  +   F+  Q P+V+  +LI+ +          L   I   L  LK  INF+ Y W S+RF  T +  +CF C  +
Sbjct:   20 VLVEVVLPSACICGIVGIITTLIILSHKHMATSTNTY-LTGLAAADLMFLIIVSL-----RLWGVMVSHSDLNTWEIFTAYSEIFLRMFNLVSVWMTVMLAVERFIAICIPYKAMDMC-TIYRSRCIVVFIYIAAFVCQSPHFAKYKIVTSHNEFNETEYTLHQTLLSGEILFTIIYGWVLEGLSGVIVPFVLILVLNSRLIYEIHKSTQYLKR----QIGANTRTSFDISSEQMKITTMLIAMCVVFLICQAPYVLYNYLISIQAGSLRSRNHLLIMAISILLAALKSSINFVLYCWFSERFWTTFKTIMCFRCARL 326          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A210PPP6 (FMRFamide receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT25244 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.842e-9
Identity = 84/327 (25.69%), Postives = 150/327 (45.87%), Query Frame = 3
Query:  348 NNGT----FEYSPWINTLFVSIITPWSCAIGICVILATIVIIKSKCLGKFTNNYYLIALGIIDVCSLITILLISPPAQRWIPFLENMKELMPPYLSTILQMTVFISNWITVALALDRHQAICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQXXXXXXXXXXXXTEVLSFLKY-----TSLGMNTFYSNFHLWFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASFTKENIKICVLLSCLITSFVFLQIPFVILIFLINYRP----SMFNGNKIQLYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQ 1289
             NGT       SP  N LF  ++ P  C  GI  I+ T++++  K +   TN Y L +L I D+   + IL       R   +  ++ ++   Y    L   +  S W+TV LA++R+ AIC P     ++ ++     A I+I++  V  +  +   F        T    + ++     T LG N  Y   + W V+ I+  +LP   +L +N  L+I +  ST++L    +L    +++ + + E +KI ++L  +I  F   Q P+VI +   N       ++     +++ +    F+  LK  INF+ Y W S++F  T +
Sbjct:   42 KNGTTSSMLRSSPSYNLLF-KVLLPIICVSGIVGIILTVMVLSRKNMCTSTNCY-LTSLSIADL-GFLVILSTKFLEYRITGYPFHVFDIYFTYAQIFLHTFLLASVWLTVMLAIERYIAICHPL----RAISICTVRRARIIIVVIFVFSFYCRVPNFFEQEIKTVTPCPGYPEFRHMVLTKLGQNLTYKISYAWVVDCIICAILPFIALLFLNIRLIIEIRKSTKYLRY--HLGTDSNMQNAVSNEQLKITMMLISIIFVFFVCQAPYVITMAYRNIHQYTSRTILRSLTMEIVADATIFMLALKSAINFILYCWFSEKFWNTFK 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TMC4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215199 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.693e-8
Identity = 70/239 (29.29%), Postives = 118/239 (49.37%), Query Frame = 3
Query:  636 MTVFI--SNWITVALALDRHQAICKPFNYYSQSYTLHNKTCA-------LILIIIGCVLLYTPQ--XXXXXXXXXXXXTEVLSFLKYTSLGMNTFYSNFHLWFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASFT--KENIKICVLLSCLITSFVFLQIPFVI--LIFLINYRPSMFNGNKIQ--LYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQAFVC 1301
            M VF+  S W+TV LA++R+ AIC+PF        L  K C+       ++ I +   L+  P          F +     +S+ K T L  N  Y   + W V+ IL+ +LP  ++L++N  L+  V  STR+L      S+S   +++ T  KE ++I V+L  +I  F   Q P+V+   IF IN +  + +G+     ++ Q+   +   K  +NF+ Y W S++F  T++   C
Sbjct:  114 MHVFLMASIWLTVMLAVERYIAICQPF--------LAAKVCSVKRARIFVVSIYVFAFLVRLPAFWEHEVVTRFDTLSNTSISYTKSTELASNVHYLRINPWVVDGILMSILPFILLLVLNVRLIWEVRKSTRYLQATMVASVSAPGRSAGTIKKEELQITVMLISIIIVFFICQAPYVVYTAIFSIN-KDILSSGSSTGFLIFHQLAIVVLAFKSAVNFIIYCWFSEKFWATLKKIFC 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000039899.1 (SMESG000039899.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.934e-11
Identity = 75/319 (23.51%), Postives = 145/319 (45.45%), Query Frame = 3
Query:  381 NTLFVSIITPWSCAIGICVILATIVIIKSKCLGKFTNNYYLIALGIIDVCSLITILLISPPAQRWIPFLENMKELMP------PYLSTILQMTVFISNWITVALALDRHQAICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQXXXXXXXXXXXXTEVLSFLKYTSLGMNTFYSNFHL---WFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASFTKENIKICVLLSCLITSFVFLQIPFVILIFLIN---YRPSMFNGNKIQLYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQAFVC 1301
            N +  + +TP    I I VI+ T++II  + L   +   Y+ ALG++D+  L+ + + S        F+ N    MP       Y+  + +  + +SNW+T  L ++R+  +  PF   ++  T  ++    +   +G VL+  P   +  NY S    +   F ++T     + + NF L   W V+  L L++P  +++ VN  L++ +  S+RF+ Q+       +       E  KI  ++ C+I +F   Q PF+    L N   +     NG    +  ++   +  +K D +F+ + W+  +F   ++   C
Sbjct:   26 NRVIKNYLTPLMSVISITVIVITLLIIHKRNLW-ISTRIYITALGLVDILGLVILTIASLDY-----FVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPF--LTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNND---FQQHTQEIEKSLH-NFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQY-----CANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQ--SMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFC 325          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078268.1 (SMESG000078268.1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.495e-8
Identity = 77/299 (25.75%), Postives = 136/299 (45.48%), Query Frame = 3
Query:  444 ATIVIIKSKCLGKFTNNYYLIALGIIDVCSLITILL--ISPP-----------AQRWIPFLENMKELMPPYLSTILQMTVFISNWITVALALDRHQAICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQXXXXXXXXXXXXTEVLSFLKYTSLGMNTFYSNFHLWFVNXXXXXXXXXXXXXMVNTHLVICVTSSTRFLYQFRNLSISKSVKASFTKENIKICVLLSCLITSFVFLQIPFVILIFLINYRPSMFNGNKIQLYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQAFVC 1301
             TIVI   K +   +   ++  +GI+D+ +L+  ++  I  P             +W     N+K ++  +L  +    +FISNWITV L  +R+ A+C P   YS+     ++  A+ +I +  ++   P            Y      L+     +   Y++  LW + L L L++P   + ++N  L++ V  S+RFL Q  N + +     S T+E+    VL+  ++  FVF Q PF I + L       FN + I L   I + L  LK  ++F  Y W  ++F + +   +C
Sbjct:   40 GTIVIALKKGIW-LSTRMFMTIMGIVDLFALVLFIIFNIEKPLIELELLNFEMISKWF----NVKMILAEFLHGL----IFISNWITVLLGFERYIAVCYPL--YSRRIDYIHRKIAVAVIFVVIIIFKLP-------LIIMIYLHRFHDLRIQRNFIYKLYTHVQLWIITLFLFLIVPFVCLALINFQLILAVRRSSRFLRQCSNQNPNYQNSNSRTEEHKITFVLIGIIVIFFVF-QGPFGIYVTL-----QSFNYHSISLRG-ISSILLSLKSIVHFFLYCWFCEKFRQILYHLLC 313          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpr1391.391e-723.32G protein-coupled receptor 139 [Source:NCBI gene;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A0L8FQN52.025e-1627.04G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A210PPP61.842e-925.69FMRFamide receptor OS=Mizuhopecten yessoensis OX=6... [more]
R7TMC42.693e-829.29G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039899.11.934e-1123.51SMESG000039899.1[more]
SMESG000078268.13.495e-825.75SMESG000078268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010542 ID=SMED30010542|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1604bp
GATAACGTCAATATTTGCTTTACATTTGCACAGTGAAATTCTAATTTCTG
AAATTGATATCTTTGCTGATAAATTGTCAAATTTTTTCTTCGACAGCTGC
CATTCGATAATGAATGTTTTTCGTGTAGCCGATTGCAATGGCTTAATGTT
TGCAATTTCTCCACTGTCGACCAATAGGAATAGGCGGTCTTGTTTTAATG
CTTATAAATGACATTTGATCATTGGACAACCATATTTTTCACATGAATTC
ATCAGCCAAGAAATGGCGGTTGATCTGCAATACCGCCAATGAACTTTATA
TCGTTCTCGATTGTGATAGAAAGGATTTCAATATCAATCTATTGATGAAT
AACGGAACCTTTGAATATTCTCCGTGGATTAATACACTGTTCGTTAGCAT
CATAACTCCCTGGAGTTGTGCCATTGGAATTTGTGTCATTCTAGCAACAA
TTGTCATTATAAAATCGAAATGCTTGGGTAAATTTACGAATAATTATTAC
CTTATAGCACTTGGAATAATCGATGTTTGCAGTCTCATTACTATTTTGTT
AATTTCTCCTCCAGCCCAACGCTGGATTCCATTTCTTGAGAATATGAAAG
AACTGATGCCTCCCTATTTGTCCACAATTCTTCAAATGACAGTATTTATC
TCCAACTGGATAACGGTAGCCCTGGCACTCGATCGGCATCAAGCCATCTG
TAAACCGTTTAATTATTACAGCCAATCATACACCTTACACAACAAAACTT
GCGCACTGATCCTAATCATCATTGGATGCGTATTACTTTATACTCCTCAA
TTTTTTATTTTCTCCAATTATTTTTCGTCTAATTACACTGAAGTATTATC
ATTTTTAAAGTACACTTCTTTAGGAATGAATACATTTTATTCGAATTTCC
ATCTTTGGTTTGTTAATCTGATTCTTTTACTCTTACTTCCCACTGGAATC
ATTCTTATGGTGAACACGCATCTCGTTATTTGCGTAACAAGTTCCACGAG
ATTTTTGTACCAATTTAGAAATTTATCTATTTCTAAATCCGTCAAGGCAT
CTTTTACGAAAGAAAACATTAAGATATGTGTTCTTTTGTCGTGTTTAATC
ACCTCTTTTGTTTTTTTACAAATTCCATTTGTGATTCTGATTTTTCTGAT
TAACTACCGCCCGTCAATGTTTAACGGAAATAAAATACAGTTATATAGTC
AAATAGTAACTTTTCTTTATGTGTTGAAACACGATATCAATTTTCTGTTT
TATCTTTGGTTGAGCAAGCGGTTTATGAGAACTATCCAGGCTTTTGTTTG
TTTTAATTGCAATAATATTATTAGAAAAGGTTCAACGGTCAGATCGAAAA
TCTCATCTTCCAGGCGCAGGTCGAATCCAAATTAAATTATGGTAAACCAT
TGATGACTTAAAGCAGAGTATATATACATATATTTGTATGTTTGTGGAGA
TTTTTCAAGGCTTTTCATGTTTCATTTGGTGACGATACCAATTTTACATT
CCCATTAGCATTTCGCACTTGTATCTGACCAACAACAAATCATTTTTACA
TTGTATTTGTTTAATATATTAATTAATATATTATTATTATTCACTGAAAA
AAAA
back to top

protein sequence of SMED30010542-orf-1

>SMED30010542-orf-1 ID=SMED30010542-orf-1|Name=SMED30010542-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MNSSAKKWRLICNTANELYIVLDCDRKDFNINLLMNNGTFEYSPWINTLF
VSIITPWSCAIGICVILATIVIIKSKCLGKFTNNYYLIALGIIDVCSLIT
ILLISPPAQRWIPFLENMKELMPPYLSTILQMTVFISNWITVALALDRHQ
AICKPFNYYSQSYTLHNKTCALILIIIGCVLLYTPQFFIFSNYFSSNYTE
VLSFLKYTSLGMNTFYSNFHLWFVNLILLLLLPTGIILMVNTHLVICVTS
STRFLYQFRNLSISKSVKASFTKENIKICVLLSCLITSFVFLQIPFVILI
FLINYRPSMFNGNKIQLYSQIVTFLYVLKHDINFLFYLWLSKRFMRTIQA
FVCFNCNNIIRKGSTVRSKISSSRRRSNPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 83..104
score: 22.17
coord: 130..152
score: 24.88
coord: 319..345
score: 19.29
coord: 278..302
score: 18.12
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 67..327
e-value: 3.5E-10
score: 39.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 36..362
e-value: 2.2E-26
score: 94.5
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 36..375
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 50..348
e-value: 1.02173E-17
score: 80.7548
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 35..374
NoneNo IPR availableTMHMMTMhelixcoord: 219..241
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 281..303
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 85..104
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 64..337
score: 19.529