F-actin-capping protein subunit beta

Overview
NameF-actin-capping protein subunit beta
Smed IDSMED30010541
Length (bp)1111
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-actin-capping protein subunit beta (SMED30010541) t-SNE clustered cells

Violin plots show distribution of expression levels for F-actin-capping protein subunit beta (SMED30010541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-actin-capping protein subunit beta (SMED30010541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-actin-capping protein subunit beta (SMED30010541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30010541SMESG000008209.1 Contig1530GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30010541SMESG000008209.1 Contig1530GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010541SMESG000008209.1 dd_Smed_v4_1165_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010541SMESG000008209.1 dd_Smed_v4_1165_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Match: CAPZB (capping actin protein of muscle Z-line subunit beta [Source:HGNC Symbol;Acc:HGNC:1491])

HSP 1 Score: 366.696 bits (940), Expect = 8.361e-127
Identity = 176/271 (64.94%), Postives = 218/271 (80.44%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 271          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Match: CAPZB (capping actin protein of muscle Z-line subunit beta [Source:HGNC Symbol;Acc:HGNC:1491])

HSP 1 Score: 366.696 bits (940), Expect = 2.345e-126
Identity = 174/267 (65.17%), Postives = 215/267 (80.52%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:   34 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 300          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Match: CAPZB (capping actin protein of muscle Z-line subunit beta [Source:HGNC Symbol;Acc:HGNC:1491])

HSP 1 Score: 362.459 bits (929), Expect = 5.187e-125
Identity = 170/245 (69.39%), Postives = 206/245 (84.08%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRS 810
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS 245          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Match: CAPZB (capping actin protein of muscle Z-line subunit beta [Source:HGNC Symbol;Acc:HGNC:1491])

HSP 1 Score: 353.984 bits (907), Expect = 6.454e-122
Identity = 167/259 (64.48%), Postives = 208/259 (80.31%), Query Frame = 1
Query:  115 MRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            MRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 259          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Match: CAPZB (capping actin protein of muscle Z-line subunit beta [Source:HGNC Symbol;Acc:HGNC:1491])

HSP 1 Score: 329.717 bits (844), Expect = 2.192e-112
Identity = 156/227 (68.72%), Postives = 186/227 (81.94%), Query Frame = 1
Query:   76 RKMADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRK 753
            RK   QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVE   +  R+
Sbjct:   26 RKSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEVCADFCRQ 252          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Celegans
Match: cap-2 (F-actin-capping protein subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P34686])

HSP 1 Score: 328.176 bits (840), Expect = 3.960e-112
Identity = 155/266 (58.27%), Postives = 204/266 (76.69%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDS-GFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNK 882
            QLD ALDLMRRLPPQ  DK+L DLI+L P L +DLLS++DQPL+IA D ++GK YLL DYNRDGDSYRSPWSN+Y+PPLEDG LPS++ R +E+EAN AFE YR++Y++GGVSSVY WDLD+ GFAG VLIKK GD  K+ TGCWDSIHVIE+ E+   R A YKLTSTIMLWL T  S +G  NLGGSLTR  E +  + + N H+ N+GR++ED E+ +R  +N++YFG +K ++  LRS   ++  ++Q ++ +++  A+ N+
Sbjct:    5 QLDCALDLMRRLPPQHCDKNLTDLIDLCPHLVDDLLSTIDQPLKIAADRETGKQYLLCDYNRDGDSYRSPWSNTYDPPLEDGQLPSEKRRKMEIEANAAFESYRDLYFEGGVSSVYFWDLDNGGFAGIVLIKKEGDGAKNITGCWDSIHVIEITER--ARQAHYKLTSTIMLWLQTNKSSSGVMNLGGSLTRQHEMDAPINDQNTHLANMGRMIEDQESKMRLTINEIYFGKTKKVMSDLRSTEKQSELEKQDEIVRELNNAMANR 268          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Fly
Match: cpb (gene:FBgn0011570 transcript:FBtr0331630)

HSP 1 Score: 369.777 bits (948), Expect = 3.278e-128
Identity = 174/266 (65.41%), Postives = 213/266 (80.08%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKN 885
            Q+D ALDLMRRLPPQ+I+K+L DLI+L PDLCEDLLSSVDQPL+IAKD + GKDYLL DYNRDGDSYRSPWSNSY PPLEDG +PS+R+R LE+EAN AF+ YREMYY+GGVSSVYLWDLD GFA  +LIKKAGD  K   GCWDSIHV+EV+EK  GR A YKLTST MLWL T    +G+ NLGGSLTR  E++ +++E++ HI NIG++VE+MEN IR  LN++YFG +K++++ LRS  S   + QQ  + QD+  AI  +N
Sbjct:    5 QMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYLLCDYNRDGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVYLWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTNKQGSGTMNLGGSLTRQQEQDANVSESSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIVNGLRSTQSLADQRQQAAMKQDLAAAILRRN 270          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Fly
Match: cpb (gene:FBgn0011570 transcript:FBtr0077881)

HSP 1 Score: 369.777 bits (948), Expect = 3.278e-128
Identity = 174/266 (65.41%), Postives = 213/266 (80.08%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKN 885
            Q+D ALDLMRRLPPQ+I+K+L DLI+L PDLCEDLLSSVDQPL+IAKD + GKDYLL DYNRDGDSYRSPWSNSY PPLEDG +PS+R+R LE+EAN AF+ YREMYY+GGVSSVYLWDLD GFA  +LIKKAGD  K   GCWDSIHV+EV+EK  GR A YKLTST MLWL T    +G+ NLGGSLTR  E++ +++E++ HI NIG++VE+MEN IR  LN++YFG +K++++ LRS  S   + QQ  + QD+  AI  +N
Sbjct:    5 QMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYLLCDYNRDGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVYLWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTNKQGSGTMNLGGSLTRQQEQDANVSESSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIVNGLRSTQSLADQRQQAAMKQDLAAAILRRN 270          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Zebrafish
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:ZFIN;Acc:ZDB-GENE-030131-7023])

HSP 1 Score: 363.229 bits (931), Expect = 1.442e-125
Identity = 171/267 (64.04%), Postives = 214/267 (80.15%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP++DG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ +++E++ HI NIGRLVE+MEN IR  LN++YFG +K++++ LRS      + +Q  L  D+  A+  + Q
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEEMENKIRSTLNEIYFGKTKDIVNGLRSVQPLADKTKQEALKNDLIQALSQRKQ 271          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Xenopus
Match: rab3gap2 (RAB3 GTPase activating non-catalytic protein subunit 2 [Source:Xenbase;Acc:XB-GENE-987874])

HSP 1 Score: 190.66 bits (483), Expect = 2.127e-59
Identity = 101/162 (62.35%), Postives = 117/162 (72.22%), Query Frame = 1
Query:   82 MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRS--PWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGN 558
            M+  LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRS  PWS    PP  +  +    +R L V    A    R  Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+ +  
Sbjct:    1 MSIILDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSTDPWSAQVSPP-PNSHITCGSMRILGVCITFAPPPRR--YFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQVRAT 159          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Xenopus
Match: rab3gap2 (RAB3 GTPase activating non-catalytic protein subunit 2 [Source:Xenbase;Acc:XB-GENE-987874])

HSP 1 Score: 154.451 bits (389), Expect = 1.225e-44
Identity = 73/121 (60.33%), Postives = 90/121 (74.38%), Query Frame = 1
Query:  370 VEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVE 729
            V     F      Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ ++++++ HI NIGRLVE
Sbjct:   25 VPVCITFAPPPRRYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVE 145          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Xenopus
Match: rab3gap2 (RAB3 GTPase activating non-catalytic protein subunit 2 [Source:Xenbase;Acc:XB-GENE-987874])

HSP 1 Score: 114.775 bits (286), Expect = 4.094e-31
Identity = 56/69 (81.16%), Postives = 62/69 (89.86%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRS 297
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRS
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRS 73          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Match: Capzb (capping protein (actin filament) muscle Z-line, beta [Source:MGI Symbol;Acc:MGI:104652])

HSP 1 Score: 366.696 bits (940), Expect = 5.740e-127
Identity = 176/271 (64.94%), Postives = 218/271 (80.44%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 271          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Match: Capzb (capping protein (actin filament) muscle Z-line, beta [Source:MGI Symbol;Acc:MGI:104652])

HSP 1 Score: 366.696 bits (940), Expect = 1.855e-126
Identity = 174/267 (65.17%), Postives = 215/267 (80.52%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:   34 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 300          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Match: Capzb (capping protein (actin filament) muscle Z-line, beta [Source:MGI Symbol;Acc:MGI:104652])

HSP 1 Score: 362.459 bits (929), Expect = 3.972e-125
Identity = 170/245 (69.39%), Postives = 206/245 (84.08%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRS 810
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS 245          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Match: Capzb (capping protein (actin filament) muscle Z-line, beta [Source:MGI Symbol;Acc:MGI:104652])

HSP 1 Score: 353.984 bits (907), Expect = 4.431e-122
Identity = 167/259 (64.48%), Postives = 208/259 (80.31%), Query Frame = 1
Query:  115 MRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            MRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 259          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Match: Capzb (capping protein (actin filament) muscle Z-line, beta [Source:MGI Symbol;Acc:MGI:104652])

HSP 1 Score: 309.301 bits (791), Expect = 1.929e-105
Identity = 144/204 (70.59%), Postives = 172/204 (84.31%), Query Frame = 1
Query:  115 MRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRL 723
            MRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRL
Sbjct:    1 MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRL 204          
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Match: sp|P48603|CAPZB_DROME (F-actin-capping protein subunit beta OS=Drosophila melanogaster OX=7227 GN=cpb PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 3.286e-127
Identity = 174/266 (65.41%), Postives = 213/266 (80.08%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKN 885
            Q+D ALDLMRRLPPQ+I+K+L DLI+L PDLCEDLLSSVDQPL+IAKD + GKDYLL DYNRDGDSYRSPWSNSY PPLEDG +PS+R+R LE+EAN AF+ YREMYY+GGVSSVYLWDLD GFA  +LIKKAGD  K   GCWDSIHV+EV+EK  GR A YKLTST MLWL T    +G+ NLGGSLTR  E++ +++E++ HI NIG++VE+MEN IR  LN++YFG +K++++ LRS  S   + QQ  + QD+  AI  +N
Sbjct:    5 QMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYLLCDYNRDGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVYLWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTNKQGSGTMNLGGSLTRQQEQDANVSESSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIVNGLRSTQSLADQRQQAAMKQDLAAAILRRN 270          
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Match: sp|Q5XI32|CAPZB_RAT (F-actin-capping protein subunit beta OS=Rattus norvegicus OX=10116 GN=Capzb PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 4.015e-126
Identity = 176/271 (64.94%), Postives = 218/271 (80.44%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 271          
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Match: sp|Q5R507|CAPZB_PONAB (F-actin-capping protein subunit beta OS=Pongo abelii OX=9601 GN=CAPZB PE=2 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 4.015e-126
Identity = 176/271 (64.94%), Postives = 218/271 (80.44%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 271          
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Match: sp|P79136|CAPZB_BOVIN (F-actin-capping protein subunit beta OS=Bos taurus OX=9913 GN=CAPZB PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.545e-125
Identity = 174/267 (65.17%), Postives = 215/267 (80.52%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A++ K Q
Sbjct:   34 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ 300          
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Match: sp|P47756|CAPZB_HUMAN (F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4)

HSP 1 Score: 362.459 bits (929), Expect = 2.491e-124
Identity = 170/245 (69.39%), Postives = 206/245 (84.08%), Query Frame = 1
Query:   82 MADQ-LDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRS 810
            M+DQ LD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN Y+PPLEDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  S +G+ NLGGSLTR  EK+ ++++ + HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS
Sbjct:    1 MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS 245          
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Match: A0A4E0REK6 (F-actin-capping protein subunit beta OS=Fasciola hepatica OX=6192 GN=D915_004225 PE=3 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 4.553e-131
Identity = 178/274 (64.96%), Postives = 227/274 (82.85%), Query Frame = 1
Query:   82 MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEA-----NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M +QL+S +DLMRRLPPQKID++L D+I LVPDLCED+LSS+DQPL+IA+D K+G+DYLL DYNRDGDSYRSPWSN+Y+PP+EDG++PS+ +R  E+E N AF+ YREMYY+GG+SSVYLWD+D GFAG +LIKKAGD K A+GCWDSIHVI+V E+ + + A+YKLTST+MLWL TQ  + G FNLGGSLTR  E++  L EA      +HIVNIGR+VED ENSIR  LN+VYFGT+KN++DSLRS +  + E+++R+L Q+V  AIQ+K Q
Sbjct:    1 MNNQLNSVMDLMRRLPPQKIDRTLLDVINLVPDLCEDILSSIDQPLKIARDAKAGRDYLLCDYNRDGDSYRSPWSNTYDPPIEDGAMPSESLRRREIEINAAFDQYREMYYEGGISSVYLWDMDLGFAGVILIKKAGDAKLASGCWDSIHVIDVMERSSAKIAQYKLTSTVMLWLQTQRDQAGYFNLGGSLTRFLERDGPLGEAGVPITTSHIVNIGRMVEDAENSIRSTLNEVYFGTTKNIVDSLRSLVPASEEEKRRRLVQEVHSAIQHKAQ 274          
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Match: A0A504Z3F4 (F-actin-capping protein subunit beta OS=Fasciola gigantica OX=46835 GN=FGIG_03122 PE=3 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 1.217e-130
Identity = 178/274 (64.96%), Postives = 226/274 (82.48%), Query Frame = 1
Query:   82 MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEA-----NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            M +QL+S +DLMRRLPPQKID++L D+I LVPDLCED+LSS+DQPL+IA+D K+G+DYLL DYNRDGDSYRSPWSN+Y+PP+EDG++PS+ +R  E+E N AF+ YREMYY+GG+SSVYLWD+D GFAG +LIKKAGD K A+GCWDSIHVI+V E+ + + A+YKLTST+MLWL TQ  + G FNLGGSLTR  E +  L EA      +HIVNIGR+VED ENSIR  LN+VYFGT+KN++DSLRS +  + E+++R+L Q+V  AIQ+K Q
Sbjct:    1 MNNQLNSVMDLMRRLPPQKIDRTLLDVINLVPDLCEDILSSIDQPLKIARDAKAGRDYLLCDYNRDGDSYRSPWSNTYDPPIEDGAMPSESLRKREIEINAAFDQYREMYYEGGISSVYLWDMDLGFAGVILIKKAGDAKLASGCWDSIHVIDVMERSSAKIAQYKLTSTVMLWLQTQRDQAGYFNLGGSLTRFLECDRPLGEAGVPITTSHIVNIGRMVEDAENSIRSTLNEVYFGTTKNIVDSLRSLVPASEEEKRRRLVQEVHSAIQHKAQ 274          
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Match: G7YWN0 (F-actin-capping protein subunit beta OS=Clonorchis sinensis OX=79923 GN=CLF_112609 PE=3 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.829e-129
Identity = 174/273 (63.74%), Postives = 224/273 (82.05%), Query Frame = 1
Query:   88 DQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEA-----NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQG 891
            +QL+S +DLMRRLPPQKID++L D+I L PDLCED+LSS+DQPL+IA+D K+G+DYLL DYNRDGDSYRSPWSN+Y+PPLEDG++PS+ +R  E+E N AF+ YREMYY+GG+SSVYLWD++ GFAG +LIKKAGD K A+GCWDSIHVI+V E+ + + A+YKLTST+MLWL TQ    G FNLGGSLTR  E++  L +A      +HIVNIGR+VED ENSIR  LN+VYFGT+KN++DSL S +  + E+++R+L Q+V  A+QNK+Q 
Sbjct:   17 NQLNSVMDLMRRLPPQKIDRTLLDIISLAPDLCEDILSSIDQPLKIARDNKAGRDYLLCDYNRDGDSYRSPWSNTYDPPLEDGAMPSENLRKREIEINAAFDQYREMYYEGGISSVYLWDMEQGFAGVILIKKAGDAKLASGCWDSIHVIDVIERSSAKVAQYKLTSTVMLWLQTQRESAGYFNLGGSLTRFMERDGPLGDAGQSITTSHIVNIGRMVEDAENSIRSTLNEVYFGTTKNIVDSLHSIVPASEEEKRRRLVQEVHTALQNKSQA 289          
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Match: A0A1S8WKL4 (F-actin-capping protein subunit beta (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09227 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 3.041e-129
Identity = 174/272 (63.97%), Postives = 224/272 (82.35%), Query Frame = 1
Query:   88 DQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEA-----NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            +QL+S +DLMRRLPPQKID++L D+I L PDLCED+LSS+DQPL+IA+D K+G+DYLL DYNRDGDSYRSPWSN+Y+PPLEDG++PS+ +R  E+E N AF+ YREMYY+GG+SSVYLWD++ GFAG +LIKKAGD K A+GCWDSIHVI+V E+ + + A+YKLTST+MLWL TQ    G FNLGGSLTR  E++  L +A      +HIVNIGR+VED ENSIR  LN+VYFGT+KN++DSL S +  + E+++R+L Q+V  A+QNK+Q
Sbjct:   11 NQLNSVMDLMRRLPPQKIDRTLLDIISLAPDLCEDILSSIDQPLKIARDNKAGRDYLLCDYNRDGDSYRSPWSNTYDPPLEDGAMPSENLRKREIEINAAFDQYREMYYEGGISSVYLWDMEQGFAGVILIKKAGDAKLASGCWDSIHVIDVIERSSAKVAQYKLTSTVMLWLQTQRESAGYFNLGGSLTRFMERDGPLGDAGQSITTSHIVNIGRMVEDAENSIRSTLNEVYFGTTKNIVDSLHSIVPASEEEKRRRLVQEVHTALQNKSQ 282          
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Match: A0A4S2KYF7 (F-actin-capping protein subunit beta OS=Opisthorchis felineus OX=147828 GN=CRM22_010487 PE=3 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 3.252e-129
Identity = 174/273 (63.74%), Postives = 224/273 (82.05%), Query Frame = 1
Query:   88 DQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEA-----NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQG 891
            +QL+S +DLMRRLPPQKID++L D+I L PDLCED+LSS+DQPL+IA+D K+G+DYLL DYNRDGDSYRSPWSN+Y+PPLEDG++PS+ +R  E+E N AF+ YREMYY+GG+SSVYLWD++ GFAG +LIKKAGD K A+GCWDSIHVI+V E+ + + A+YKLTST+MLWL TQ    G FNLGGSLTR  E++  L +A      +HIVNIGR+VED ENSIR  LN+VYFGT+KN++DSL S +  + E+++R+L Q+V  A+QNK+Q 
Sbjct:    6 NQLNSVMDLMRRLPPQKIDRTLLDIISLAPDLCEDILSSIDQPLKIARDNKAGRDYLLCDYNRDGDSYRSPWSNTYDPPLEDGAMPSEGLRKREIEINAAFDQYREMYYEGGISSVYLWDMEQGFAGVILIKKAGDAKLASGCWDSIHVIDVIERSSAKVAQYKLTSTVMLWLQTQRESAGYFNLGGSLTRFMERDGPLGDAGQSITTSHIVNIGRMVEDAENSIRSTLNEVYFGTTKNIVDSLHSIVPASEEEKRRRLVQEVHTALQNKSQA 278          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Cavefish
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:NCBI gene;Acc:103044673])

HSP 1 Score: 364.385 bits (934), Expect = 4.525e-126
Identity = 172/267 (64.42%), Postives = 215/267 (80.52%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP++DG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ +++E++ HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  +   + +Q  L  D+  A+  + Q
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTLADKSKQDALRNDLVGALNKRKQ 271          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Cavefish
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:NCBI gene;Acc:103044673])

HSP 1 Score: 361.688 bits (927), Expect = 4.902e-125
Identity = 167/241 (69.29%), Postives = 204/241 (84.65%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRS 810
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP++DG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ +++E++ HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS 245          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Yeast
Match: CAP2 (Beta subunit of the capping protein heterodimer (Cap1p and Cap2p); capping protein (CP) binds to the barbed ends of actin filaments preventing further polymerization; localized predominantly to cortical actin patches; protein increases in abundance and relocalizes from bud neck to plasma membrane upon DNA replication stress [Source:SGD;Acc:S000001296])

HSP 1 Score: 211.846 bits (538), Expect = 4.724e-67
Identity = 117/260 (45.00%), Postives = 168/260 (64.62%), Query Frame = 1
Query:   82 MAD-QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTK-SGKDYLLGDYNRDGDSYRSPWSNSYEPPL-----EDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLD------SGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNA-RYKLTSTIMLWLD-TQNSETGSFNLGGSLTRMTEKEVSLTEA-------NNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLI 795
            M+D Q D+ALDL+RRL P  + ++L +LIEL P+L +DLLSSVD PL   KD+  S ++YL  DYNRD DS+RSPWSN+Y P L     +D   PS  +R LE+ AN +F+VYR++YY+GG+SSVYLWDL+        FAG VL KK    +S    WDSIHV EV    +  ++  Y++T+TI+L LD T+  +     L G+LTR TEK++++  +        +H+ N+G L+ED+E+ +R  L  VYF  ++++ 
Sbjct:    1 MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREYLCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAPLRKLEILANDSFDVYRDLYYEGGISSVYLWDLNEEDFNGHDFAGVVLFKKN---QSDHSNWDSIHVFEVTTSPSSPDSFNYRVTTTIILHLDKTKTDQNSHMMLSGNLTRQTEKDIAIDMSRPLDVIFTSHVANLGSLIEDIESQMRNLLETVYFEKTRDIF 257          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Nematostella
Match: EDO44936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU18])

HSP 1 Score: 360.918 bits (925), Expect = 3.462e-125
Identity = 166/267 (62.17%), Postives = 218/267 (81.65%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQ 888
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D ++GKDYLL DYNRDGDSYRSPWSN+Y+PPL+DG++PSDR+R LE++AN AF+ YREMY++GGVSSVYLWDLD GFAG +LIKKAGD  +   GCWDSIHV+EV+EK +GR A YKLTST MLWL T    +G  NLGGSLTR  E +  +++A+ HI NIG++VEDMEN +R  LN++YFG ++++++SLRS  S   ++ Q+++  ++   ++N+ +
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKQTGKDYLLCDYNRDGDSYRSPWSNTYDPPLDDGAVPSDRLRKLEIDANSAFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSRKIKGCWDSIHVVEVQEKSSGRQAHYKLTSTAMLWLQTNKVGSGIMNLGGSLTRQVEVDSPVSDASPHIANIGKMVEDMENKMRNTLNEIYFGKTRDIVNSLRSVNSLASQNDQKRMQAELFQTLKNRQK 271          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Nematostella
Match: EDO30346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T120])

HSP 1 Score: 224.172 bits (570), Expect = 1.987e-73
Identity = 102/132 (77.27%), Postives = 122/132 (92.42%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKK 486
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D ++GKDYLL DYNRDGDSYRSPWSN+Y+PPL+DG++PSDR+R LE++AN AF+ YREMY++GGVSSVYLWDLD GFAG +LIKK
Sbjct:    4 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKQTGKDYLLCDYNRDGDSYRSPWSNTYDPPLDDGAVPSDRLRKLEIDANSAFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKK 135          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Medaka
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:NCBI gene;Acc:101167528])

HSP 1 Score: 366.311 bits (939), Expect = 6.769e-127
Identity = 173/265 (65.28%), Postives = 216/265 (81.51%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNK 882
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP+EDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ ++ E+++HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS  ++  + Q+  L  D+  A++ K
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVGESSSHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTQADKQQKDALRNDLVEALRRK 269          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Medaka
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:NCBI gene;Acc:101167528])

HSP 1 Score: 363.229 bits (931), Expect = 1.300e-125
Identity = 168/241 (69.71%), Postives = 204/241 (84.65%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRS 810
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP+EDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ ++ E+++HI NIGRLVEDMEN IR  LN++YFG +K++++ LRS
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVGESSSHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS 245          
BLAST of F-actin-capping protein subunit beta vs. Ensembl Medaka
Match: capzb (capping actin protein of muscle Z-line subunit beta [Source:NCBI gene;Acc:101167528])

HSP 1 Score: 332.028 bits (850), Expect = 1.760e-113
Identity = 155/222 (69.82%), Postives = 187/222 (84.23%), Query Frame = 1
Query:   91 QLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGD-IKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRK 753
            QLD ALDLMRRLPPQ+I+K+L DLI+LVP LCEDLLSSVDQPL+IA+D   GKDYLL DYNRDGDSYRSPWSN YEPP+EDG++PS R+R LEVEAN AF+ YR++Y++GGVSSVYLWDLD GFAG +LIKKAGD  K   GCWDSIHV+EV+EK +GR A YKLTST+MLWL T  + +G+ NLGGSLTR  EK+ ++ E+++HI NIGRLVE+  +S R+
Sbjct:    5 QLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVGESSSHIANIGRLVEERSDSGRQ 226          
BLAST of F-actin-capping protein subunit beta vs. Planmine SMEST
Match: SMESG000008209.1 (SMESG000008209.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 273/273 (100.00%), Postives = 273/273 (100.00%), Query Frame = 1
Query:   82 MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQGNAS 900
            MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQGNAS
Sbjct:    1 MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAKDTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEANKAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIHVIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVSLTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVEDQQRKLCQDVKIAIQNKNQGNAS 273          
The following BLAST results are available for this feature:
BLAST of F-actin-capping protein subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPZB8.361e-12764.94capping actin protein of muscle Z-line subunit bet... [more]
CAPZB2.345e-12665.17capping actin protein of muscle Z-line subunit bet... [more]
CAPZB5.187e-12569.39capping actin protein of muscle Z-line subunit bet... [more]
CAPZB6.454e-12264.48capping actin protein of muscle Z-line subunit bet... [more]
CAPZB2.192e-11268.72capping actin protein of muscle Z-line subunit bet... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cap-23.960e-11258.27F-actin-capping protein subunit beta [Source:UniP... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cpb3.278e-12865.41gene:FBgn0011570 transcript:FBtr0331630[more]
cpb3.278e-12865.41gene:FBgn0011570 transcript:FBtr0077881[more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
capzb1.442e-12564.04capping actin protein of muscle Z-line subunit bet... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rab3gap22.127e-5962.35RAB3 GTPase activating non-catalytic protein subun... [more]
rab3gap21.225e-4460.33RAB3 GTPase activating non-catalytic protein subun... [more]
rab3gap24.094e-3181.16RAB3 GTPase activating non-catalytic protein subun... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capzb5.740e-12764.94capping protein (actin filament) muscle Z-line, be... [more]
Capzb1.855e-12665.17capping protein (actin filament) muscle Z-line, be... [more]
Capzb3.972e-12569.39capping protein (actin filament) muscle Z-line, be... [more]
Capzb4.431e-12264.48capping protein (actin filament) muscle Z-line, be... [more]
Capzb1.929e-10570.59capping protein (actin filament) muscle Z-line, be... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48603|CAPZB_DROME3.286e-12765.41F-actin-capping protein subunit beta OS=Drosophila... [more]
sp|Q5XI32|CAPZB_RAT4.015e-12664.94F-actin-capping protein subunit beta OS=Rattus nor... [more]
sp|Q5R507|CAPZB_PONAB4.015e-12664.94F-actin-capping protein subunit beta OS=Pongo abel... [more]
sp|P79136|CAPZB_BOVIN1.545e-12565.17F-actin-capping protein subunit beta OS=Bos taurus... [more]
sp|P47756|CAPZB_HUMAN2.491e-12469.39F-actin-capping protein subunit beta OS=Homo sapie... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0REK64.553e-13164.96F-actin-capping protein subunit beta OS=Fasciola h... [more]
A0A504Z3F41.217e-13064.96F-actin-capping protein subunit beta OS=Fasciola g... [more]
G7YWN01.829e-12963.74F-actin-capping protein subunit beta OS=Clonorchis... [more]
A0A1S8WKL43.041e-12963.97F-actin-capping protein subunit beta (Fragment) OS... [more]
A0A4S2KYF73.252e-12963.74F-actin-capping protein subunit beta OS=Opisthorch... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
capzb4.525e-12664.42capping actin protein of muscle Z-line subunit bet... [more]
capzb4.902e-12569.29capping actin protein of muscle Z-line subunit bet... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CAP24.724e-6745.00Beta subunit of the capping protein heterodimer (C... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO449363.462e-12562.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303461.987e-7377.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
capzb6.769e-12765.28capping actin protein of muscle Z-line subunit bet... [more]
capzb1.300e-12569.71capping actin protein of muscle Z-line subunit bet... [more]
capzb1.760e-11369.82capping actin protein of muscle Z-line subunit bet... [more]
back to top
BLAST of F-actin-capping protein subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008209.10.000e+0100.00SMESG000008209.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010541 ID=SMED30010541|Name=F-actin-capping protein subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=1111bp
CTTTGTTGTAACTAATTATTATTTGTTCATTTATATCAAATTTGTTTATT
ACGTAGTTTTTTAATTAAAATATAAAGGAAAATGGCTGATCAACTTGACT
CGGCTCTTGATTTAATGAGGAGATTACCTCCACAAAAAATTGACAAAAGT
TTACAAGATCTTATTGAATTAGTTCCGGATTTATGCGAAGATCTTCTCTC
ATCTGTAGATCAACCTTTAAGAATAGCCAAAGACACAAAGAGTGGAAAAG
ATTATTTGCTTGGTGATTATAACCGTGATGGAGATTCATACAGATCTCCT
TGGTCAAATTCATATGAGCCTCCACTCGAAGATGGATCATTGCCCAGTGA
TAGAGTTCGTGCTTTAGAAGTTGAAGCTAATAAAGCTTTTGAAGTTTACC
GTGAAATGTATTACGACGGAGGGGTTTCATCCGTTTATTTGTGGGATCTT
GATAGTGGTTTTGCTGGTGCTGTGCTTATAAAAAAAGCTGGAGATATTAA
ATCAGCAACAGGATGTTGGGATTCAATTCATGTCATTGAAGTCGAAGAGA
AAGGTAATGGTAGAAATGCTCGTTACAAGTTGACAAGTACTATAATGCTA
TGGTTGGATACTCAAAATTCTGAAACTGGATCCTTTAATTTGGGTGGTAG
TTTGACTAGAATGACTGAGAAAGAGGTATCATTAACAGAAGCTAACAATC
ACATTGTTAATATTGGCCGTTTAGTTGAAGATATGGAAAATTCCATCAGG
AAACAATTAAATGATGTTTATTTTGGCACATCTAAAAATTTGATAGATTC
CCTCAGATCTGGTCTATCAAAGAACGTAGAAGATCAGCAACGTAAGCTTT
GCCAGGATGTCAAAATTGCTATTCAAAACAAGAATCAAGGAAATGCCAGT
TAAATACAAAATGACTTTATCTTATCTATTATTTGATTGACCACCACAAA
TAGATTTCATATAATGTTCCGGTATTTGTTGGCAGCTTCTATATAATTTT
GTTTCCAATTTCAATGCTGTGTATCGTCTATACTGAAATGTGATTAATTG
CGGCTGAGACTTTATTTTATTCTATTTTATAATCGATAAGAAATAGGTGT
TTTCTAAAAAA
back to top

protein sequence of SMED30010541-orf-1

>SMED30010541-orf-1 ID=SMED30010541-orf-1|Name=SMED30010541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=274bp
MADQLDSALDLMRRLPPQKIDKSLQDLIELVPDLCEDLLSSVDQPLRIAK
DTKSGKDYLLGDYNRDGDSYRSPWSNSYEPPLEDGSLPSDRVRALEVEAN
KAFEVYREMYYDGGVSSVYLWDLDSGFAGAVLIKKAGDIKSATGCWDSIH
VIEVEEKGNGRNARYKLTSTIMLWLDTQNSETGSFNLGGSLTRMTEKEVS
LTEANNHIVNIGRLVEDMENSIRKQLNDVYFGTSKNLIDSLRSGLSKNVE
DQQRKLCQDVKIAIQNKNQGNAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042276CapZ_alpha/beta_2
IPR043175CAPZB_N
IPR037282CapZ_alpha/beta
IPR001698CAPZB
Vocabulary: cellular component
TermDefinition
GO:0008290F-actin capping protein complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005884actin filament
GO:0030017sarcomere
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0071203WASH complex
Vocabulary: biological process
TermDefinition
GO:0051016barbed-end actin filament capping
GO:0000902cell morphogenesis
GO:0007010cytoskeleton organization
GO:0008150biological_process
GO:0010591regulation of lamellipodium assembly
GO:0022604regulation of cell morphogenesis
GO:0030036actin cytoskeleton organization
GO:0051490negative regulation of filopodium assembly
GO:0051693actin filament capping
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0003779actin binding
GO:0005515protein binding
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001698F-actin-capping protein subunit betaPRINTSPR00192FACTINCAPBcoord: 210..236
score: 59.72
coord: 25..46
score: 79.55
coord: 96..123
score: 73.21
coord: 4..24
score: 74.4
coord: 56..82
score: 85.65
IPR001698F-actin-capping protein subunit betaPFAMPF01115F_actin_cap_Bcoord: 5..237
e-value: 3.7E-101
score: 337.7
IPR001698F-actin-capping protein subunit betaPANTHERPTHR10619F-ACTIN-CAPPING PROTEIN SUBUNIT BETAcoord: 3..269
IPR042276F-actin-capping protein subunit alpha/beta, domain 2GENE3DG3DSA:2.40.160.80coord: 89..242
e-value: 1.6E-63
score: 215.4
IPR043175F-actin-capping protein subunit beta, N-terminal domainGENE3DG3DSA:1.20.58.570coord: 1..88
e-value: 1.7E-40
score: 138.9
NoneNo IPR availablePANTHERPTHR10619:SF1coord: 3..269
IPR037282F-actin-capping protein subunit alpha/betaSUPERFAMILYSSF90096Subunits of heterodimeric actin filament capping protein Capzcoord: 2..249