Phospholipid scramblase

Overview
NamePhospholipid scramblase
Smed IDSMED30010538
Length (bp)1083
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid scramblase (SMED30010538) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30010538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid scramblase (SMED30010538) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30010538) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010538h1SMcG0020412 SmedASXL_005217SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010538h1SMcG0020412 SmedASXL_005216SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30010538h1SMcG0020412 dd_Smed_v4_4899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010538h1SMcG0020412 dd_Smed_v4_4899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010538h1SMcG0020412 dd_Smed_v6_4899_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 245.743 bits (626), Expect = 7.273e-79
Identity = 124/232 (53.45%), Postives = 154/232 (66.38%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  P   + CPPGLEYL+ +DQIL+HQQIELLEV T +ET NKY+IKNS GQ+VY+AAE++D C R CCGP R F + I DNMG EVI   R  +C +  C  C        QE+ ++APPG  IG VIQ      P + IQN   E +L+I GP  +C    C  D +F++ S D    +G+ISK W+G + E FTDADNFG+ FP+DLDVKMKA M+ A FLIDFMFFE
Sbjct:   78 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCL-------QEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCS---CCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 299          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 245.743 bits (626), Expect = 9.530e-79
Identity = 124/232 (53.45%), Postives = 154/232 (66.38%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  P   + CPPGLEYL+ +DQIL+HQQIELLEV T +ET NKY+IKNS GQ+VY+AAE++D C R CCGP R F + I DNMG EVI   R  +C +  C  C        QE+ ++APPG  IG VIQ      P + IQN   E +L+I GP  +C    C  D +F++ S D    +G+ISK W+G + E FTDADNFG+ FP+DLDVKMKA M+ A FLIDFMFFE
Sbjct:   85 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCL-------QEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCS---CCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 306          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 221.09 bits (562), Expect = 3.323e-70
Identity = 113/214 (52.80%), Postives = 142/214 (66.36%), Query Frame = 1
Query:  238 TMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            + +DQIL+HQQIELLEV T +ET NKY+IKNS GQ+VY+AAE++D C R CCGP R F + I DNMG EVI   R  +C +  C  C        QE+ ++APPG  IG VIQ      P + IQN   E +L+I GP  +C    C  D +F++ S D    +G+ISK W+G + E FTDADNFG+ FP+DLDVKMKA M+ A FLIDFMFFE
Sbjct:   22 SKIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCC-------LQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCS---CCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 225          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR2 (phospholipid scramblase 2 [Source:HGNC Symbol;Acc:HGNC:16494])

HSP 1 Score: 206.068 bits (523), Expect = 1.337e-64
Identity = 107/219 (48.86%), Postives = 139/219 (63.47%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            GLEYL+ +D IL+HQQIELLEV  ++E+ N Y+IKNS GQ++Y+AAE+++ C R CCG  R F + ITDN+G EVI           P    C     C QE+ ++APPG  +G V Q        + I+N   E +L+I GP  +C    C    +F++ S D    +GRISK WSGF+ E FTDADNFG+ FP DLDVKMKA M+ A FLID+MFFE
Sbjct:   13 GLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVI-------TLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCS---CIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFE 221          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR2 (phospholipid scramblase 2 [Source:HGNC Symbol;Acc:HGNC:16494])

HSP 1 Score: 206.068 bits (523), Expect = 1.337e-64
Identity = 107/219 (48.86%), Postives = 139/219 (63.47%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            GLEYL+ +D IL+HQQIELLEV  ++E+ N Y+IKNS GQ++Y+AAE+++ C R CCG  R F + ITDN+G EVI           P    C     C QE+ ++APPG  +G V Q        + I+N   E +L+I GP  +C    C    +F++ S D    +GRISK WSGF+ E FTDADNFG+ FP DLDVKMKA M+ A FLID+MFFE
Sbjct:   13 GLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVI-------TLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCS---CIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFE 221          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 224.942 bits (572), Expect = 1.581e-71
Identity = 120/233 (51.50%), Postives = 151/233 (64.81%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM  PP + G P GLEYLT +D I+VHQ  EL+E+ T+WETKNKY +KN+ G+Q YYA EES  C RQCCGPQRGFVMHI DN   EV+   REFKCC G CC C A I  C QE  +E P    +G + Q+  C+  +Y I + D   + QI GP C     C   D+EF + +++  T +G I+K+W G   E FTDAD F V+FP DLDVK+K  ++ A FLIDFM FE
Sbjct:   49 VWMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCML--CGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFE 279          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 224.942 bits (572), Expect = 1.803e-71
Identity = 120/233 (51.50%), Postives = 151/233 (64.81%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM  PP + G P GLEYLT +D I+VHQ  EL+E+ T+WETKNKY +KN+ G+Q YYA EES  C RQCCGPQRGFVMHI DN   EV+   REFKCC G CC C A I  C QE  +E P    +G + Q+  C+  +Y I + D   + QI GP C     C   D+EF + +++  T +G I+K+W G   E FTDAD F V+FP DLDVK+K  ++ A FLIDFM FE
Sbjct:   49 VWMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCML--CGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFE 279          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 224.942 bits (572), Expect = 1.803e-71
Identity = 120/233 (51.50%), Postives = 151/233 (64.81%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM  PP + G P GLEYLT +D I+VHQ  EL+E+ T+WETKNKY +KN+ G+Q YYA EES  C RQCCGPQRGFVMHI DN   EV+   REFKCC G CC C A I  C QE  +E P    +G + Q+  C+  +Y I + D   + QI GP C     C   D+EF + +++  T +G I+K+W G   E FTDAD F V+FP DLDVK+K  ++ A FLIDFM FE
Sbjct:   49 VWMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCML--CGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFE 279          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 224.942 bits (572), Expect = 1.803e-71
Identity = 120/233 (51.50%), Postives = 151/233 (64.81%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM  PP + G P GLEYLT +D I+VHQ  EL+E+ T+WETKNKY +KN+ G+Q YYA EES  C RQCCGPQRGFVMHI DN   EV+   REFKCC G CC C A I  C QE  +E P    +G + Q+  C+  +Y I + D   + QI GP C     C   D+EF + +++  T +G I+K+W G   E FTDAD F V+FP DLDVK+K  ++ A FLIDFM FE
Sbjct:   49 VWMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCML--CGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFE 279          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-2 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:G5EEQ3])

HSP 1 Score: 204.527 bits (519), Expect = 6.493e-64
Identity = 109/234 (46.58%), Postives = 143/234 (61.11%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXI-DMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            IWM+  P + G P GLEYL  +D ++VHQ  E+LE+ T WE+KNKY I+N  GQQ YYA EES+   RQCCG QRGF MHI DN    V+   RE +CCA   C C  G+ ++C    T+E+     +G V+Q   C    Y I + D   +  + G  C     CC  D++F + + D S  +G I+K+W G + E FTDAD F V+FPIDLDVK+KA +L A FLIDF+ FE
Sbjct:   35 IWMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVLEILTGWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSFCGCLLGLQNIC----TIESLSTGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTS--CCCEDKDFTIKTPDSSVPIGSITKKWGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFE 262          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 216.083 bits (549), Expect = 1.049e-68
Identity = 112/231 (48.48%), Postives = 141/231 (61.04%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            M  P  +  CP GLEYLT +DQ+LV Q++ELLE FT +ET NK+ IKN+LGQ+VY+AAE++D C R CCGP R F M + DN   EVI   R                  C Q + V APPG  IG + Q+ S   PS+ I N   +T+++I GP C         D EF V S     ++G+ISKQWSG   E FTDAD FG++FP+DLDV+MKA +L A FLID MFFE
Sbjct:    1 MSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLA-------CSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFS---LCGDVEFNVVSL-TGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 220          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 216.853 bits (551), Expect = 1.334e-68
Identity = 113/232 (48.71%), Postives = 148/232 (63.79%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  P  +  CP GLEYLT +DQ+LV Q+IE LE+ T +ETKN++++KNSLGQ VY+A EESD C R   G  R F M I DN   EV+   R FK      C        C   + V APPGQ IG V Q  + + P + I+N   +T+LQI GP+C C+   C  D  FKV S++ + E+G+ISKQWSG   E FTDAD F V+FP++LDV+MKA + AA+FLID +++E
Sbjct:   41 WMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFK------CDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCK---CFSDTNFKVLSAN-NEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 219.55 bits (558), Expect = 1.073e-67
Identity = 113/232 (48.71%), Postives = 142/232 (61.21%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  P  +  CP GLEYLT +DQ+LV Q++ELLE FT +ET NK+ IKN+LGQ+VY+AAE++D C R CCGP R F M + DN   EVI   R                  C Q + V APPG  IG + Q+ S   PS+ I N   +T+++I GP C         D EF V S     ++G+ISKQWSG   E FTDAD FG++FP+DLDV+MKA +L A FLID MFFE
Sbjct:  183 WMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLA-------CSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFS---LCGDVEFNVVSL-TGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 215.698 bits (548), Expect = 3.128e-67
Identity = 111/228 (48.68%), Postives = 140/228 (61.40%), Query Frame = 1
Query:  196 PPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            P  +  CP GLEYLT +DQ+LV Q++ELLE FT +ET NK+ IKN+LGQ+VY+AAE++D C R CCGP R F M + DN   EVI   R                  C Q + V APPG  IG + Q+ S   PS+ I N   +T+++I GP C         D EF V S     ++G+ISKQWSG   E FTDAD FG++FP+DLDV+MKA +L A FLID MFFE
Sbjct:  103 PTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPL-------ACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFS---LCGDVEFNVVSL-TGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 319          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: CG9084 (gene:FBgn0033582 transcript:FBtr0088197)

HSP 1 Score: 72.4034 bits (176), Expect = 4.191e-14
Identity = 59/232 (25.43%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMC--AQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEET---MLQIRGPICICQGPCC---TWDQEFKVFSSDMSTELGRISKQWSGFVHE-----YFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            G + L  +  + + Q  EL +  T   ++N+Y +++ LG  ++ A E S    R   G  R F MH+ D    E +   ++                MC  A+ L +  PPG  +G+V+Q  + ++P + I+  DE T      + GP+ +  G CC     D  FK+ S         I  +W     +     YF+DA          L  K +A +L + FL++++FF+
Sbjct:   67 GYDCLADLPSVHIEQTFELNDALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLAMG-----------SMCCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIE--DESTGQLTFCVEGPVGL--GFCCFSLPKDCYFKIHSG--GNMRASIDHKWLASKSQYTTNIYFSDA---------KLTAKERALILGSAFLLEYLFFQ 272          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 256.914 bits (655), Expect = 4.261e-84
Identity = 128/235 (54.47%), Postives = 159/235 (67.66%), Query Frame = 1
Query:  175 QQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            Q + M  P +  GCPPGLEYLT +DQ+LV Q++EL EV   WET NKY +KNS+GQQV+Y AEE+D C RQ CGP R FV+H+ DN+G EV+R MR  K               C QEL +++PPG  IG VIQ      P + IQN  +E +L+I GP C C+  CC+ D  F V S D ST++G+ISKQW+G V E FTDADNFG+SFP+DLDVK+KA +  A FLIDFMFFE
Sbjct:   36 QVVMMPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLK-------CGSCFCPCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCR--CCS-DVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFE 260          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 255.373 bits (651), Expect = 5.515e-84
Identity = 127/231 (54.98%), Postives = 157/231 (67.97%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            M  P +  GCPPGLEYLT +DQ+LV Q++EL EV   WET NKY +KNS+GQQV+Y AEE+D C RQ CGP R FV+H+ DN+G EV+R MR  K               C QEL +++PPG  IG VIQ      P + IQN  +E +L+I GP C C+  CC+ D  F V S D ST++G+ISKQW+G V E FTDADNFG+SFP+DLDVK+KA +  A FLIDFMFFE
Sbjct:    2 MPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLK-------CGSCFCPCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCR--CCS-DVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFE 222          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 255.373 bits (651), Expect = 5.515e-84
Identity = 127/231 (54.98%), Postives = 157/231 (67.97%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            M  P +  GCPPGLEYLT +DQ+LV Q++EL EV   WET NKY +KNS+GQQV+Y AEE+D C RQ CGP R FV+H+ DN+G EV+R MR  K               C QEL +++PPG  IG VIQ      P + IQN  +E +L+I GP C C+  CC+ D  F V S D ST++G+ISKQW+G V E FTDADNFG+SFP+DLDVK+KA +  A FLIDFMFFE
Sbjct:    2 MPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLK-------CGSCFCPCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCR--CCS-DVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFE 222          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 255.373 bits (651), Expect = 5.515e-84
Identity = 127/231 (54.98%), Postives = 157/231 (67.97%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            M  P +  GCPPGLEYLT +DQ+LV Q++EL EV   WET NKY +KNS+GQQV+Y AEE+D C RQ CGP R FV+H+ DN+G EV+R MR  K               C QEL +++PPG  IG VIQ      P + IQN  +E +L+I GP C C+  CC+ D  F V S D ST++G+ISKQW+G V E FTDADNFG+SFP+DLDVK+KA +  A FLIDFMFFE
Sbjct:    2 MPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLK-------CGSCFCPCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCR--CCS-DVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFE 222          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 236.884 bits (603), Expect = 1.787e-76
Identity = 123/231 (53.25%), Postives = 152/231 (65.80%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            + RP   +GCP GLEYLT VDQ+LVHQ++EL+EV   WET N+Y +KNSLGQQV++AAEES  C+R  CG  R F++HI DNMG EV+   R  K               C QEL V +P G  +G V Q      P + I N  +E +L+I GP C C+  CC+ D  F+V S D S+ +GRISKQWSGF  E FTDADNFG+ FP+DLDVK+KA +L A FLIDFMFFE
Sbjct:   23 LDRP---MGCPVGLEYLTQVDQLLVHQKVELMEVLMGWETNNQYVVKNSLGQQVFFAAEESHFCSRMFCGSVRSFLLHIQDNMGQEVMTLSRPLK-------CSSCFFPCCLQELEVHSPSGSPLGYVTQSWHPYLPKFIIHNERKEPVLKILGPFCDCK--CCS-DVNFEVMSLDESSVIGRISKQWSGFEAEAFTDADNFGLQFPMDLDVKIKAVILGACFLIDFMFFE 240          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 248.054 bits (632), Expect = 1.002e-79
Identity = 123/222 (55.41%), Postives = 153/222 (68.92%), Query Frame = 1
Query:  214 CPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            CPPGLEYLT +DQILVHQQ+ELLEV T +ET NKY+IKNSLGQ+VY+AAEE+D C R CCGP R F M I DN G EV++  R  +               C Q+L V+APPG  +G VIQ      P + IQ+  E+ +L+I+GP   C+   C  D +F++ S D S  +GRI+KQW+GFV E FTDADNFG+ FP+DLDVK+KA +L A FLIDFMFFE
Sbjct:  102 CPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCR-------CSACCFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCR---CCADVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFE 313          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 248.054 bits (632), Expect = 1.119e-79
Identity = 123/222 (55.41%), Postives = 153/222 (68.92%), Query Frame = 1
Query:  214 CPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            CPPGLEYLT +DQILVHQQ+ELLEV T +ET NKY+IKNSLGQ+VY+AAEE+D C R CCGP R F M I DN G EV++  R  +               C Q+L V+APPG  +G VIQ      P + IQ+  E+ +L+I+GP   C+   C  D +F++ S D S  +GRI+KQW+GFV E FTDADNFG+ FP+DLDVK+KA +L A FLIDFMFFE
Sbjct:  107 CPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCR-------CSACCFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCR---CCADVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFE 318          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 233.802 bits (595), Expect = 1.076e-74
Identity = 120/231 (51.95%), Postives = 149/231 (64.50%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFF 876
            WM  P     CPPGLEYL+ +DQILVHQQ+ELLEV T +ET NKY+IKNSLGQ+VY+AAEE+D C R  CGP R F M I DN G EV++  R  +               C Q+L V+APPG  +G V+Q      P + IQ+  E+ +L+I GP   C+  CCT D  F+V S D S+ +GRISKQW+G V E FTD DNFG+ FP+DLD+K KA +L A FLI   FF
Sbjct:   57 WMPIPAANPNCPPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHRPLR-------CSACCFPCCLQKLEVQAPPGTVVGYVVQNWHPCLPKFTIQDEREQGVLKISGPCIPCR--CCT-DVNFEVMSVDESSVVGRISKQWAGSVKEIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIVSSFF 277          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 142.51 bits (358), Expect = 5.173e-40
Identity = 78/201 (38.81%), Postives = 115/201 (57.21%), Query Frame = 1
Query:  271 IELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMC----AQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLI 861
             ++  VF   E  NKY+IK++ GQ+ Y+A EE++   +  CGP R F M I+++ G EVI  +R  +C           I  C     QEL V+AP G   G ++Q+   L P + IQN  +E +L + GP        C  D  F+V + +  + +G+I K WSGFV++ FT+ADNFG+ FP+DLDVK+KA ++   FLI
Sbjct:   14 FDVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRC-----------IHCCFPCYLQELEVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGPYLTSS---CFGDVIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLI 200          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 141.739 bits (356), Expect = 1.581e-39
Identity = 77/201 (38.31%), Postives = 115/201 (57.21%), Query Frame = 1
Query:  271 IELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMC----AQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLI 861
             ++  VF   E  NKY+IK++ GQ+ Y+A EE++   +  CGP R F M I+++ G EVI  +R  +C           I  C     QE+ V+AP G   G ++Q+   L P + IQN  +E +L + GP        C  D  F+V + +  + +G+I K WSGFV++ FT+ADNFG+ FP+DLDVK+KA ++   FLI
Sbjct:   26 FDVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRC-----------IHCCFPCYLQEVKVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGPYLTSS---CFGDVIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLI 212          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 232.261 bits (591), Expect = 7.181e-74
Identity = 114/232 (49.14%), Postives = 148/232 (63.79%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  PP ++ CPPGLEYL  +DQ+L+HQQ+ELLEV T +ET NK++IKNSLGQ VY A E++D C R CC   R F + I D++G EV+   R  K               C QE+ ++APPG  IG V Q      P   +QN   E +L++ GP   C   CC+ D +F++ S D  T +G+I+KQWSG V E FTD+DNFG+ FP+DL+VKMKA  L A FLID+MFFE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLK-------CSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACT--CCS-DIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 232.261 bits (591), Expect = 7.181e-74
Identity = 114/232 (49.14%), Postives = 148/232 (63.79%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  PP ++ CPPGLEYL  +DQ+L+HQQ+ELLEV T +ET NK++IKNSLGQ VY A E++D C R CC   R F + I D++G EV+   R  K               C QE+ ++APPG  IG V Q      P   +QN   E +L++ GP   C   CC+ D +F++ S D  T +G+I+KQWSG V E FTD+DNFG+ FP+DL+VKMKA  L A FLID+MFFE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLK-------CSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACT--CCS-DIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 229.565 bits (584), Expect = 1.600e-72
Identity = 114/219 (52.05%), Postives = 147/219 (67.12%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            GLEYL  +DQ+LVHQQIELLEV T +ET NKY+IKNSLGQ+VY+A E++D C R CCG  R F + I DN+G EV+   R  +               C QE+ ++APPG  +G V Q      P + +QN  ++ +L++ GP  +C   CC+ D +F++ S D  + +G+ISKQWSGFV E FTDADNFG+ FP+DLDVKMKA ML A FLIDFMFFE
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLR-------CSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCS--CCS-DIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 315          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 229.565 bits (584), Expect = 1.600e-72
Identity = 114/219 (52.05%), Postives = 147/219 (67.12%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            GLEYL  +DQ+LVHQQIELLEV T +ET NKY+IKNSLGQ+VY+A E++D C R CCG  R F + I DN+G EV+   R  +               C QE+ ++APPG  +G V Q      P + +QN  ++ +L++ GP  +C   CC+ D +F++ S D  + +G+ISKQWSGFV E FTDADNFG+ FP+DLDVKMKA ML A FLIDFMFFE
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLR-------CSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCS--CCS-DIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 315          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr3 (phospholipid scramblase 3 [Source:MGI Symbol;Acc:MGI:1917560])

HSP 1 Score: 202.986 bits (515), Expect = 1.544e-62
Identity = 103/223 (46.19%), Postives = 139/223 (62.33%), Query Frame = 1
Query:  211 GCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            G PPGLE+L  +DQIL+HQ+ E +E F  WET N Y++++  GQQ+  AAEES+ CAR CCG +R F + + D    EV+R +R   C    C           QE+ V+APPG  IG V+Q      P ++I +AD + +L++ GP   C    C  D  F+V + D S  +GRISKQW G + E  TDAD+FG+ FP+DLDVK+KA +L A FLID+MFFE
Sbjct:   72 GVPPGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQAAEESNCCARLCCGARRPFRIRLADPGDREVLRLLRPLHCGCSCCPCGL-------QEMEVQAPPGTTIGHVLQTWHPFLPKFSILDADRQPVLRVVGPCWTCG---CGTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDYMFFE 284          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q3ZBG9|PLS2_BOVIN (Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.715e-79
Identity = 123/236 (52.12%), Postives = 150/236 (63.56%), Query Frame = 1
Query:  172 NQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
             Q  WM  P   + CPPGLEYLT +DQ+L+HQQIELLEV   +ET NKY+IKNSLGQ++Y+AAE++D C R CCGP R F M I DNMG EVI   R  +               C QE+ ++APPG  +G V Q      P + IQN   E +L+I GP  IC    C  D +F+V S D    +G+ISK W+G + E FTD DNFG+ FP+DLDVKMKA ML A FLIDFMFFE
Sbjct:   63 TQVPWMPAPLPPLNCPPGLEYLTQIDQLLIHQQIELLEVLIGFETNNKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLR-------CTSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICS---CCADIDFEVKSLDDKYVVGKISKHWTGLIKELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 288          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|O15162|PLS1_HUMAN (Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 4.576e-78
Identity = 124/232 (53.45%), Postives = 154/232 (66.38%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  P   + CPPGLEYL+ +DQIL+HQQIELLEV T +ET NKY+IKNS GQ+VY+AAE++D C R CCGP R F + I DNMG EVI   R  +C +  C  C        QE+ ++APPG  IG VIQ      P + IQN   E +L+I GP  +C    C  D +F++ S D    +G+ISK W+G + E FTDADNFG+ FP+DLDVKMKA M+ A FLIDFMFFE
Sbjct:   85 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCL-------QEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCS---CCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 306          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|P58195|PLS1_RAT (Phospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 4.890e-74
Identity = 126/232 (54.31%), Postives = 157/232 (67.67%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WMQ PP  + CPPGLEYLT +DQILVHQQIELLEV T +ET NKY+IKNSLGQ+VY+A E++D C R CCG  R F + I DNMG EV+   R  +               C QE+ ++APPG  +G VIQ      P + +QN   + +L++ GP  +C   CC+ D +F++ S D  + +G+ISKQWSGFV E FTDADNFG+ FP+DLDVKMKA ML A FLIDFMFFE
Sbjct:  102 WMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLR-------CSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCS--CCS-DIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 323          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9DCW2|PLS2_MOUSE (Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3)

HSP 1 Score: 232.261 bits (591), Expect = 5.023e-73
Identity = 114/232 (49.14%), Postives = 148/232 (63.79%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM  PP ++ CPPGLEYL  +DQ+L+HQQ+ELLEV T +ET NK++IKNSLGQ VY A E++D C R CC   R F + I D++G EV+   R  K               C QE+ ++APPG  IG V Q      P   +QN   E +L++ GP   C   CC+ D +F++ S D  T +G+I+KQWSG V E FTD+DNFG+ FP+DL+VKMKA  L A FLID+MFFE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLK-------CSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACT--CCS-DIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9JJ00|PLS1_MOUSE (Phospholipid scramblase 1 OS=Mus musculus OX=10090 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.119e-71
Identity = 114/219 (52.05%), Postives = 147/219 (67.12%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            GLEYL  +DQ+LVHQQIELLEV T +ET NKY+IKNSLGQ+VY+A E++D C R CCG  R F + I DN+G EV+   R  +               C QE+ ++APPG  +G V Q      P + +QN  ++ +L++ GP  +C   CC+ D +F++ S D  + +G+ISKQWSGFV E FTDADNFG+ FP+DLDVKMKA ML A FLIDFMFFE
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLR-------CSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCS--CCS-DIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 315          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A1I8HNN9 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.860e-129
Identity = 181/233 (77.68%), Postives = 205/233 (87.98%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM RP  + GCPPGLEYLT VDQ+LVHQQIELLEVFTNWETKNKYQ+KNS+GQQVY+AAEESDVCARQCCGPQRGFVMHITDN+G+EVIR  REFKC A P C+C AG D CA EL +EAPPG  +G V Q+ SCLEP Y IQNAD + +L IRGP+CICQGPCCTWDQEFKV+S+DM+ E+G+ISKQWSGF+ EYFTDADNFGVSFP+DLDV+MKATM+ AVFLIDFMFFE
Sbjct:   42 VWMNRPAPIPGCPPGLEYLTQVDQLLVHQQIELLEVFTNWETKNKYQVKNSMGQQVYFAAEESDVCARQCCGPQRGFVMHITDNLGSEVIRVTREFKCLACPGCYCLAGADACAHELQIEAPPGTVVGYVRQECSCLEPRYEIQNADRQVVLLIRGPVCICQGPCCTWDQEFKVYSADMAHEVGKISKQWSGFIREYFTDADNFGVSFPMDLDVRMKATMIGAVFLIDFMFFE 274          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A267FT90 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003533g2 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 1.829e-128
Identity = 181/233 (77.68%), Postives = 205/233 (87.98%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +WM RP  + GCPPGLEYLT VDQ+LVHQQIELLEVFTNWETKNKYQ+KNS+GQQVY+AAEESDVCARQCCGPQRGFVMHITDN+G+EVIR  REFKC A P C+C AG D CA EL +EAPPG  +G V Q+ SCLEP Y IQNAD + +L IRGP+CICQGPCCTWDQEFKV+S+DM+ E+G+ISKQWSGF+ EYFTDADNFGVSFP+DLDV+MKATM+ AVFLIDFMFFE
Sbjct:   81 VWMNRPAPIPGCPPGLEYLTQVDQLLVHQQIELLEVFTNWETKNKYQVKNSMGQQVYFAAEESDVCARQCCGPQRGFVMHITDNLGSEVIRVTREFKCLACPGCYCLAGADACAHELQIEAPPGTVVGYVRQECSCLEPRYEIQNADRQVVLLIRGPVCICQGPCCTWDQEFKVYSADMAHEVGKISKQWSGFIREYFTDADNFGVSFPMDLDVRMKATMIGAVFLIDFMFFE 313          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A267F8M5 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000651g2 PE=3 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.866e-128
Identity = 186/257 (72.37%), Postives = 210/257 (81.71%), Query Frame = 1
Query:  109 GMPMQIXXXXXXXXXXXXXXINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            G PMQ                 Q +WM +P    GCPPGLEYLT VDQ+LVHQQIELLEVFTNWETKNKYQ+KNS+GQQVY+AAEESDVCARQCCGPQRGFVMHITDN+G EVIR  R+FKCCA P C+C AG+D CA EL +EAPPG  I  V QQ SCLEPSY IQ+A  +T+LQIRGP+CICQGPCCTWDQEFKV+S+DM+ E+G+ISKQWSGF+ EYFTDADNFGVSFP+DLDVK+KA M+ AVFLIDFMFFE
Sbjct:   34 GQPMQAGYAPVPQQPQLGAPTGQVVWMNKPAAFPGCPPGLEYLTQVDQLLVHQQIELLEVFTNWETKNKYQVKNSMGQQVYFAAEESDVCARQCCGPQRGFVMHITDNLGAEVIRVTRQFKCCACPGCYCMAGMDCCAHELQIEAPPGSVIAYVKQQCSCLEPSYVIQDAGRKTVLQIRGPVCICQGPCCTWDQEFKVYSADMAHEVGKISKQWSGFIREYFTDADNFGVSFPMDLDVKIKAAMVGAVFLIDFMFFE 290          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A1I8GDX3 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032770g1 PE=3 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.932e-128
Identity = 186/257 (72.37%), Postives = 210/257 (81.71%), Query Frame = 1
Query:  109 GMPMQIXXXXXXXXXXXXXXINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            G PMQ                 Q +WM +P    GCPPGLEYLT VDQ+LVHQQIELLEVFTNWETKNKYQ+KNS+GQQVY+AAEESDVCARQCCGPQRGFVMHITDN+G EVIR  R+FKCCA P C+C AG+D CA EL +EAPPG  I  V QQ SCLEPSY IQ+A  +T+LQIRGP+CICQGPCCTWDQEFKV+S+DM+ E+G+ISKQWSGF+ EYFTDADNFGVSFP+DLDVK+KA M+ AVFLIDFMFFE
Sbjct:   35 GQPMQAGYAPVPQQPQLGAPTGQVVWMNKPAAFPGCPPGLEYLTQVDQLLVHQQIELLEVFTNWETKNKYQVKNSMGQQVYFAAEESDVCARQCCGPQRGFVMHITDNLGAEVIRVTRQFKCCACPGCYCMAGMDCCAHELQIEAPPGSVIAYVKQQCSCLEPSYVIQDAGRKTVLQIRGPVCICQGPCCTWDQEFKVYSADMAHEVGKISKQWSGFIREYFTDADNFGVSFPMDLDVKIKAAMVGAVFLIDFMFFE 291          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A1I8HPR3 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.519e-123
Identity = 175/227 (77.09%), Postives = 199/227 (87.67%), Query Frame = 1
Query:  181 IWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLI 861
            +WM RP  + GCPPGLEYLT VDQ+LVHQQIELLEVFTNWETKNKYQ+KNS+GQQVY+AAEESDVCARQCCGPQRGFVMHITDN+G+EVIR  REFKC A P C+C AG D CA EL +EAPPG  +G V Q+ SCLEP Y IQNAD + +L IRGP+CICQGPCCTWDQEFKV+S+DM+ E+G+ISKQWSGF+ EYFTDADNFGVSFP+DLDV+MKATM+ AVFLI
Sbjct:   74 VWMNRPAPIPGCPPGLEYLTQVDQLLVHQQIELLEVFTNWETKNKYQVKNSMGQQVYFAAEESDVCARQCCGPQRGFVMHITDNLGSEVIRVTREFKCLACPGCYCLAGADACAHELQIEAPPGTVVGYVRQECSCLEPRYEIQNADRQVVLLIRGPVCICQGPCCTWDQEFKVYSADMAHEVGKISKQWSGFIREYFTDADNFGVSFPMDLDVRMKATMIGAVFLI 300          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 260.381 bits (664), Expect = 1.517e-85
Identity = 130/231 (56.28%), Postives = 161/231 (69.70%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            M  P + VGCPPGLEYLT +DQ+LVHQ+IEL EV   WET NKY +KN+LGQQV+Y AEE+D C RQCCGP R FV+H+ DNMG EV+   R  +C +  C  C        QEL V+APPG  IG VIQ+     P + +QN   E +L+I+GP C C   CC+ D  F+V S D ST++GRI KQW+G + E FTDADNFG+ FP+DLDVK+KA +  A+FLIDFMFFE
Sbjct:   39 MPVPQRPVGCPPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTLGQQVFYVAEENDCCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPLRCASCCCPCCL-------QELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGPFCACN--CCS-DVNFEVMSMDESTQVGRICKQWTGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLIDFMFFE 259          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 248.054 bits (632), Expect = 3.278e-80
Identity = 124/225 (55.11%), Postives = 155/225 (68.89%), Query Frame = 1
Query:  187 MQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLI 861
            M  P + VGCPPGLEYLT +DQ+LVHQ+IEL EV   WET NKY +KN+LGQQV+Y AEE+D C RQCCGP R FV+H+ DNMG EV+   R  +C +  C  C        QEL V+APPG  IG VIQ+     P + +QN   E +L+I+GP C C   CC+ D  F+V S D ST++GRI KQW+G + E FTDADNFG+ FP+DLDVK+KA +  A+FLI
Sbjct:   39 MPVPQRPVGCPPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTLGQQVFYVAEENDCCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPLRCASCCCPCCL-------QELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGPFCACN--CCS-DVNFEVMSMDESTQVGRICKQWTGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLI 253          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 224.942 bits (572), Expect = 6.345e-72
Identity = 112/218 (51.38%), Postives = 146/218 (66.97%), Query Frame = 1
Query:  226 LEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            LEYLT +DQIL+HQ++EL+E    WET N+Y +KNSLGQQV+ AAEE+D C R  CGP R FV+H+ DN G EV+   R                  C QEL V++PPGQ IG VIQ+     P + I++  +++++QI GP C C   CC+ D  F+V S D ++ +GRISKQW+G   E  TDADNFGV FP+DLDVK+KA +L+A FLIDFM+FE
Sbjct:   33 LEYLTQIDQILIHQKVELMEAMLGWETNNQYVVKNSLGQQVFLAAEENDFCTRTMCGPMRSFVLHLQDNTGREVLTLTRPLN-------CSSCCFPCCLQELEVQSPPGQPIGYVIQKWHPYLPKFTIKDERKQSVMQIVGPFCDCN--CCS-DVNFEVMSLDGASVIGRISKQWTGMEAEMLTDADNFGVQFPMDLDVKIKAVILSACFLIDFMYFE 240          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:103028162])

HSP 1 Score: 224.172 bits (570), Expect = 7.302e-72
Identity = 108/235 (45.96%), Postives = 149/235 (63.40%), Query Frame = 1
Query:  175 QQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
              ++M   P + GCP GLEYLT VDQ+L+ Q++EL+E    +E+ NKY+I+N++GQ V+YA EE+D   RQCCGP R F + + DN G EVI   R  K               C QEL V++PPG  +G V+Q+     P + I+N   E +L+++GP C   G  C  D +F++ + D    +G+ISKQW+G + E FTDADNFG+ FP+DLDV+MKA M+   FLIDFMFFE
Sbjct:    3 HNMYMVPNPGMPGCPAGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNAMGQNVFYAVEENDCLTRQCCGPLRSFTIRVLDNFGQEVITVNRPLK-------CMSCFFPCCLQELEVQSPPGNIVGYVLQEWHPFLPKFTIKNEHREPVLKLQGPFC---GWSCLPDVDFEIMTMD-DVSIGKISKQWTGLLREAFTDADNFGIQFPMDLDVRMKAVMIGLCFLIDFMFFE 226          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 225.713 bits (574), Expect = 3.581e-71
Identity = 107/224 (47.77%), Postives = 144/224 (64.29%), Query Frame = 1
Query:  208 VGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            VG PPGLEYLT +DQ+L+HQ++ELLE    +ET N+Y++KNS+GQ++Y A E++D C R CCG  R F M I DN   EVIR +R F+               C QE+ V+APPG  IG V Q      P ++I+  ++ET++++ GP   C    C  D  F++   D    +GRISKQWSG + E FTD DNFG+ FP+D+DVKMKA ++ A FLIDF+FFE
Sbjct:   99 VGVPPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFR-------CATCWCPCCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLACN---CCGDVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFE 312          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO31512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP9])

HSP 1 Score: 233.032 bits (593), Expect = 8.418e-76
Identity = 116/218 (53.21%), Postives = 150/218 (68.81%), Query Frame = 1
Query:  226 LEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            LEYLT +DQ+L+ QQ+EL E+FT  E KNKYQI NSLGQQVY+A E++D C RQCCGP R F M ITDN G EVI   R  +C    C  C   I+       V+AP G  +G V Q+    +P + I++A+ +T+L + GPIC C+   C  D EF V S+D +  +G+++KQW+G + E FTDA+NFG++FP+DLDVKMKA ML AVFLIDFMFFE
Sbjct:   14 LEYLTQIDQLLIRQQVELFELFTGCEMKNKYQITNSLGQQVYFAKEDTDCCTRQCCGPARPFEMEITDNTGREVIHLSRPLRCACFCCWCCLQTIE-------VQAPRGNVVGYVEQEFYICKPKFTIKDANRQTILTMTGPICACR---CCADVEFPVLSADGTVPVGKVTKQWTGLIKEAFTDAENFGITFPMDLDVKMKAVMLGAVFLIDFMFFE 221          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 229.565 bits (584), Expect = 2.542e-67
Identity = 111/216 (51.39%), Postives = 143/216 (66.20%), Query Frame = 1
Query:  223 GLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPIC---ICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLI 861
            GLEYLTMVDQ+L+ QQ+ELLE FT +ET NKY+I N+LGQQV++AAE++D C RQCCGP R F + I DN   EVI   R  +               C QE+ V++PPG  +G   Q  S   P Y +Q+A+ +T+LQI GP+C   IC       D EF+V S+D   ++G++SKQWSG V E FTDADNFGV+FP+DLDVKMKA ++   FLI
Sbjct:   86 GLEYLTMVDQLLIKQQVELLEAFTGFETNNKYKITNNLGQQVFFAAEDTDCCTRQCCGPSRPFDIKIMDNTQREVIHLTRPLR-------CSSCWFPCCLQEVEVQSPPGTVVGYCCQSWSICIPKYTLQDANRQTILQIEGPLCTFNICG------DVEFQVLSADGQNQVGKVSKQWSGLVKEAFTDADNFGVTFPMDLDVKMKAVIIGTAFLI 288          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 225.713 bits (574), Expect = 1.253e-71
Identity = 113/224 (50.45%), Postives = 149/224 (66.52%), Query Frame = 1
Query:  208 VGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +G PPGLEYL  +DQIL+HQ++ELLE F  +ET N+Y+IKN+LGQ++Y A E++D C R CCG  R F M I DN   EVIR +R F+C +  C  C        QE+ V+APPG  +G V Q      P ++IQ A++ET++++ GP   C    C  D  F++   D  T +GRI+KQWSG + E FTD DNFG+ FP+DLDVKMKA ++ A FLIDFMFFE
Sbjct:   65 IGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSCCCPCCL-------QEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACN---CCGDVSFELKGKD-ETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 225.713 bits (574), Expect = 1.253e-71
Identity = 113/224 (50.45%), Postives = 149/224 (66.52%), Query Frame = 1
Query:  208 VGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +G PPGLEYL  +DQIL+HQ++ELLE F  +ET N+Y+IKN+LGQ++Y A E++D C R CCG  R F M I DN   EVIR +R F+C +  C  C        QE+ V+APPG  +G V Q      P ++IQ A++ET++++ GP   C    C  D  F++   D  T +GRI+KQWSG + E FTD DNFG+ FP+DLDVKMKA ++ A FLIDFMFFE
Sbjct:   65 IGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSCCCPCCL-------QEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACN---CCGDVSFELKGKD-ETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 211.46 bits (537), Expect = 1.363e-66
Identity = 100/216 (46.30%), Postives = 137/216 (63.43%), Query Frame = 1
Query:  232 YLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            Y   VDQ+L+ Q++EL+E    +E+ NKY+I+N +GQ V+YA EE+D  +RQCCGP R F +H+ DN G E+I   R  K               C QEL V++PPG  +G VIQQ     P + + N   E +L+I GP C   G  C  D +F++ + D   ++G+ISKQW+G + E FTD+DNFG+ FP+DLDV+MKA M+ A FLIDFMFFE
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLK-------CMSCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFC---GWSCLPDVDFEILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFE 242          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 211.46 bits (537), Expect = 1.363e-66
Identity = 100/216 (46.30%), Postives = 137/216 (63.43%), Query Frame = 1
Query:  232 YLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            Y   VDQ+L+ Q++EL+E    +E+ NKY+I+N +GQ V+YA EE+D  +RQCCGP R F +H+ DN G E+I   R  K               C QEL V++PPG  +G VIQQ     P + + N   E +L+I GP C   G  C  D +F++ + D   ++G+ISKQW+G + E FTD+DNFG+ FP+DLDV+MKA M+ A FLIDFMFFE
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLK-------CMSCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFC---GWSCLPDVDFEILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFE 242          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: ENSORLT00000039761.1 (pep primary_assembly:ASM223467v1:17:23178367:23181458:-1 gene:ENSORLG00000023741.1 transcript:ENSORLT00000039761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 8.088e-7
Identity = 47/176 (26.70%), Postives = 71/176 (40.34%), Query Frame = 1
Query:  352 YAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            +  E   VC   CCGP R   +   D  G +V       +  A         +  C  E+    P  + IG V Q+ S   P   + +++  + ++I       QG CC  D   K+ SS +   +G I K+W GF  E+  D D FG+          +   L  VF+ + M FE
Sbjct:  112 FPLERYCVCL-HCCGPARACSLQGVDCQGRQVFYFESPLRVDACC-------LGSCLMEIRAYLPQKRIIGTVGQRWSMFTPLLEMCDSEGSSTIRI-------QGSCCPGDFILKIVSS-IGEPIGSIWKKWPGFNEEHNMDHDCFGLE---GEKRTFELKQLPLVFVQNHMVFE 268          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 484.952 bits (1247), Expect = 1.148e-171
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:    1 QGQPYNQQGTXXXXXXXXXXXXXXXXXXXXXXXXXXGMPMQIXXXXXXXXXXXXXXINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE
Sbjct:  123 QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 415          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 484.567 bits (1246), Expect = 1.163e-171
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:    1 QGQPYNQQGTXXXXXXXXXXXXXXXXXXXXXXXXXXGMPMQIXXXXXXXXXXXXXXINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE
Sbjct:  109 QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 401          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 484.567 bits (1246), Expect = 1.451e-171
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:    1 QGQPYNQQGTXXXXXXXXXXXXXXXXXXXXXXXXXXGMPMQIXXXXXXXXXXXXXXINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE
Sbjct:  120 QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGPGMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 412          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.295e-72
Identity = 116/235 (49.36%), Postives = 157/235 (66.81%), Query Frame = 1
Query:  184 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPI---CICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            WM RP +VVGCP GLEYLT++DQ+L+HQQ+EL E+ + +ET N+Y +KN  GQ++YYA E++D C R   GP R FV+H++D +  EVI+  R   C     C  C+  + C  E+ VEAPPGQ +G V Q     E  Y+I N + E +L++ GP    C C G     D   K+ S+D S ELG++SKQWS  V E FTDADNFG+ FP+DLDVK+KA ++ +VFL+DFM+FE
Sbjct:   90 WMSRP-EVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCS--ECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGD----DFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFE 317          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 225.328 bits (573), Expect = 2.585e-72
Identity = 113/230 (49.13%), Postives = 154/230 (66.96%), Query Frame = 1
Query:  199 PQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKXXXXXXXXXXXXIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPI---CICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 879
            P+VVGCP GLEYLT++DQ+L+HQQ+EL E+ + +ET N+Y +KN  GQ++YYA E++D C R   GP R FV+H++D +  EVI+  R   C     C  C+  + C  E+ VEAPPGQ +G V Q     E  Y+I N + E +L++ GP    C C G     D   K+ S+D S ELG++SKQWS  V E FTDADNFG+ FP+DLDVK+KA ++ +VFL+DFM+FE
Sbjct:    4 PEVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCS--ECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGD----DFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFE 227          
The following BLAST results are available for this feature:
BLAST of Phospholipid scramblase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLSCR17.273e-7953.45phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR19.530e-7953.45phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR13.323e-7052.80phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR21.337e-6448.86phospholipid scramblase 2 [Source:HGNC Symbol;Acc:... [more]
PLSCR21.337e-6448.86phospholipid scramblase 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrm-11.581e-7151.50Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.803e-7151.50Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.803e-7151.50Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.803e-7151.50Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-26.493e-6446.58Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scramb11.049e-6848.48gene:FBgn0052056 transcript:FBtr0076302[more]
scramb21.334e-6848.71gene:FBgn0035390 transcript:FBtr0073005[more]
scramb11.073e-6748.71gene:FBgn0052056 transcript:FBtr0076301[more]
scramb13.128e-6748.68gene:FBgn0052056 transcript:FBtr0076303[more]
CG90844.191e-1425.43gene:FBgn0033582 transcript:FBtr0088197[more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.14.261e-8454.47si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.15.515e-8454.98si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.15.515e-8454.98si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.15.515e-8454.98si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.51.787e-7653.25si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insyn11.002e-7955.41inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn11.119e-7955.41inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.11.076e-7451.95phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
kpna65.173e-4038.81karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
kpna61.581e-3938.31karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plscr27.181e-7449.14phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr27.181e-7449.14phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr11.600e-7252.05phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr11.600e-7252.05phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr31.544e-6246.19phospholipid scramblase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBG9|PLS2_BOVIN2.715e-7952.12Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN... [more]
sp|O15162|PLS1_HUMAN4.576e-7853.45Phospholipid scramblase 1 OS=Homo sapiens OX=9606 ... [more]
sp|P58195|PLS1_RAT4.890e-7454.31Phospholipid scramblase 1 OS=Rattus norvegicus OX=... [more]
sp|Q9DCW2|PLS2_MOUSE5.023e-7349.14Phospholipid scramblase 2 OS=Mus musculus OX=10090... [more]
sp|Q9JJ00|PLS1_MOUSE1.119e-7152.05Phospholipid scramblase 1 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Phospholipid scramblase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HNN93.860e-12977.68Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
A0A267FT901.829e-12877.68Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
A0A267F8M51.866e-12872.37Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
A0A1I8GDX31.932e-12872.37Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
A0A1I8HPR31.519e-12377.09Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.11.517e-8556.28phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch211-71m22.13.278e-8055.11phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch211-71m22.56.345e-7251.38si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
si:ch73-206p6.17.302e-7245.96phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
plscr3b3.581e-7147.77phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315128.418e-7653.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461092.542e-6751.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plscr3b1.253e-7150.45phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b1.253e-7150.45phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.363e-6646.30phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.363e-6646.30phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000039761.18.088e-726.70pep primary_assembly:ASM223467v1:17:23178367:23181... [more]
back to top
BLAST of Phospholipid scramblase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043802.11.148e-171100.00SMESG000043802.1[more]
SMESG000043802.11.163e-171100.00SMESG000043802.1[more]
SMESG000043802.11.451e-171100.00SMESG000043802.1[more]
SMESG000050651.11.295e-7249.36SMESG000050651.1[more]
SMESG000050651.12.585e-7249.13SMESG000050651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010538 ID=SMED30010538|Name=Phospholipid scramblase|organism=Schmidtea mediterranea sexual|type=transcript|length=1083bp
CAAGGTCAACCGTATAATCAACAAGGAACCCCATATAATCCGCAAGGTCA
ACCATATAATCAACAAGGACCCCCATATAATCCGCAAGCAGCACCATACG
GACAACCAGGAATGCCTATGCAAATACCTACGGGTCAGCCTTGTGGTCCC
GGAATGCCTCAACAAGGAATAAATCAACAAATTTGGATGCAAAGACCTCC
ACAAGTTGTTGGATGCCCACCAGGACTTGAATATCTGACAATGGTTGATC
AAATTCTTGTCCATCAGCAAATTGAATTGCTTGAAGTCTTTACCAACTGG
GAAACAAAGAACAAGTATCAAATTAAAAATTCCCTTGGCCAGCAAGTTTA
TTATGCTGCTGAAGAATCTGACGTATGTGCTCGTCAATGTTGTGGTCCTC
AACGGGGCTTTGTAATGCATATTACCGATAATATGGGCACAGAGGTCATC
AGAGCTATGAGAGAGTTTAAATGTTGCGCCGGCCCATGCTGCCATTGCTG
TGCCGGTATAGACATGTGTGCCCAAGAATTAACCGTTGAAGCCCCACCCG
GACAAGCAATCGGCCGGGTTATTCAACAATCAAGTTGTCTCGAACCAAGT
TATGCAATTCAAAATGCCGATGAAGAGACTATGCTACAAATAAGAGGACC
TATTTGTATTTGTCAGGGACCATGTTGTACATGGGATCAGGAATTTAAGG
TATTCTCGTCAGATATGTCAACTGAGCTCGGTAGAATTAGTAAACAATGG
TCCGGATTTGTACACGAATACTTCACGGACGCGGACAACTTCGGCGTTTC
TTTTCCTATTGATCTCGATGTGAAAATGAAAGCAACAATGTTGGCCGCTG
TGTTTTTAATAGATTTTATGTTTTTTGAAAATAACCAGCAAAATCAGAAT
AGCTAAACAGGTGGACTTTTTATCATTTTGAATGTGATTATATTTCTTCA
TGTATTTTATTTGTGAACTTCATCTTTCATTCGTCGCAACTGTATTATAA
TAATGGAGGCCCCATTGCATATTTTGAATAGGGACTCATACTTTATATAT
CTAGTTTCCTTGTTGAGATTTGATTTATTAATG
back to top

protein sequence of SMED30010538-orf-1

>SMED30010538-orf-1 ID=SMED30010538-orf-1|Name=SMED30010538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
QGQPYNQQGTPYNPQGQPYNQQGPPYNPQAAPYGQPGMPMQIPTGQPCGP
GMPQQGINQQIWMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNW
ETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVI
RAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPS
YAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFSSDMSTELGRISKQW
SGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFENNQQNQN
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0017121phospholipid scrambling
GO:0006644phospholipid metabolic process
GO:0045454cell redox homeostasis
GO:0050482arachidonic acid secretion
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0017128phospholipid scramblase activity
GO:0004623phospholipase A2 activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005552Scramblase
IPR025659Tubby-like_C
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 292..301
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availablePANTHERPTHR23248:SF38PHOSPHOLIPID SCRAMBLASE 1-RELATEDcoord: 26..299
IPR005552ScramblasePFAMPF03803Scramblasecoord: 69..294
e-value: 7.6E-83
score: 277.2
IPR005552ScramblasePANTHERPTHR23248PHOSPHOLIPID SCRAMBLASE-RELATEDcoord: 26..299
IPR025659Tubby-like, C-terminalSUPERFAMILYSSF54518Tubby C-terminal domain-likecoord: 103..291