Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30010536
Length (bp)1329
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30010536) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30010536) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30010536) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30010536) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010536

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010536SMESG000036140.1 SmedASXL_010069SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30010536SMESG000036140.1 dd_Smed_v4_9596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010536SMESG000036140.1 dd_Smed_v6_9596_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010536SMESG000036140.1 dd_Smed_v4_9596_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30010536SMESG000036140.1 dd_Smed_v4_9596_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: DLX1 (distal-less homeobox 1 [Source:HGNC Symbol;Acc:HGNC:2914])

HSP 1 Score: 71.2478 bits (173), Expect = 7.380e-14
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  123 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: DLX1 (distal-less homeobox 1 [Source:HGNC Symbol;Acc:HGNC:2914])

HSP 1 Score: 71.633 bits (174), Expect = 1.749e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  123 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: DLX6 (distal-less homeobox 6 [Source:HGNC Symbol;Acc:HGNC:2919])

HSP 1 Score: 69.3218 bits (168), Expect = 2.224e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:   34 GKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 87          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: DLX5 (distal-less homeobox 5 [Source:HGNC Symbol;Acc:HGNC:2918])

HSP 1 Score: 71.2478 bits (173), Expect = 3.276e-13
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  559 AYQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +Y +    ++R P +T   +    +  +   +   KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  100 SYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: DLX6 (distal-less homeobox 6 [Source:HGNC Symbol;Acc:HGNC:2919])

HSP 1 Score: 70.4774 bits (171), Expect = 6.371e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  164 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 215          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-43 (Homeobox protein ceh-43 [Source:UniProtKB/Swiss-Prot;Acc:Q18273])

HSP 1 Score: 66.6254 bits (161), Expect = 4.591e-12
Identity = 28/52 (53.85%), Postives = 39/52 (75.00%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++ ++Q++ LQ  + + +YL L +RA LA  L L+QTQVKIWF
Sbjct:   99 GKKMRKPRTIYNSSQLQMLQKKFQKTQYLALPDRAALAHELGLSQTQVKIWF 150          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 60.8474 bits (146), Expect = 2.560e-10
Identity = 26/58 (44.83%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  643 LGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +GS    KKSRK RT+FT+ Q++ L+  ++++KYL++ +R  LA  + LT TQVK W+
Sbjct:   86 MGSPGSCKKSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWY 143          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 60.8474 bits (146), Expect = 2.560e-10
Identity = 26/58 (44.83%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  643 LGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +GS    KKSRK RT+FT+ Q++ L+  ++++KYL++ +R  LA  + LT TQVK W+
Sbjct:   86 MGSPGSCKKSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWY 143          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-5 (Homeobox protein ceh-5 [Source:UniProtKB/Swiss-Prot;Acc:P20269])

HSP 1 Score: 57.3806 bits (137), Expect = 6.150e-10
Identity = 25/50 (50.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  667 KSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            + ++PRTVFT+ Q+E+L+  ++   YL+ S RAKLA SL L+  QVK+WF
Sbjct:   34 RPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWF 83          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: vab-15 (Homeobox protein vab-15 [Source:UniProtKB/Swiss-Prot;Acc:Q09604])

HSP 1 Score: 58.9214 bits (141), Expect = 8.453e-10
Identity = 26/51 (50.98%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            K +RKPRT F+  Q+  L+  +  ++YL+++ERA+ +ASL LT+TQVKIWF
Sbjct:  127 KNNRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWF 177          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Dll (gene:FBgn0000157 transcript:FBtr0072378)

HSP 1 Score: 72.4034 bits (176), Expect = 1.009e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q+++L   +   +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Dll (gene:FBgn0000157 transcript:FBtr0072379)

HSP 1 Score: 72.4034 bits (176), Expect = 1.177e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q+++L   +   +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Dll (gene:FBgn0000157 transcript:FBtr0300076)

HSP 1 Score: 72.4034 bits (176), Expect = 1.441e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q+++L   +   +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Hmx (gene:FBgn0264005 transcript:FBtr0346339)

HSP 1 Score: 70.8626 bits (172), Expect = 8.021e-13
Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  649 SSNHG----KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            SS HG    K+ +K RTVF+ AQ+ +L+  +D ++YL+ SERA LAASL LT+TQVKIWF
Sbjct:  457 SSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWF 516          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Hmx (gene:FBgn0264005 transcript:FBtr0330385)

HSP 1 Score: 70.8626 bits (172), Expect = 8.021e-13
Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  649 SSNHG----KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            SS HG    K+ +K RTVF+ AQ+ +L+  +D ++YL+ SERA LAASL LT+TQVKIWF
Sbjct:  457 SSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWF 516          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: dlx6a (distal-less homeobox 6a [Source:NCBI gene;Acc:30586])

HSP 1 Score: 69.707 bits (169), Expect = 7.250e-14
Identity = 47/134 (35.07%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTF 1056
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWFQ                  +K      + +QG N    D + P  I        I PI   + S+   N+S ++ Y P +
Sbjct:   19 GKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQ------------------NKRSKFKKLLKQGGNPHETDTL-PGSIALSPRSPAIPPIWDVSASSKGVNMSANS-YMPGY 132          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: dlx6a (distal-less homeobox 6a [Source:NCBI gene;Acc:30586])

HSP 1 Score: 72.0182 bits (175), Expect = 8.460e-14
Identity = 47/132 (35.61%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTF 1056
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWFQ                  +K      + +QG N    D + P  I        I PI   + S+   N+S ++ Y P +
Sbjct:  122 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQ------------------NKRSKFKKLLKQGGNPHETDTL-PGSIALSPRSPAIPPIWDVSASSKGVNMSANS-YMPGY 233          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: dlx1a (distal-less homeobox 1a [Source:NCBI gene;Acc:30568])

HSP 1 Score: 71.2478 bits (173), Expect = 1.363e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  125 GKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: dlx6a (distal-less homeobox 6a [Source:NCBI gene;Acc:30586])

HSP 1 Score: 69.3218 bits (168), Expect = 1.429e-13
Identity = 47/132 (35.61%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTF 1056
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWFQ                  +K      + +QG N    D + P  I        I PI   + S+   N+S ++ Y P +
Sbjct:   45 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQ------------------NKRSKFKKLLKQGGNPHETDTL-PGSIALSPRSPAIPPIWDVSASSKGVNMSANS-YMPGY 156          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: dlx4b (distal-less homeobox 4b [Source:NCBI gene;Acc:30581])

HSP 1 Score: 70.8626 bits (172), Expect = 2.061e-13
Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  604 TTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            T  E P   ++  +  +  GKK RKPRT++++ Q++ L   + + +YL L ERA LAA L LTQTQVKIWF
Sbjct:  107 TNHEKPAVIENGEIRLNGKGKKIRKPRTIYSSVQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWF 177          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: dlx1 (distal-less homeobox 1 [Source:NCBI gene;Acc:100101750])

HSP 1 Score: 71.2478 bits (173), Expect = 2.248e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  119 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: shpk (sedoheptulokinase [Source:Xenbase;Acc:XB-GENE-991309])

HSP 1 Score: 70.4774 bits (171), Expect = 4.340e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  131 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 182          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: dlx2 (distal-less homeobox 2 [Source:NCBI gene;Acc:493423])

HSP 1 Score: 70.0922 bits (170), Expect = 7.542e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  125 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 175          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: dlx1 (distal-less homeobox 1 [Source:NCBI gene;Acc:100101750])

HSP 1 Score: 71.2478 bits (173), Expect = 8.547e-13
Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = 1
Query:  598 YSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +   TE  T  +   +  +  GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  272 HGAETEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 344          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: nfatc3 (nuclear factor of activated T cells 3 [Source:Xenbase;Acc:XB-GENE-493918])

HSP 1 Score: 69.707 bits (169), Expect = 1.099e-12
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  144 KKIRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 194          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Dlx5 (distal-less homeobox 5 [Source:MGI Symbol;Acc:MGI:101926])

HSP 1 Score: 72.7886 bits (177), Expect = 8.081e-14
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 1
Query:  562 YQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            Y +    ++R P +T+  +    +  +   +   KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  101 YHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Dlx1 (distal-less homeobox 1 [Source:MGI Symbol;Acc:MGI:94901])

HSP 1 Score: 71.633 bits (174), Expect = 1.212e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  123 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Dlx6 (distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:101927])

HSP 1 Score: 69.3218 bits (168), Expect = 1.236e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:   27 GKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 80          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Dlx6 (distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:101927])

HSP 1 Score: 70.8626 bits (172), Expect = 3.420e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  168 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Dlx6 (distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:101927])

HSP 1 Score: 70.8626 bits (172), Expect = 3.420e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  168 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 219          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P50575|DLX5_RAT (Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.549e-13
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 1
Query:  562 YQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            Y +    ++R P +T+  +    +  +   +   KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  101 YHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 185          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P70396|DLX5_MOUSE (Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.653e-13
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 1
Query:  562 YQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            Y +    ++R P +T+  +    +  +   +   KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  101 YHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 185          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q98877|DLX6A_DANRE (Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.387e-13
Identity = 47/132 (35.61%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTF 1056
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWFQ                  +K      + +QG N    D + P  I        I PI   + S+   N+S ++ Y P +
Sbjct:  122 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQ------------------NKRSKFKKLLKQGGNPHETDTL-PGSIALSPRSPAIPPIWDVSASSKGVNMSANS-YMPGY 233          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P87393|DLX2_ELECQ (Homeobox protein DLX-2 (Fragment) OS=Eleutherodactylus coqui OX=57060 GN=DLX2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.607e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:   52 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 102          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P70397|DLX6_MOUSE (Homeobox protein DLX-6 OS=Mus musculus OX=10090 GN=Dlx6 PE=2 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 7.474e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:   46 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 97          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: Q27W45 (ANTP homeobox protein OS=Trichoplax adhaerens OX=10228 GN=Dlx PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.675e-11
Identity = 36/55 (65.45%), Postives = 41/55 (74.55%), Query Frame = 1
Query:  652 SNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            SN GKK+RKPRT+FT+AQ+  L   +    YL L ERA LAASL LTQTQVKIWF
Sbjct:  156 SNKGKKNRKPRTIFTSAQLNELNNRFRLSHYLGLPERADLAASLGLTQTQVKIWF 210          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1W6AZH5 (Distal-less OS=Membranipora membranacea OX=95170 GN=dlx PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.686e-11
Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 1
Query:  595 PYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            P ST  E   + + +I      GKK RKPRT++++ Q+++L   +   +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  109 PTSTGREGGKDVEPTIGRVGGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 182          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: G3P627 (Distal-less homeobox 4b OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.171e-11
Identity = 47/97 (48.45%), Postives = 60/97 (61.86%), Query Frame = 1
Query:  613 EDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSIS 903
            E P    S     +  GKK+RKPRT++++ Q++ L   + + +YL L ERA LAA L LTQTQVKIWFQN+RSK KK  K    SEG+      SIS
Sbjct:  105 EKPAAADSRDFRPNGRGKKTRKPRTIYSSLQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKITKRGSGSEGEHLHSTSSIS 201          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A3P9IF17 (Distal-less homeobox 4b OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.362e-11
Identity = 46/81 (56.79%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSIS 903
            GKK RKPRT++++ Q++ L   + + +YL L ERA LAA L LTQTQVKIWFQN+RSK KK  K S  SEGD      SIS
Sbjct:  128 GKKIRKPRTIYSSLQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHSSGSEGDHLHSASSIS 208          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A3P9MPF0 (Distal-less homeobox 4b OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.394e-11
Identity = 46/81 (56.79%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSIS 903
            GKK RKPRT++++ Q++ L   + + +YL L ERA LAA L LTQTQVKIWFQN+RSK KK  K S  SEGD      SIS
Sbjct:  128 GKKIRKPRTIYSSLQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHSSGSEGDHLHSASSIS 208          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: dlx4b (homeobox protein Dlx4b-like [Source:NCBI gene;Acc:103029147])

HSP 1 Score: 71.633 bits (174), Expect = 6.591e-14
Identity = 38/96 (39.58%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPC 948
            GKK RKPRT++++ Q+  LQ  + + +YL L ERA LAA L LTQTQVKIWFQ                  +K      I + G++    D   PC
Sbjct:  114 GKKLRKPRTIYSSGQLAALQQRFQQTQYLALPERADLAAQLGLTQTQVKIWFQ------------------NKRSKYKKIMKHGSSGPEGDPHGPC 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: dlx6a (distal-less homeobox 6 [Source:NCBI gene;Acc:103029558])

HSP 1 Score: 70.8626 bits (172), Expect = 1.427e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  122 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 173          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: dlx1a (distal-less homeobox 1 [Source:NCBI gene;Acc:103031421])

HSP 1 Score: 70.8626 bits (172), Expect = 1.651e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  125 GKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: dlx2 (distal-less homeobox 2 [Source:NCBI gene;Acc:103031105])

HSP 1 Score: 70.0922 bits (170), Expect = 4.713e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  123 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 173          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: dlx2b (Astyanax mexicanus homeobox protein Dlx2b-like (LOC103034899), mRNA. [Source:RefSeq mRNA;Acc:NM_001291254])

HSP 1 Score: 69.707 bits (169), Expect = 5.494e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  123 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 173          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 70.0922 bits (170), Expect = 2.492e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  200 KKIRKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWF 250          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 60.8474 bits (146), Expect = 9.521e-12
Identity = 27/48 (56.25%), Postives = 39/48 (81.25%), Query Frame = 1
Query:  673 RKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +K RTVF+ +Q+ +L+  +D ++YL+ +ERA LAASL LT+TQVKIWF
Sbjct:    2 KKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 60.8474 bits (146), Expect = 1.350e-11
Identity = 26/51 (50.98%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            K +RKPRT FT +Q+  L+  + +++YL+++ERA+ + SL LT+TQVKIWF
Sbjct:   12 KATRKPRTPFTTSQLLALEHKFRQKQYLSIAERAEFSTSLSLTETQVKIWF 62          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dlx6a (distal-less homeobox 6a [Source:NCBI gene;Acc:30586])

HSP 1 Score: 57.7658 bits (138), Expect = 1.865e-10
Identity = 27/49 (55.10%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVK 807
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQV+
Sbjct:   99 GKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVR 147          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001480.1 (pep scaffold:Pmarinus_7.0:GL487501:66:2428:-1 gene:ENSPMAG00000001338.1 transcript:ENSPMAT00000001480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.041e-9
Identity = 24/52 (46.15%), Postives = 36/52 (69.23%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            G + RK RTVFT++Q+  L+  +  ++YL+  ER  LA +L L++TQVK WF
Sbjct:    3 GVRRRKARTVFTDSQLSGLERRFVRQRYLSTPERVDLATALGLSETQVKTWF 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO46555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPR7])

HSP 1 Score: 62.003 bits (149), Expect = 1.738e-12
Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q+  L   + + +YL L ERA LAA L LTQTQVKIWF
Sbjct:    8 GKKIRKPRTIYSSFQLRELNKRFIKTQYLALPERADLAAYLGLTQTQVKIWF 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO43402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ0])

HSP 1 Score: 61.6178 bits (148), Expect = 2.423e-12
Identity = 28/53 (52.83%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  658 HGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            H  KSR+ RT FT++Q++ L+  + E+KYLT+SER +LA S+ L+ TQVK WF
Sbjct:    7 HSSKSRRKRTAFTSSQLKYLEEKFQEKKYLTISERNELAKSMYLSDTQVKTWF 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: MSX (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI73])

HSP 1 Score: 61.2326 bits (147), Expect = 6.308e-12
Identity = 27/51 (52.94%), Postives = 42/51 (82.35%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            K +RKPRT FT +Q+  L+  + +++YL+++ERA+ +ASL+LT+TQVKIWF
Sbjct:   12 KANRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSASLNLTETQVKIWF 62          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO32495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX2])

HSP 1 Score: 58.5362 bits (140), Expect = 2.179e-11
Identity = 26/48 (54.17%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  673 RKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            ++PRT FTN QI+ L+  + + KYL++S R +LA SL LT+TQ+KIWF
Sbjct:    2 KRPRTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO38891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBL6])

HSP 1 Score: 58.9214 bits (141), Expect = 2.272e-11
Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  670 SRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            SR+ RT FT++Q++ L+  + E+KYLT+SER  LA S+ LT TQVK WF
Sbjct:    1 SRRRRTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: dlx4b (homeobox protein Dlx4b [Source:NCBI gene;Acc:101157253])

HSP 1 Score: 74.3294 bits (181), Expect = 1.277e-14
Identity = 46/81 (56.79%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSIS 903
            GKK RKPRT++++ Q++ L   + + +YL L ERA LAA L LTQTQVKIWFQN+RSK KK  K S  SEGD      SIS
Sbjct:  128 GKKIRKPRTIYSSLQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHSSGSEGDHLHSASSIS 208          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: dlx6a (distal-less homeobox 6 [Source:NCBI gene;Acc:101158118])

HSP 1 Score: 71.2478 bits (173), Expect = 1.272e-13
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  661 GKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  121 GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWF 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: dlx1a (distal-less homeobox 1 [Source:NCBI gene;Acc:101161018])

HSP 1 Score: 70.8626 bits (172), Expect = 1.649e-13
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  655 NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
              GKK RKPRT++++ Q++ L   + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  122 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 175          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: dlx2 (distal-less homeobox 2 [Source:NCBI gene;Acc:100049449])

HSP 1 Score: 70.0922 bits (170), Expect = 4.035e-13
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  + + +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  124 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 174          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: dlx5a (distal-less homeobox 5 [Source:NCBI gene;Acc:101158458])

HSP 1 Score: 69.3218 bits (168), Expect = 8.640e-13
Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  664 KKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            KK RKPRT++++ Q+  LQ  +   +YL L ERA+LAASL LTQTQVKIWF
Sbjct:  147 KKVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWF 197          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000036140.1 (SMESG000036140.1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 1
Query:  103 MTELIHQNQTLDEAYQCALSEEESTMYDYSDLINEQTNFNSDCYRIPFTNSDCSDFTTHLNMQNAEYMHDWKIWSPSLSLQMLSNDHQDLLKVTQPLNYENDXXXXXXXXXXYIGNEMKVPEVSQSYYQSITKADQVMTDYKSFYNTCMINGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFXXXXXXXXXXXXXXXXXEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTFYTQSMNNPYHNPTSNENFETFPHNEPLIIYEDPLPTHNIVPNTEDFPDSFPVNNIMENCK 1236
            MTELIHQNQTLDEAYQCALSEEESTMYDYSDLINEQTNFNSDCYRIPFTNSDCSDFTTHLNMQNAEYMHDWKIWSPSLSLQMLSNDHQDLLKVTQPLNYENDLNLLPPHPPPYIGNEMKVPEVSQSYYQSITKADQVMTDYKSFYNTCMINGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFQNRRSKEKKSQKSSENSEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTFYTQSMNNPYHNPTSNENFETFPHNEPLIIYEDPLPTHNIVPNTEDFPDSFPVNNIMENCK
Sbjct:    1 MTELIHQNQTLDEAYQCALSEEESTMYDYSDLINEQTNFNSDCYRIPFTNSDCSDFTTHLNMQNAEYMHDWKIWSPSLSLQMLSNDHQDLLKVTQPLNYENDLNLLPPHPPPYIGNEMKVPEVSQSYYQSITKADQVMTDYKSFYNTCMINGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFQNRRSKEKKSQKSSENSEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSAQSNNNYNVSDSTVYTPTFYTQSMNNPYHNPTSNENFETFPHNEPLIIYEDPLPTHNIVPNTEDFPDSFPVNNIMENCK 378          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000045025.1 (SMESG000045025.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.822e-13
Identity = 31/55 (56.36%), Postives = 43/55 (78.18%), Query Frame = 1
Query:  652 SNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            S  GKK RKPRT++++ Q+++L   +   +YL+L ERA+LA+SL LTQTQVKIWF
Sbjct:  276 SGKGKKIRKPRTIYSSLQLQQLSKRFQRTQYLSLPERAELASSLGLTQTQVKIWF 330          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000045025.1 (SMESG000045025.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.856e-13
Identity = 31/55 (56.36%), Postives = 43/55 (78.18%), Query Frame = 1
Query:  652 SNHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            S  GKK RKPRT++++ Q+++L   +   +YL+L ERA+LA+SL LTQTQVKIWF
Sbjct:  272 SGKGKKIRKPRTIYSSLQLQQLSKRFQRTQYLSLPERAELASSLGLTQTQVKIWF 326          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000019757.1 (SMESG000019757.1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.174e-11
Identity = 32/100 (32.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  520 DYKSFYNTCMINGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSS-NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +Y+ + +  +IN  Y+    +F +         P ++++S    +    K +RKPRT FT  Q+ +L+  + +++YL+++ERA+ ++SL LT+ QVKIWF
Sbjct:   54 EYRRWISNIIINENYEPTQQKFSQIQNHCQISTPIHFRTSPNKCTLRKHKPNRKPRTPFTTQQLIQLEKKFHQKQYLSIAERAEFSSSLGLTEIQVKIWF 153          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000019757.1 (SMESG000019757.1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.242e-11
Identity = 32/100 (32.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  520 DYKSFYNTCMINGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSS-NHGKKSRKPRTVFTNAQIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWF 816
            +Y+ + +  +IN  Y+    +F +         P ++++S    +    K +RKPRT FT  Q+ +L+  + +++YL+++ERA+ ++SL LT+ QVKIWF
Sbjct:   58 EYRRWISNIIINENYEPTQQKFSQIQNHCQISTPIHFRTSPNKCTLRKHKPNRKPRTPFTTQQLIQLEKKFHQKQYLSIAERAEFSSSLGLTEIQVKIWF 157          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLX17.380e-1457.41distal-less homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
DLX11.749e-1357.41distal-less homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
DLX62.224e-1357.41distal-less homeobox 6 [Source:HGNC Symbol;Acc:HGN... [more]
DLX53.276e-1340.70distal-less homeobox 5 [Source:HGNC Symbol;Acc:HGN... [more]
DLX66.371e-1359.62distal-less homeobox 6 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-434.591e-1253.85Homeobox protein ceh-43 [Source:UniProtKB/Swiss-P... [more]
ceh-302.560e-1044.83Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
ceh-302.560e-1044.83Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
ceh-56.150e-1050.00Homeobox protein ceh-5 [Source:UniProtKB/Swiss-Pr... [more]
vab-158.453e-1050.98Homeobox protein vab-15 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dll1.009e-1359.62gene:FBgn0000157 transcript:FBtr0072378[more]
Dll1.177e-1359.62gene:FBgn0000157 transcript:FBtr0072379[more]
Dll1.441e-1359.62gene:FBgn0000157 transcript:FBtr0300076[more]
Hmx8.021e-1356.67gene:FBgn0264005 transcript:FBtr0346339[more]
Hmx8.021e-1356.67gene:FBgn0264005 transcript:FBtr0330385[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlx6a7.250e-1435.07distal-less homeobox 6a [Source:NCBI gene;Acc:3058... [more]
dlx6a8.460e-1435.61distal-less homeobox 6a [Source:NCBI gene;Acc:3058... [more]
dlx1a1.363e-1359.62distal-less homeobox 1a [Source:NCBI gene;Acc:3056... [more]
dlx6a1.429e-1335.61distal-less homeobox 6a [Source:NCBI gene;Acc:3058... [more]
dlx4b2.061e-1346.48distal-less homeobox 4b [Source:NCBI gene;Acc:3058... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlx12.248e-1357.41distal-less homeobox 1 [Source:NCBI gene;Acc:10010... [more]
shpk4.340e-1359.62sedoheptulokinase [Source:Xenbase;Acc:XB-GENE-9913... [more]
dlx27.542e-1360.78distal-less homeobox 2 [Source:NCBI gene;Acc:49342... [more]
dlx18.547e-1346.58distal-less homeobox 1 [Source:NCBI gene;Acc:10010... [more]
nfatc31.099e-1260.78nuclear factor of activated T cells 3 [Source:Xenb... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlx58.081e-1441.18distal-less homeobox 5 [Source:MGI Symbol;Acc:MGI:... [more]
Dlx11.212e-1357.41distal-less homeobox 1 [Source:MGI Symbol;Acc:MGI:... [more]
Dlx61.236e-1357.41distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:... [more]
Dlx63.420e-1359.62distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:... [more]
Dlx63.420e-1359.62distal-less homeobox 6 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50575|DLX5_RAT5.549e-1341.18Homeobox protein DLX-5 OS=Rattus norvegicus OX=101... [more]
sp|P70396|DLX5_MOUSE5.653e-1341.18Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN... [more]
sp|Q98877|DLX6A_DANRE6.387e-1335.61Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=d... [more]
sp|P87393|DLX2_ELECQ6.607e-1360.78Homeobox protein DLX-2 (Fragment) OS=Eleutherodact... [more]
sp|P70397|DLX6_MOUSE7.474e-1359.62Homeobox protein DLX-6 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q27W451.675e-1165.45ANTP homeobox protein OS=Trichoplax adhaerens OX=1... [more]
A0A1W6AZH51.686e-1148.65Distal-less OS=Membranipora membranacea OX=95170 G... [more]
G3P6273.171e-1148.45Distal-less homeobox 4b OS=Gasterosteus aculeatus ... [more]
A0A3P9IF173.362e-1156.79Distal-less homeobox 4b OS=Oryzias latipes OX=8090... [more]
A0A3P9MPF03.394e-1156.79Distal-less homeobox 4b OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlx4b6.591e-1439.58homeobox protein Dlx4b-like [Source:NCBI gene;Acc:... [more]
dlx6a1.427e-1359.62distal-less homeobox 6 [Source:NCBI gene;Acc:10302... [more]
dlx1a1.651e-1359.62distal-less homeobox 1 [Source:NCBI gene;Acc:10303... [more]
dlx24.713e-1360.78distal-less homeobox 2 [Source:NCBI gene;Acc:10303... [more]
dlx2b5.494e-1360.78Astyanax mexicanus homeobox protein Dlx2b-like (LO... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlx5a2.492e-1360.78distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
HMX19.521e-1256.25H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
MSX11.350e-1150.98msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
dlx6a1.865e-1055.10distal-less homeobox 6a [Source:NCBI gene;Acc:3058... [more]
ENSPMAT00000001480.11.041e-946.15pep scaffold:Pmarinus_7.0:GL487501:66:2428:-1 gene... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465551.738e-1257.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434022.423e-1252.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MSX6.308e-1252.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324952.179e-1154.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388912.272e-1155.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlx4b1.277e-1456.79homeobox protein Dlx4b [Source:NCBI gene;Acc:10115... [more]
dlx6a1.272e-1359.62distal-less homeobox 6 [Source:NCBI gene;Acc:10115... [more]
dlx1a1.649e-1357.41distal-less homeobox 1 [Source:NCBI gene;Acc:10116... [more]
dlx24.035e-1360.78distal-less homeobox 2 [Source:NCBI gene;Acc:10004... [more]
dlx5a8.640e-1360.78distal-less homeobox 5 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036140.10.000e+0100.00SMESG000036140.1[more]
SMESG000045025.11.822e-1356.36SMESG000045025.1[more]
SMESG000045025.11.856e-1356.36SMESG000045025.1[more]
SMESG000019757.12.174e-1132.00SMESG000019757.1[more]
SMESG000019757.12.242e-1132.00SMESG000019757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010536 ID=SMED30010536|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1329bp
TTAATGCAAGCAAATAATAGCTATGCTTGTTAGTATGTTGAATATTTCAT
CAATTATAATGCTTTTTATTTCGTGAGAATTTCTTTATCAACACCAAAAA
AAATGACAGAATTAATTCACCAAAATCAAACTCTAGACGAAGCTTACCAA
TGCGCTTTGTCTGAAGAAGAATCGACGATGTATGATTATTCCGATCTTAT
AAATGAGCAAACTAATTTCAATTCTGACTGCTATAGGATTCCGTTCACGA
ATTCCGATTGCAGTGATTTTACGACTCACCTCAACATGCAAAATGCTGAA
TACATGCATGATTGGAAAATTTGGAGTCCCTCCTTATCTCTACAAATGTT
ATCAAACGACCATCAAGATCTATTAAAAGTCACTCAACCATTGAATTATG
AAAACGACCTCAATCTATTGCCTCCTCATCCTCCTCCATATATAGGCAAT
GAAATGAAAGTACCAGAAGTTTCTCAATCTTATTATCAATCTATCACCAA
AGCAGACCAAGTAATGACAGATTATAAATCTTTCTACAATACTTGTATGA
TTAATGGCGCATATCAAAAGGAAGATTCACAATTCGATAGATTCCCATAT
TCTACAACTACGGAAGATCCAACAAACTATCAAAGTTCCATATTAGGAAG
TAGTAATCATGGAAAGAAATCCCGAAAACCTCGAACTGTATTTACTAATG
CTCAAATCGAAAGACTACAAGTCGTTTATGATGAGAGAAAATATTTAACT
TTATCAGAAAGAGCTAAATTAGCAGCCTCTCTAGATCTCACTCAAACACA
GGTTAAAATATGGTTTCAAAATCGGAGATCAAAAGAGAAAAAATCACAGA
AAAGTTCTGAAAATTCCGAAGGTGACAAAAATGAAGATGTCGATTCAATT
TCGCAACAGGGAACAAATCAAGTGATTAATGACAAAATGGAGCCATGTGA
AATTCCTCAAATTCAAAACAAGAAAATAATATCTCCAATTATTATGTCCG
CCCAGTCTAATAATAATTATAATGTGAGTGATTCAACTGTTTATACACCA
ACCTTTTATACTCAGTCAATGAACAATCCTTATCATAATCCAACCTCCAA
CGAAAATTTCGAAACTTTTCCTCACAATGAGCCATTAATTATTTACGAAG
ACCCCTTACCCACCCATAACATTGTTCCCAATACTGAAGATTTTCCAGAT
TCTTTCCCGGTTAACAACATTATGGAAAACTGTAAATGATATTATTTATT
TAAAATTGACATTCATGTTTGAAGTTGATGTTGAATTAATATATTATTAT
GAATTTTTAAATTATGAAAATATAATTGC
back to top

protein sequence of SMED30010536-orf-1

>SMED30010536-orf-1 ID=SMED30010536-orf-1|Name=SMED30010536-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MTELIHQNQTLDEAYQCALSEEESTMYDYSDLINEQTNFNSDCYRIPFTN
SDCSDFTTHLNMQNAEYMHDWKIWSPSLSLQMLSNDHQDLLKVTQPLNYE
NDLNLLPPHPPPYIGNEMKVPEVSQSYYQSITKADQVMTDYKSFYNTCMI
NGAYQKEDSQFDRFPYSTTTEDPTNYQSSILGSSNHGKKSRKPRTVFTNA
QIERLQVVYDERKYLTLSERAKLAASLDLTQTQVKIWFQNRRSKEKKSQK
SSENSEGDKNEDVDSISQQGTNQVINDKMEPCEIPQIQNKKIISPIIMSA
QSNNNYNVSDSTVYTPTFYTQSMNNPYHNPTSNENFETFPHNEPLIIYED
PLPTHNIVPNTEDFPDSFPVNNIMENCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000047HTH_motif
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0044212transcription regulatory region DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0001503ossification
GO:0001649osteoblast differentiation
GO:0001958endochondral ossification
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0008283cell proliferation
GO:0045669positive regulation of osteoblast differentiation
GO:0045893positive regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 219..228
score: 46.41
coord: 228..244
score: 63.68
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 212..223
score: 37.35
coord: 237..246
score: 76.51
coord: 227..237
score: 62.6
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 190..252
e-value: 2.2E-23
score: 93.7
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 191..247
e-value: 5.0E-20
score: 71.1
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 188..248
score: 19.904
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 191..242
e-value: 7.15529E-18
score: 74.9724
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 180..263
e-value: 4.6E-24
score: 85.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..263
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..186
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..267
NoneNo IPR availablePANTHERPTHR24327FAMILY NOT NAMEDcoord: 117..337
NoneNo IPR availablePANTHERPTHR24327:SF74HOMEOTIC PROTEIN DISTAL-LESS-RELATEDcoord: 117..337
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 223..246
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 172..250