Cytoplasmic protein NCK1

Overview
NameCytoplasmic protein NCK1
Smed IDSMED30010532
Length (bp)3660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoplasmic protein NCK1 (SMED30010532) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoplasmic protein NCK1 (SMED30010532) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoplasmic protein NCK1 (SMED30010532) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoplasmic protein NCK1 (SMED30010532) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Match: SHF (Src homology 2 domain containing F [Source:HGNC Symbol;Acc:HGNC:25116])

HSP 1 Score: 101.293 bits (251), Expect = 3.494e-23
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  134 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 235          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Match: SHF (Src homology 2 domain containing F [Source:HGNC Symbol;Acc:HGNC:25116])

HSP 1 Score: 96.2857 bits (238), Expect = 3.520e-22
Identity = 44/97 (45.36%), Postives = 66/97 (68.04%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:   63 WYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 159          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Match: SHF (Src homology 2 domain containing F [Source:HGNC Symbol;Acc:HGNC:25116])

HSP 1 Score: 101.679 bits (252), Expect = 5.784e-22
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  318 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 419          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Match: SHB (SH2 domain containing adaptor protein B [Source:HGNC Symbol;Acc:HGNC:10838])

HSP 1 Score: 99.3673 bits (246), Expect = 9.265e-21
Identity = 43/101 (42.57%), Postives = 69/101 (68.32%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR S+TS++D+SL+++ N  F+HMK++K    ++LGQ S P+ ++P ++H+Y+   +P+KGA+ + L  P+ 
Sbjct:  405 LEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVA 505          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Match: SHD (Src homology 2 domain containing transforming protein D [Source:HGNC Symbol;Acc:HGNC:30633])

HSP 1 Score: 89.3521 bits (220), Expect = 3.190e-18
Identity = 43/102 (42.16%), Postives = 65/102 (63.73%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE QPW+H    R  AE LL   KEGS+LVR SET+  D SL+++ +  FLH+K ++      +LGQ+S P+ ++P ++ HYS   +PV+GA+ + L  P+ 
Sbjct:  235 LEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRSSQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVV 336          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 55.4546 bits (132), Expect = 7.974e-8
Identity = 30/102 (29.41%), Postives = 59/102 (57.84%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            +E QPWY    +R++AE LL+  +EG FLVR SE++  D S++++      H K+ +N  G +L   ++ +V +  +++HY+ + +     + + L  P+ +
Sbjct:  187 MEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFKV-QNVDG-LLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 55.4546 bits (132), Expect = 7.974e-8
Identity = 30/102 (29.41%), Postives = 59/102 (57.84%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            +E QPWY    +R++AE LL+  +EG FLVR SE++  D S++++      H K+ +N  G +L   ++ +V +  +++HY+ + +     + + L  P+ +
Sbjct:  187 MEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFKV-QNVDG-LLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 55.4546 bits (132), Expect = 7.974e-8
Identity = 30/102 (29.41%), Postives = 59/102 (57.84%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            +E QPWY    +R++AE LL+  +EG FLVR SE++  D S++++      H K+ +N  G +L   ++ +V +  +++HY+ + +     + + L  P+ +
Sbjct:  187 MEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFKV-QNVDG-LLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 55.8398 bits (133), Expect = 1.051e-7
Identity = 30/102 (29.41%), Postives = 59/102 (57.84%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            +E QPWY    +R++AE LL+  +EG FLVR SE++  D S++++      H K+ +N  G +L   ++ +V +  +++HY+ + +     + + L  P+ +
Sbjct:  296 MEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFKV-QNVDG-LLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 395          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 53.5286 bits (127), Expect = 7.032e-7
Identity = 27/83 (32.53%), Postives = 46/83 (55.42%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGA--KEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHY 2723
            +E QPWY     R  AE+ L+    + G+FLVR SE+ ++D SL+++ N+   H +I +   G       +P+ T+  ++ HY
Sbjct:  119 IESQPWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDLSLSVRENDSVKHYRIRQLDHGGYFIARRRPFATLHDLIAHY 201          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0333156)

HSP 1 Score: 103.605 bits (257), Expect = 5.360e-22
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR +AE  L    EGSFLVR  E+++ D+SL++K    F+HM+I +N  G +ILGQ+S+P+ T+P M+ H+ L  +PV+GA+ + L  P+
Sbjct:  775 LERQGWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMIRHFCLNRLPVRGAEHMCLIEPV 875          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0333154)

HSP 1 Score: 103.99 bits (258), Expect = 7.122e-22
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR +AE  L    EGSFLVR  E+++ D+SL++K    F+HM+I +N  G +ILGQ+S+P+ T+P M+ H+ L  +PV+GA+ + L  P+
Sbjct: 1663 LERQGWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMIRHFCLNRLPVRGAEHMCLIEPV 1763          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0346131)

HSP 1 Score: 103.605 bits (257), Expect = 7.545e-22
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR +AE  L    EGSFLVR  E+++ D+SL++K    F+HM+I +N  G +ILGQ+S+P+ T+P M+ H+ L  +PV+GA+ + L  P+
Sbjct: 1344 LERQGWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMIRHFCLNRLPVRGAEHMCLIEPV 1444          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0333155)

HSP 1 Score: 103.219 bits (256), Expect = 8.947e-22
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR +AE  L    EGSFLVR  E+++ D+SL++K    F+HM+I +N  G +ILGQ+S+P+ T+P M+ H+ L  +PV+GA+ + L  P+
Sbjct: 1405 LERQGWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMIRHFCLNRLPVRGAEHMCLIEPV 1505          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0345369)

HSP 1 Score: 61.6178 bits (148), Expect = 5.824e-9
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSL 2729
            LE   WYH   +R  AE LL     GSFLVR+SE+S    S+++++     H +IS++P G +       + T+  ++HH+S+
Sbjct:  249 LEKHSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRISEDPDGKVFVTQEAKFNTLAELVHHHSV 331          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Match: shda (Src homology 2 domain containing transforming protein D, a [Source:ZFIN;Acc:ZDB-GENE-070912-58])

HSP 1 Score: 101.679 bits (252), Expect = 9.583e-23
Identity = 48/101 (47.52%), Postives = 71/101 (70.30%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR +AE LL   KE S+LVRKS+TSRND+SL+++  + F+HMK S++  G FILG+ S P+ +IP ++H Y+   +P++GA+ + L  P+
Sbjct:  216 LEKQVWYHGALTRSEAESLLTLCKECSYLVRKSQTSRNDYSLSLRSCHGFMHMKFSQSRDGKFILGENSPPFDSIPEVIHFYTTNKLPIRGAEHLSLLFPV 316          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Match: shdb (Src homology 2 domain containing transforming protein D, b [Source:ZFIN;Acc:ZDB-GENE-030131-6059])

HSP 1 Score: 99.3673 bits (246), Expect = 1.790e-21
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SETSR D+SL+++    F+HMK S+   G +ILGQ S P+ TIP ++H+Y+   +P+KGA+ + L  P+
Sbjct:  286 LEKQVWYHGSLSRSEAESLLTLCKECSYLVRNSETSRLDYSLSLRSCQGFMHMKFSQCKDGRYILGQNSPPFETIPEVIHYYTTHKLPIKGAEHLSLLFPV 386          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Match: shdb (Src homology 2 domain containing transforming protein D, b [Source:ZFIN;Acc:ZDB-GENE-030131-6059])

HSP 1 Score: 99.3673 bits (246), Expect = 1.790e-21
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SETSR D+SL+++    F+HMK S+   G +ILGQ S P+ TIP ++H+Y+   +P+KGA+ + L  P+
Sbjct:  286 LEKQVWYHGSLSRSEAESLLTLCKECSYLVRNSETSRLDYSLSLRSCQGFMHMKFSQCKDGRYILGQNSPPFETIPEVIHYYTTHKLPIKGAEHLSLLFPV 386          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Match: zgc:158464 (zgc:158464 [Source:ZFIN;Acc:ZDB-GENE-070112-432])

HSP 1 Score: 95.1301 bits (235), Expect = 1.911e-21
Identity = 46/102 (45.10%), Postives = 68/102 (66.67%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S  + ++P ++H+YS   +P+KGA+ + L  P+ 
Sbjct:  112 LEGQFWYHGAISRTDAEALLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKDSKYVLGQNSCLFDSVPEIIHYYSSRKLPIKGAEHMSLLYPVA 213          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Match: zgc:158464 (zgc:158464 [Source:ZFIN;Acc:ZDB-GENE-070112-432])

HSP 1 Score: 94.7449 bits (234), Expect = 1.924e-20
Identity = 46/102 (45.10%), Postives = 68/102 (66.67%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S  + ++P ++H+YS   +P+KGA+ + L  P+ 
Sbjct:  202 LEGQFWYHGAISRTDAEALLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKDSKYVLGQNSCLFDSVPEIIHYYSSRKLPIKGAEHMSLLYPVA 303          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Match: ENSXETT00000014703.1 (Src homology 2 domain containing adaptor protein B [Source:NCBI gene;Acc:100489262])

HSP 1 Score: 99.7525 bits (247), Expect = 4.277e-21
Identity = 46/100 (46.00%), Postives = 68/100 (68.00%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R  AE LL   KE S+LVR S+TS++DFSL++K +  F+HMK+SK    +ILGQ S P+ ++P ++H Y+   +P+KGA+ + L  P+
Sbjct:  389 LEKQIWYHGAISRTDAENLLRLCKECSYLVRNSQTSKHDFSLSLKSSQGFMHMKLSKTKEKYILGQNSPPFESVPEVVHFYTTRKLPIKGAEHLSLLYPV 488          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Match: shf (Src homology 2 domain containing F [Source:NCBI gene;Acc:100216125])

HSP 1 Score: 94.7449 bits (234), Expect = 2.268e-19
Identity = 44/102 (43.14%), Postives = 67/102 (65.69%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR SET++ DFSL++K +  F+HMK+S+     ++LG  S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  396 LESQFWYHGAISRADAESLLRLCKEASYLVRNSETNKIDFSLSLKSSQGFMHMKLSRTKENKYVLGHNSPPFNSVPEIIHHYASQKLPIKGAEHMSLLYPVA 497          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Match: shf (Src homology 2 domain containing F [Source:NCBI gene;Acc:100216125])

HSP 1 Score: 94.7449 bits (234), Expect = 3.027e-19
Identity = 44/102 (43.14%), Postives = 67/102 (65.69%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR SET++ DFSL++K +  F+HMK+S+     ++LG  S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  449 LESQFWYHGAISRADAESLLRLCKEASYLVRNSETNKIDFSLSLKSSQGFMHMKLSRTKENKYVLGHNSPPFNSVPEIIHHYASQKLPIKGAEHMSLLYPVA 550          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Match: SHE (Src homology 2 domain containing E [Source:NCBI gene;Acc:100490744])

HSP 1 Score: 70.0922 bits (170), Expect = 1.042e-11
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   TR QAE LL    E S+L+R S +  + +S+ +K +   +H+ +++     F L Q    + +IP ++HHYS   +P KG+  + L  P+
Sbjct:  348 LEKQSWYHGSVTRDQAESLLDSCPEASYLLRNSGSGNSKYSIALKTSQGCVHIIVAQTKNNKFTLSQMCGAFNSIPEVVHHYSSQKLPFKGSKHISLLHPV 448          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Match: GRAP2 (GRB2 related adaptor protein 2 [Source:NCBI gene;Acc:100492322])

HSP 1 Score: 59.3066 bits (142), Expect = 4.325e-9
Identity = 24/77 (31.17%), Postives = 52/77 (67.53%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHY 2723
            WY E+ +R +AE +LIG   G+F++R S+TS+ +FS++++  +D  H K+ ++ RG + L  +++ + ++  ++ +Y
Sbjct:   58 WYCENISRGEAESILIGRFVGAFIIRASQTSKGEFSMSVRDEDDVQHFKVMRDIRGNYYL--WTEKFKSLNKLVEYY 132          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Match: Shf (Src homology 2 domain containing F [Source:MGI Symbol;Acc:MGI:3613669])

HSP 1 Score: 106.686 bits (265), Expect = 1.861e-24
Identity = 71/224 (31.70%), Postives = 113/224 (50.45%), Query Frame = 3
Query: 2154 YEEPWDVRHGR----------VISELT---SARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            Y++PW+ +  R          VI +L        +D +  LP  D+  S     +P P     S  F  + N      + K     +PP   +   +S   ++ LG   S       + ++ LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:   99 YDQPWEWKKERISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGSENCLSPGREEKGR---LPPRLSAGNPKS---AKPLGMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 316          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Match: Shf (Src homology 2 domain containing F [Source:MGI Symbol;Acc:MGI:3613669])

HSP 1 Score: 101.679 bits (252), Expect = 1.850e-23
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  127 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 228          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Match: Shf (Src homology 2 domain containing F [Source:MGI Symbol;Acc:MGI:3613669])

HSP 1 Score: 101.293 bits (251), Expect = 2.256e-23
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  133 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 234          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Match: Shf (Src homology 2 domain containing F [Source:MGI Symbol;Acc:MGI:3613669])

HSP 1 Score: 101.293 bits (251), Expect = 2.256e-23
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  133 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 234          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Match: Shf (Src homology 2 domain containing F [Source:MGI Symbol;Acc:MGI:3613669])

HSP 1 Score: 100.908 bits (250), Expect = 9.500e-22
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  341 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 442          
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Match: sp|Q8CG80|SHF_MOUSE (SH2 domain-containing adapter protein F OS=Mus musculus OX=10090 GN=Shf PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 1.578e-22
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  133 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 234          
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Match: sp|Q7M4L6|SHF_HUMAN (SH2 domain-containing adapter protein F OS=Homo sapiens OX=9606 GN=SHF PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.778e-21
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE+Q WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     ++LGQ S P+ ++P ++HHY+   +P+KGA+ + L  P+ 
Sbjct:  318 LENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVA 419          
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Match: sp|Q6PD21|SHB_MOUSE (SH2 domain-containing adapter protein B OS=Mus musculus OX=10090 GN=Shb PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.706e-20
Identity = 44/101 (43.56%), Postives = 69/101 (68.32%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR S+TS++D+SL++K N  F+HMK++K    ++LGQ S P+ ++P ++H+Y+   +P+KGA+ + L  P+ 
Sbjct:  399 LEKQIWYHGAISRSDAENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVA 499          
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Match: sp|Q15464|SHB_HUMAN (SH2 domain-containing adapter protein B OS=Homo sapiens OX=9606 GN=SHB PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 4.449e-20
Identity = 43/101 (42.57%), Postives = 69/101 (68.32%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR S+TS++D+SL+++ N  F+HMK++K    ++LGQ S P+ ++P ++H+Y+   +P+KGA+ + L  P+ 
Sbjct:  405 LEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVA 505          
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Match: sp|O88834|SHD_MOUSE (SH2 domain-containing adapter protein D OS=Mus musculus OX=10090 GN=Shd PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.093e-17
Identity = 43/102 (42.16%), Postives = 65/102 (63.73%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE QPW+H   +R +AE LL   KEGS+LVR SET   D  L+++ N   +H+K ++      +LGQ+S P+ +IP ++ HYS   +PV+GA+ + L  P+T
Sbjct:  220 LEKQPWFHGPLSRAEAENLLSLCKEGSYLVRLSETRAQDCILSLRSNQGSMHLKFARTRENQVVLGQHSGPFPSIPELVLHYSARPLPVQGAEHLALLYPVT 321          
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Match: A0A504YLT2 (SH2 domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_02318 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 3.059e-46
Identity = 194/663 (29.26%), Postives = 289/663 (43.59%), Query Frame = 3
Query:  948 YTNSPKGNTVICHHPSSPFAXXXXXXXXXXXXXXXCIGSAXXXXXXXXXXXXXPKVVVESPDRKLSGSNKNLTANSNI-----VSRRPGR-----FGKS-TPSDVTQSSN-----------KQTPEFSPLQDGQPPVRHSERRSEYYSKQPVYEEAWDLKLRRICKDMVEKSGKSSQCGIERMQDNYSAINSGLPSVPNSIINSFNRPQSAAGARCRTDSPSSKYASPPAVPPHRRNSVHYKLTHGLSFEDPKLFNDQLNTNCQTSQSINDCRTSNFGNDDSIGRALPLKPNLKHNINPSFDDQGLTTDYDYAYNETWSLGVQLNMAFNLTNNDSTNNGPGATNKKDTFTTNN-------SLTAGYMDKIDSVDXXXXXXXXXXXXXXNNYLKD----------KNQNSNENKKQLNLVEDELMSIXXXXXXXXXXXXXXXYEEPWDVRHGRVISELTSARLIDP----------ACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNR--HQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            + ++P+GN+VI HHP+SPFA            P  C  +A+   P+S                  +G N++  + +NI     V   PG+      G S  P ++T S +           K  P   P  DG         R+     QP YEEAWDLK+ R               GI R+   +  +   +P V +S +   +R    A ++  T  P+   +S  +     R         GL F + +LF DQ  T  +   S     T+                                T+YDYAYN +WS+GV+LN+   +  N ++  G G+T    T T+N        S+  G  +K DSV          + +T ++++            +  ++    K+ +     +M+ +   S + DS S DS ++ W+ RHGRV+SELTSAR +DP          AC +    QP S   G       +  SH  +H    NR      +      + P        SV+++  L               + LE+QPW+H+   R +AE+LL    EGSFLVRKSETS ND+SLTIKH   FLHMKIS+N  G +ILG+YSQPY  +P M++HY+ T+VPV+GA++V L  P+
Sbjct:  396 FVDTPRGNSVIVHHPTSPFARVPRGTILPQVTP--CSAAAATSVPTS------------------TGPNQSTESRTNINPTSMVRVSPGQASCADVGNSRAPINITPSVSISGTSGSTIWKKSAPSGGPTGDGN--STGPRVRTNNTDTQPTYEEAWDLKMARQLG-----------FGISRLTPVHVPVT--IPGVLSSTLGPESRLAPVASSKAVTTRPTVSGSSSSSSSSSIRAHGERHQRSGLKFHENRLF-DQHPTKSKNDASCAQTSTA-------------------------------ATEYDYAYNGSWSMGVKLNLCLAM--NGASETGDGSTG--STVTSNPTVLPYRPSVPVGNTNKTDSVHICGPPPQVPAHQTQSSHMNGFAVGPASHGAEIVSTGSRSKRGDPSALNIMTGSVLPSAEVDSTSTDSCDDSWEARHGRVVSELTSARFVDPSSLLLNESTSACPVLSTGQPLSVHVGA------DALSHVVHHTEPSNRTSSSPSASVSHSQITPTGTGGVSPSVNSTLEL---------------LPLEEQPWFHQSLKRLEAEELLRNQPEGSFLVRKSETSPNDYSLTIKHKT-FLHMKISRNAAGQYILGEYSQPYAAVPQMIYHYARTLVPVRGAESVTLTHPV 965          
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Match: A0A564Z2I8 (SH2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11924 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.310e-37
Identity = 95/212 (44.81%), Postives = 127/212 (59.91%), Query Frame = 3
Query: 2157 EEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRH----QTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIP 2777
            EEPWDVRHG+VIS+LTS+R IDP+ VL      ++ + G      N++ S A   N   N H    +     +GV +PP         VS    L  S S      +     L +QPW+H + TR  AE+ L    EGSFLVR SET++N++SLT+KHN  FLHM+I+++ +G F+LG+YSQPY +IPHM+ HY  T VPVKGAD+V L  P
Sbjct:  172 EEPWDVRHGKVISQLTSSRFIDPSEVL------SAVANG------NHNGSSANGGNVYANGHSGVGEGQKNGNGVVIPPAL--GISPPVSCQSPLARSPSNVKVVQVQSLKPLNEQPWFHPNLTRVGAEKRLRLEPEGSFLVRNSETNKNEYSLTVKHNG-FLHMRITRDAQGQFVLGEYSQPYPSIPHMISHYEQTQVPVKGADSVTLCHP 368          
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Match: A0A183AM51 (SH2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8036 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.803e-36
Identity = 94/209 (44.98%), Postives = 127/209 (60.77%), Query Frame = 3
Query: 2166 WDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXX---XXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            W+ RHGRV+SELTSAR +DP+ +    ++PTS+        P +  + A +  R V  H   + +     P    S    SVS     GAS S S +S      + + LE+QPW+H   TR +AE+LL    EGSFLVR SET  ND+SLTIKH   FLHMKIS+N  G +ILG+YSQPY  +P M++HY+ T+VPV+GA++V L  P+
Sbjct:  130 WEARHGRVVSELTSARFVDPSSL--TLNEPTSTGSVRTVGQPLSVLTGADSQQR-VGHHHHHTDTFFTASP----SAPLSSVSQVTPTGASVSPSIHSLIPSSLEMLPLEEQPWFHRSLTRLEAEELLRNQPEGSFLVRNSETCPNDYSLTIKHKT-FLHMKISRNAAGQYILGEYSQPYAAVPQMIYHYARTLVPVRGAESVTLTHPV 330          
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Match: A0A158QFN1 (SH2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9143 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.099e-34
Identity = 94/209 (44.98%), Postives = 126/209 (60.29%), Query Frame = 3
Query: 2157 EEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRH----QTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLL 2768
            EEPWDVRHG+VIS+LTS+R IDP+ VL      ++ + G      N++ S A   N   N H    +     +GV +PP         VS    L  S S      +     L +QPW+H + TR  AE+ L    EGSFLVR SET++N++SLT+KHN  FLHM+I+++ +G F+LG+YSQPY +IPHM+ HY  T VPVKGAD+V L
Sbjct:  558 EEPWDVRHGKVISQLTSSRFIDPSEVL------SAVANG------NHNGSSANGGNVYANGHSGVGEGQKNGNGVVIPPAL--GISPPVSCQSPLARSPSNVKVVQVQSLKPLNEQPWFHPNLTRVGAEKRLRLEPEGSFLVRNSETNKNEYSLTVKHNG-FLHMRITRDAQGQFVLGEYSQPYPSIPHMISHYEQTQVPVKGADSVTL 751          
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Match: A0A0R3VSE6 (SH2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS73 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.652e-34
Identity = 98/210 (46.67%), Postives = 127/210 (60.48%), Query Frame = 3
Query: 2157 EEPWDVRHGRVISELTSARLIDPACVLPV-----HDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLL 2768
            EEPWDVRHG+VIS+LTS+R IDP+ VL       H+  T+S  GG  S  N H     + +RN      D +   V M P   S     +S    L    S S   + N    L +QPW+H + TR  AE+ L    EGSFLVR SET +N++SLT+KHN  FLHM+I+++ +G F+LG+YSQPY +IPHM+ HY  T VPVKGAD+V L
Sbjct:  481 EEPWDVRHGKVISQLTSSRFIDPSEVLSAVANGNHNGATTSVSGGCIS--NGH-----SESRNAAGLVVDGEG-AVPMSPS--SNISPPISCPSPLA--RSPSDIKMQNCLKPLNEQPWFHPNLTRFGAEKRLRSEPEGSFLVRNSETLKNEYSLTVKHNG-FLHMRITRDAQGQFVLGEYSQPYPSIPHMISHYEQTQVPVKGADSVTL 677          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Match: ENSAMXT00000041056.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000346.1:108329:124475:1 gene:ENSAMXG00000033932.1 transcript:ENSAMXT00000041056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.461e-21
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            WYH   +R  AE LL   KE S+LVR SETS+NDFSL++K +  F+HMK+S+     +ILGQ S  + ++P ++H YS   +P+KGA+ + L  P+ 
Sbjct:   11 WYHGAISRTDAESLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKDSKYILGQNSCLFDSVPEIIHFYSSRKLPIKGAEHMSLLYPVA 107          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Match: shdb (SH2 domain-containing adapter protein F-like [Source:NCBI gene;Acc:103027120])

HSP 1 Score: 93.2041 bits (230), Expect = 1.297e-19
Identity = 44/101 (43.56%), Postives = 67/101 (66.34%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R  AE LL   KE S+LVR SET  +++SL+++    F+HMK S++  G +ILGQ S P+ TIP ++H+Y+   +P++GA+ + L  P+
Sbjct:  282 LEKQVWYHGALSRSDAESLLTLCKECSYLVRNSETGHSEYSLSLRSCQGFMHMKFSQSKDGKYILGQNSPPFSTIPEVIHYYTTHKLPIRGAEHLSLLFPV 382          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Match: she (Src homology 2 domain containing E [Source:ZFIN;Acc:ZDB-GENE-090915-6])

HSP 1 Score: 78.9518 bits (193), Expect = 9.443e-15
Identity = 37/103 (35.92%), Postives = 62/103 (60.19%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPR-GFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            LE Q WYH   +RQ+AE  L   +E SFLVR SE++ + +S+ +K +   +H+ +++    G+ L Q S  + +IP ++HHY    +P  GA+ + L+ P+ R
Sbjct:  339 LEKQSWYHGSVSRQEAEAQLQNCREASFLVRDSESATSKYSIALKTSQGCVHIIVAQTKECGYTLDQSSCVFPSIPEVVHHYCTQRLPFTGAEHMTLQHPVPR 441          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Match: shda (Src homology 2 domain containing transforming protein D, a [Source:ZFIN;Acc:ZDB-GENE-070912-58])

HSP 1 Score: 64.6994 bits (156), Expect = 2.625e-10
Identity = 33/65 (50.77%), Postives = 44/65 (67.69%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FIL 2672
            L+ Q WYH   TR  AE LL   KE S+LVR S+TSRND+SL+++  + F+HMK S +  G +IL
Sbjct:  297 LDQQVWYHGALTRSDAESLLTLCKECSYLVRNSQTSRNDYSLSLRSCHGFMHMKFSLSRDGKYIL 361          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Match: grap2a (GRB2-related adapter protein-like [Source:NCBI gene;Acc:103029038])

HSP 1 Score: 59.6918 bits (143), Expect = 5.667e-9
Identity = 25/82 (30.49%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMV 2738
            W+ E+  R  AE+ LI  + G+FL+R  ++SR  FS++++H++D  H K+ K+ +G + L  +S+ + ++  ++ +Y  T +
Sbjct:   58 WFQENTGRTSAEETLISREVGAFLIRGCQSSREGFSISVRHDSDVQHFKVMKDNKGHYYL--WSEKFTSLNKLVDYYKTTSI 137          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Match: SHD (Src homology 2 domain containing transforming protein D [Source:HGNC Symbol;Acc:HGNC:30633])

HSP 1 Score: 69.707 bits (169), Expect = 1.320e-13
Identity = 34/96 (35.42%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            W+H D  R +AEQ+L   +  SFLVR SE+   + SL+++    F+HM++S +  G  +LG  S P+ ++P  +  Y    +PV+GA+ + L  P+
Sbjct:  106 WFHGDIGRVEAEQILQQHRTSSFLVRPSESDPRELSLSLRSAAGFVHMRVSWDQGGHVVLGGNSPPFASVPEAVLFYRGRHLPVRGAEQLSLLHPV 201          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 50.447 bits (119), Expect = 5.729e-7
Identity = 24/58 (41.38%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 2493 PWYHEDCTRQQAEQLLIGAK-EGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG 2663
            PW+     R +AE++L   K +G+FLVR+SE++  DFSL++K  ND  H K+ ++  G
Sbjct:   59 PWFTGKIPRVKAEEMLNRQKFDGAFLVRESESAPGDFSLSVKFGNDVQHFKVLRDGAG 116          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Match: abl1 (c-abl oncogene 1, non-receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-100812-9])

HSP 1 Score: 50.8322 bits (120), Expect = 2.216e-6
Identity = 26/82 (31.71%), Postives = 41/82 (50.00%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYS 2726
            LE   WYH   +R  AE LL     GSFL+R+SE+S    S++++      H +I+    G         + T+  ++HH+S
Sbjct:   97 LEKHSWYHGPISRNAAEYLLSSGINGSFLLRESESSPGQLSISLRCEGRVYHYRINTASDGKYFVSSESRFSTLAELVHHHS 178          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008302.1 (pep scaffold:Pmarinus_7.0:GL479171:25668:32395:1 gene:ENSPMAG00000007513.1 transcript:ENSPMAT00000008302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 2.597e-6
Identity = 26/98 (26.53%), Postives = 53/98 (54.08%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIG-AKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYS--LTMVPVKGADAVLLKIPI 2780
            W+H + +  +AE LL+    +GSFL R S+++  DF+L+++ N +  H+KI      + L    + + T+  ++ +Y+     +  K  D + L+ P+
Sbjct:    6 WFHPNISGIEAEHLLMTRGVDGSFLARPSKSNPGDFTLSVRRNGEVTHIKIQNTGDYYDLYG-GEKFATLAELVQYYTDYQGQLREKNGDIIELRFPL 102          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010807.1 (pep scaffold:Pmarinus_7.0:GL482620:11442:16083:1 gene:ENSPMAG00000009791.1 transcript:ENSPMAT00000010807.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 7.620e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 3
Query: 2496 WYHEDCTRQQAEQLLIG-AKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPV--KGADAVLLKIPI 2780
            W+H   T  QAEQLL+     GSFLVR S ++  DF+L+++  ++  H+KI      + L    + + T+  ++  Y+     +  +  D + L+ P+
Sbjct:    2 WFHPHITGLQAEQLLMTRGVCGSFLVRPSSSNPGDFTLSVRQRDEVRHIKIQNTGDYYDL-YGGEKFATLAELVQFYTENQGQLRERDGDVIELRYPL 98          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Match: shdb (SH2 domain-containing adapter protein D [Source:NCBI gene;Acc:101158013])

HSP 1 Score: 98.2117 bits (243), Expect = 2.150e-21
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SET+R+D+SL+++    F+HMK +K   G F+LGQ S P+ TIP ++H Y+   +P++GA+ + L  P+
Sbjct:  245 LEKQVWYHGSLSRSEAETLLTLCKECSYLVRNSETNRSDYSLSLRSCQGFMHMKFAKCKDGKFVLGQNSPPFDTIPELIHFYTTHKLPIRGAEHLSLLFPV 345          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Match: shdb (SH2 domain-containing adapter protein D [Source:NCBI gene;Acc:101158013])

HSP 1 Score: 98.2117 bits (243), Expect = 3.976e-21
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SET+R+D+SL+++    F+HMK +K   G F+LGQ S P+ TIP ++H Y+   +P++GA+ + L  P+
Sbjct:  288 LEKQVWYHGSLSRSEAETLLTLCKECSYLVRNSETNRSDYSLSLRSCQGFMHMKFAKCKDGKFVLGQNSPPFDTIPELIHFYTTHKLPIRGAEHLSLLFPV 388          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Match: shdb (SH2 domain-containing adapter protein D [Source:NCBI gene;Acc:101158013])

HSP 1 Score: 98.2117 bits (243), Expect = 3.976e-21
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SET+R+D+SL+++    F+HMK +K   G F+LGQ S P+ TIP ++H Y+   +P++GA+ + L  P+
Sbjct:  288 LEKQVWYHGSLSRSEAETLLTLCKECSYLVRNSETNRSDYSLSLRSCQGFMHMKFAKCKDGKFVLGQNSPPFDTIPELIHFYTTHKLPIRGAEHLSLLFPV 388          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Match: shdb (SH2 domain-containing adapter protein D [Source:NCBI gene;Acc:101158013])

HSP 1 Score: 98.2117 bits (243), Expect = 5.367e-21
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPI 2780
            LE Q WYH   +R +AE LL   KE S+LVR SET+R+D+SL+++    F+HMK +K   G F+LGQ S P+ TIP ++H Y+   +P++GA+ + L  P+
Sbjct:  314 LEKQVWYHGSLSRSEAETLLTLCKECSYLVRNSETNRSDYSLSLRSCQGFMHMKFAKCKDGKFVLGQNSPPFDTIPELIHFYTTHKLPIRGAEHLSLLFPV 414          
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Match: SHF (Src homology 2 domain containing F [Source:NCBI gene;Acc:101169774])

HSP 1 Score: 97.0561 bits (240), Expect = 8.221e-21
Identity = 47/102 (46.08%), Postives = 68/102 (66.67%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPIT 2783
            LE Q WYH   +R  AE LL   KE S+LVR SETS+ND+SL++K +  F+HMK+S+     +ILGQ S P+ ++P ++H YS   +P+KGA+ + L  P+ 
Sbjct:  275 LESQFWYHGAISRTDAESLLRLCKEASYLVRNSETSKNDYSLSLKSSQGFMHMKLSRTKENKYILGQNSCPFDSVPDIIHFYSSRKLPIKGAEHMSLLYPVA 376          
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Match: SMESG000003425.1 (SMESG000003425.1)

HSP 1 Score: 1670.21 bits (4324), Expect = 0.000e+0
Identity = 919/920 (99.89%), Postives = 919/920 (99.89%), Query Frame = 3
Query:   27 MPLKIXXXXXXXXXELIHTHSCPDDSVTHTKKNRGLRRLFDRAKYXXXXXXXXXXXXXNTKSPQYTNKLSDAGSNLTSLDSSPKSQQTNTCHSVSPKLYTSSCASSIEELSKVALNSNGINTGVSSSAIPCSPIQDVILEEDYEEALLVTNKTQSSLANEPESTAKDGGTQPVTLSSVKFNQGIYNEPKDTAKGLNKEIIETCRLSQITPTNQFKEIRSRSGSDTDPLIVHPELGVGGRCSTNSSSVGSALTLSESPAVVPQSCSPQNQSITLQGLPTVPTAVPPSTIALSINVHTTLQTSSGPPTVYTNSPKGNTVICHHPSSPFAXXXXXXXXXXXXXXXCIGSAXXXXXXXXXXXXXPKVVVESPDRKLSGSNKNLTANSNIVSRRPGRFGKSTPSDVTQSSNKQTPEFSPLQDGQPPVRHSERRSEYYSKQPVYEEAWDLKLRRICKDMVEKSGKSSQCGIERMQDNYSAINSGLPSVPNSIINSFNRPQSAAGARCRTDSPSSKYASPPAVPPHRRNSVHYKLTHGLSFEDPKLFNDQLNTNCQTSQSINDCRTSNFGNDDSIGRALPLKPNLKHNINPSFDDQGLTTDYDYAYNETWSLGVQLNMAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDXXXXXXXXXXXXXXNNYLKDKNQNSNENKKQLNLVEDELMSIXXXXXXXXXXXXXXXYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            MPLKIGKSKSSSGSELIHTHSCPDDSVTHTKKNRGLRRLFDRAKYSSSASKVSTSENSNTKSPQYTNKLSDAGSNLTSLDSSPKSQQTNTCHSVSPKLYTSSCASSIEELSKVALNSNGINTGVSSSAIPCSPIQDVILEEDYEEALLVTNKTQSSLANEPESTAKDGGT PVTLSSVKFNQGIYNEPKDTAKGLNKEIIETCRLSQITPTNQFKEIRSRSGSDTDPLIVHPELGVGGRCSTNSSSVGSALTLSESPAVVPQSCSPQNQSITLQGLPTVPTAVPPSTIALSINVHTTLQTSSGPPTVYTNSPKGNTVICHHPSSPFAPPTNSKPNSSSNPTSCIGSASNHSPSSDRLSSSPKVVVESPDRKLSGSNKNLTANSNIVSRRPGRFGKSTPSDVTQSSNKQTPEFSPLQDGQPPVRHSERRSEYYSKQPVYEEAWDLKLRRICKDMVEKSGKSSQCGIERMQDNYSAINSGLPSVPNSIINSFNRPQSAAGARCRTDSPSSKYASPPAVPPHRRNSVHYKLTHGLSFEDPKLFNDQLNTNCQTSQSINDCRTSNFGNDDSIGRALPLKPNLKHNINPSFDDQGLTTDYDYAYNETWSLGVQLNMAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDSEESSSLSTSQETSNNYLKDKNQNSNENKKQLNLVEDELMSITNTTSNDNDSLSNDSYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGASGSISSNSIINKSINLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR
Sbjct:    1 MPLKIGKSKSSSGSELIHTHSCPDDSVTHTKKNRGLRRLFDRAKYSSSASKVSTSENSNTKSPQYTNKLSDAGSNLTSLDSSPKSQQTNTCHSVSPKLYTSSCASSIEELSKVALNSNGINTGVSSSAIPCSPIQDVILEEDYEEALLVTNKTQSSLANEPESTAKDGGTPPVTLSSVKFNQGIYNEPKDTAKGLNKEIIETCRLSQITPTNQFKEIRSRSGSDTDPLIVHPELGVGGRCSTNSSSVGSALTLSESPAVVPQSCSPQNQSITLQGLPTVPTAVPPSTIALSINVHTTLQTSSGPPTVYTNSPKGNTVICHHPSSPFAPPTNSKPNSSSNPTSCIGSASNHSPSSDRLSSSPKVVVESPDRKLSGSNKNLTANSNIVSRRPGRFGKSTPSDVTQSSNKQTPEFSPLQDGQPPVRHSERRSEYYSKQPVYEEAWDLKLRRICKDMVEKSGKSSQCGIERMQDNYSAINSGLPSVPNSIINSFNRPQSAAGARCRTDSPSSKYASPPAVPPHRRNSVHYKLTHGLSFEDPKLFNDQLNTNCQTSQSINDCRTSNFGNDDSIGRALPLKPNLKHNINPSFDDQGLTTDYDYAYNETWSLGVQLNMAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDSEESSSLSTSQETSNNYLKDKNQNSNENKKQLNLVEDELMSITNTTSNDNDSLSNDSYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGASGSISSNSIINKSINLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 920          
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Match: SMESG000003425.1 (SMESG000003425.1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 310/310 (100.00%), Postives = 310/310 (100.00%), Query Frame = 3
Query: 1857 MAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDXXXXXXXXXXXXXXNNYLKDKNQNSNENKKQLNLVEDELMSIXXXXXXXXXXXXXXXYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            MAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDSEESSSLSTSQETSNNYLKDKNQNSNENKKQLNLVEDELMSITNTTSNDNDSLSNDSYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGASGSISSNSIINKSINLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR
Sbjct:    1 MAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDSVDSEESSSLSTSQETSNNYLKDKNQNSNENKKQLNLVEDELMSITNTTSNDNDSLSNDSYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRRLGASGSISSNSIINKSINLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 310          
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Match: SMESG000026235.1 (SMESG000026235.1)

HSP 1 Score: 162.155 bits (409), Expect = 3.234e-41
Identity = 88/212 (41.51%), Postives = 128/212 (60.38%), Query Frame = 3
Query: 2160 EPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNR---HQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            EPWDV HGR   ++ + R IDP+ +        ++++  +   P++ +S   ++N + NR     TDSK           S ++  ++ + ++                 LE QPWYH   TR +AE LL    +GSFLVR+SE+++N +SLTIKHN +FLHMKI+KN +GF+LG+YSQPY +IPHML+HY LTMVPVKGADA  L+  +T+
Sbjct:  424 EPWDVIHGRFYKDVIATRFIDPSII--------NNNKPPLTKLPSSEESKVTSNNTSRNRTVNSNTDSKVIK-------ESLKRVHININPKVP----------------LEKQPWYHFYLTRSKAESLLSNHPDGSFLVRRSESNKNAYSLTIKHNGNFLHMKITKNHKGFVLGEYSQPYQSIPHMLYHYCLTMVPVKGADAASLRFAVTK 604          
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Match: SMESG000026235.1 (SMESG000026235.1)

HSP 1 Score: 162.155 bits (409), Expect = 3.329e-41
Identity = 88/212 (41.51%), Postives = 128/212 (60.38%), Query Frame = 3
Query: 2160 EPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGGIPSPPNNHKSHAFNHNRNVNR---HQTDSKSHGVNMPPHTHSKRQRSVSASRRLGAXXXXXXXXXXXXXXXLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            EPWDV HGR   ++ + R IDP+ +        ++++  +   P++ +S   ++N + NR     TDSK           S ++  ++ + ++                 LE QPWYH   TR +AE LL    +GSFLVR+SE+++N +SLTIKHN +FLHMKI+KN +GF+LG+YSQPY +IPHML+HY LTMVPVKGADA  L+  +T+
Sbjct:  427 EPWDVIHGRFYKDVIATRFIDPSII--------NNNKPPLTKLPSSEESKVTSNNTSRNRTVNSNTDSKVIK-------ESLKRVHININPKVP----------------LEKQPWYHFYLTRSKAESLLSNHPDGSFLVRRSESNKNAYSLTIKHNGNFLHMKITKNHKGFVLGEYSQPYQSIPHMLYHYCLTMVPVKGADAASLRFAVTK 607          
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Match: SMESG000060606.1 (SMESG000060606.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.028e-25
Identity = 53/103 (51.46%), Postives = 75/103 (72.82%), Query Frame = 3
Query: 2481 LEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRKSETSRNDFSLTIKHNNDFLHMKISKNPRG-FILGQYSQPYVTIPHMLHHYSLTMVPVKGADAVLLKIPITR 2786
            LE+  W+H   +R  AE LL    EGSFLVR+SE+S N++SL+I++   +LHMKIS++  G F+LGQYSQPY +IP M+ HYS + +PVKGA+ + L+ P+ R
Sbjct:  375 LEEHLWFHPHLSRVGAELLLSKYPEGSFLVRRSESSINEYSLSIRYKQKWLHMKISRDQDGQFVLGQYSQPYPSIPIMIRHYSCSFLPVKGANLISLQQPVFR 477          
The following BLAST results are available for this feature:
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHF3.494e-2346.08Src homology 2 domain containing F [Source:HGNC Sy... [more]
SHF3.520e-2245.36Src homology 2 domain containing F [Source:HGNC Sy... [more]
SHF5.784e-2246.08Src homology 2 domain containing F [Source:HGNC Sy... [more]
SHB9.265e-2142.57SH2 domain containing adaptor protein B [Source:HG... [more]
SHD3.190e-1842.16Src homology 2 domain containing transforming prot... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nck-17.974e-829.41NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-17.974e-829.41NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-17.974e-829.41NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-11.051e-729.41NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
src-27.032e-732.53Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hwt5.360e-2245.54gene:FBgn0264542 transcript:FBtr0333156[more]
hwt7.122e-2245.54gene:FBgn0264542 transcript:FBtr0333154[more]
hwt7.545e-2245.54gene:FBgn0264542 transcript:FBtr0346131[more]
hwt8.947e-2245.54gene:FBgn0264542 transcript:FBtr0333155[more]
Abl5.824e-934.94gene:FBgn0000017 transcript:FBtr0345369[more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shda9.583e-2347.52Src homology 2 domain containing transforming prot... [more]
shdb1.790e-2147.52Src homology 2 domain containing transforming prot... [more]
shdb1.790e-2147.52Src homology 2 domain containing transforming prot... [more]
zgc:1584641.911e-2145.10zgc:158464 [Source:ZFIN;Acc:ZDB-GENE-070112-432][more]
zgc:1584641.924e-2045.10zgc:158464 [Source:ZFIN;Acc:ZDB-GENE-070112-432][more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000014703.14.277e-2146.00Src homology 2 domain containing adaptor protein B... [more]
shf2.268e-1943.14Src homology 2 domain containing F [Source:NCBI ge... [more]
shf3.027e-1943.14Src homology 2 domain containing F [Source:NCBI ge... [more]
SHE1.042e-1134.65Src homology 2 domain containing E [Source:NCBI ge... [more]
GRAP24.325e-931.17GRB2 related adaptor protein 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shf1.861e-2431.70Src homology 2 domain containing F [Source:MGI Sym... [more]
Shf1.850e-2346.08Src homology 2 domain containing F [Source:MGI Sym... [more]
Shf2.256e-2346.08Src homology 2 domain containing F [Source:MGI Sym... [more]
Shf2.256e-2346.08Src homology 2 domain containing F [Source:MGI Sym... [more]
Shf9.500e-2246.08Src homology 2 domain containing F [Source:MGI Sym... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CG80|SHF_MOUSE1.578e-2246.08SH2 domain-containing adapter protein F OS=Mus mus... [more]
sp|Q7M4L6|SHF_HUMAN2.778e-2146.08SH2 domain-containing adapter protein F OS=Homo sa... [more]
sp|Q6PD21|SHB_MOUSE1.706e-2043.56SH2 domain-containing adapter protein B OS=Mus mus... [more]
sp|Q15464|SHB_HUMAN4.449e-2042.57SH2 domain-containing adapter protein B OS=Homo sa... [more]
sp|O88834|SHD_MOUSE1.093e-1742.16SH2 domain-containing adapter protein D OS=Mus mus... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YLT23.059e-4629.26SH2 domain-containing protein OS=Fasciola gigantic... [more]
A0A564Z2I85.310e-3744.81SH2 domain-containing protein OS=Hymenolepis dimin... [more]
A0A183AM516.803e-3644.98SH2 domain-containing protein OS=Echinostoma capro... [more]
A0A158QFN11.099e-3444.98SH2 domain-containing protein OS=Hymenolepis dimin... [more]
A0A0R3VSE62.652e-3446.67SH2 domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000041056.13.461e-2145.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
shdb1.297e-1943.56SH2 domain-containing adapter protein F-like [Sour... [more]
she9.443e-1535.92Src homology 2 domain containing E [Source:ZFIN;Ac... [more]
shda2.625e-1050.77Src homology 2 domain containing transforming prot... [more]
grap2a5.667e-930.49GRB2-related adapter protein-like [Source:NCBI gen... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHD1.320e-1335.42Src homology 2 domain containing transforming prot... [more]
grb2a5.729e-741.38growth factor receptor-bound protein 2a [Source:ZF... [more]
abl12.216e-631.71c-abl oncogene 1, non-receptor tyrosine kinase [So... [more]
ENSPMAT00000008302.12.597e-626.53pep scaffold:Pmarinus_7.0:GL479171:25668:32395:1 g... [more]
ENSPMAT00000010807.17.620e-628.57pep scaffold:Pmarinus_7.0:GL482620:11442:16083:1 g... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytoplasmic protein NCK1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shdb2.150e-2145.54SH2 domain-containing adapter protein D [Source:NC... [more]
shdb3.976e-2145.54SH2 domain-containing adapter protein D [Source:NC... [more]
shdb3.976e-2145.54SH2 domain-containing adapter protein D [Source:NC... [more]
shdb5.367e-2145.54SH2 domain-containing adapter protein D [Source:NC... [more]
SHF8.221e-2146.08Src homology 2 domain containing F [Source:NCBI ge... [more]
back to top
BLAST of Cytoplasmic protein NCK1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003425.10.000e+099.89SMESG000003425.1[more]
SMESG000003425.10.000e+0100.00SMESG000003425.1[more]
SMESG000026235.13.234e-4141.51SMESG000026235.1[more]
SMESG000026235.13.329e-4141.51SMESG000026235.1[more]
SMESG000060606.11.028e-2551.46SMESG000060606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010532 ID=SMED30010532|Name=Cytoplasmic protein NCK1|organism=Schmidtea mediterranea sexual|type=transcript|length=3660bp
TCTATATAAATCTTATATGATTTACTATGCCACTGAAAATTGGTAAGTCT
AAATCTTCAAGTGGATCCGAATTGATACATACTCATTCATGTCCTGATGA
TTCAGTAACGCATACAAAAAAAAATCGTGGCCTAAGAAGATTATTTGATC
GCGCCAAATATTCATCATCGGCATCAAAAGTTTCAACCAGTGAAAATAGT
AACACAAAAAGTCCACAATATACAAACAAATTATCTGATGCAGGGTCTAA
TTTAACTTCATTAGATTCATCTCCTAAAAGTCAACAAACTAATACCTGCC
ATTCAGTGAGTCCAAAACTATATACTAGTTCTTGCGCATCATCTATTGAA
GAATTATCAAAAGTTGCTTTGAATTCAAATGGAATTAATACTGGAGTTTC
TTCTTCTGCTATTCCATGCAGCCCTATTCAAGATGTGATTCTGGAAGAAG
ATTATGAAGAAGCTCTATTGGTAACAAATAAAACCCAATCATCACTTGCA
AATGAACCCGAGTCGACTGCAAAAGACGGGGGTACACAACCGGTAACTTT
GTCTTCTGTGAAATTCAATCAGGGAATATACAACGAACCAAAGGATACTG
CCAAAGGATTAAATAAAGAAATTATTGAAACCTGCCGCCTTAGTCAAATT
ACTCCAACCAATCAATTCAAAGAAATTCGATCAAGATCTGGAAGTGATAC
TGATCCATTGATAGTTCATCCTGAACTTGGAGTTGGAGGCCGATGCTCAA
CAAATTCATCTTCAGTGGGAAGTGCATTAACGCTTTCAGAAAGTCCGGCT
GTTGTGCCACAATCATGCTCACCTCAAAATCAGTCAATTACATTGCAGGG
TCTCCCTACTGTTCCAACGGCTGTGCCACCTTCAACGATTGCTTTAAGTA
TCAATGTTCATACAACTCTTCAAACTTCATCAGGACCTCCAACTGTTTAT
ACGAATAGCCCAAAAGGGAACACAGTAATATGCCATCATCCTTCTAGTCC
ATTTGCACCACCGACAAATTCAAAGCCAAATAGCTCATCTAATCCCACGT
CATGTATTGGTTCAGCTTCTAATCATTCACCATCTTCAGACCGATTGTCA
TCTTCCCCAAAAGTGGTTGTCGAAAGTCCCGATCGAAAACTGTCAGGCTC
AAACAAGAATTTGACTGCTAATTCTAATATTGTTTCTCGTCGACCCGGAA
GGTTTGGCAAATCAACTCCCAGCGATGTTACTCAGTCATCAAACAAACAA
ACCCCAGAATTCAGTCCACTTCAAGATGGTCAGCCGCCAGTGAGACATTC
TGAAAGACGTTCCGAATACTACAGTAAGCAGCCAGTTTACGAAGAAGCTT
GGGATCTGAAATTGAGAAGAATATGTAAAGATATGGTTGAAAAATCTGGC
AAGTCATCGCAGTGTGGAATTGAAAGAATGCAAGATAATTATTCAGCAAT
TAATAGCGGGTTACCATCAGTTCCAAACAGTATCATCAATTCTTTTAATC
GGCCTCAAAGCGCAGCTGGAGCCAGGTGTAGAACTGACAGTCCTAGCTCA
AAGTATGCATCTCCTCCAGCTGTTCCACCTCATCGGCGAAACTCAGTCCA
TTATAAACTTACTCACGGACTTTCATTTGAAGATCCAAAATTGTTCAACG
ATCAATTGAATACAAATTGTCAAACAAGCCAATCCATCAATGATTGTAGG
ACATCTAATTTCGGAAATGACGACTCGATTGGACGCGCTCTTCCTTTAAA
GCCTAATTTGAAACACAATATCAATCCTTCATTTGATGATCAGGGCCTTA
CGACAGATTATGATTATGCGTACAACGAAACCTGGAGCCTAGGAGTTCAA
TTAAATATGGCTTTCAATCTGACTAACAACGATTCTACCAATAATGGACC
CGGGGCTACAAACAAAAAGGATACATTTACAACGAATAATTCTCTAACTG
CCGGATACATGGATAAAATTGATTCTGTTGATTCAGAAGAGTCGTCCTCT
TTATCAACCAGTCAAGAAACATCGAATAATTATCTTAAGGATAAAAACCA
AAACTCAAATGAAAATAAGAAACAGTTGAATCTTGTTGAAGATGAATTAA
TGTCAATCACAAATACTACTAGCAATGACAATGACAGTTTATCAAATGAC
AGCTATGAGGAACCTTGGGATGTTCGACATGGGCGCGTTATATCCGAGTT
AACAAGTGCCAGACTGATCGATCCAGCATGTGTTTTGCCTGTTCACGATC
AACCGACAAGTTCATCAAGAGGAGGAATTCCGTCTCCACCGAATAACCAT
AAGAGTCATGCCTTTAATCACAATCGCAATGTAAATCGACATCAAACCGA
TTCGAAATCTCATGGTGTAAATATGCCACCTCACACTCATTCAAAACGCC
AAAGAAGTGTAAGTGCTAGTCGGCGCCTTGGAGCCAGTGGTTCAATATCA
TCTAATTCAATTATTAATAAGTCTATTAATCTCGAGGATCAACCATGGTA
TCACGAGGACTGTACAAGACAACAAGCCGAACAGTTACTAATTGGTGCAA
AAGAAGGAAGTTTTCTTGTTCGGAAAAGTGAAACGAGTCGAAATGACTTC
TCATTGACAATCAAACACAACAACGATTTCTTGCACATGAAAATCTCGAA
AAACCCGAGAGGATTTATTCTCGGTCAATACAGTCAGCCGTATGTTACCA
TTCCTCACATGTTACACCATTACAGTTTAACAATGGTACCGGTCAAAGGT
GCCGATGCAGTCCTATTAAAAATCCCAATCACGCGTTGAAATCAATCAAA
CAATCAATAATAATAAATTCGCATTTTTTTTACATCACTGCTCTCATTGA
ATGGATTTTTTGTTGATTTCTCTTAATCGTCCAATGAGATTGATTGTTTC
GATTATATGTTTGATAGAGGCATAATTTGATTTGTTGTTAGTCCGTGTTG
AATAATTTGAATAACGTGTGTAAATTAGTGTTTATCATTCGCTGCTTTTG
TTGTTTATTGGGCAATCGATAACGTATTGATGAGTTCGGCACATTTTAGT
TGCTATTACTTGTTGTTATCGATTATATATATAAATATAATTTTCACACT
TCGATAGACCAATCAGAGCGGCGTAGCAGCGTTCGATTGGGTTTTCGTGT
CACTATTCGTTTGCCCGAGTTGTTTGTTTAAAACGATTAAATGTTCACCG
GCACAGAAAATATACTCAATTGCCGCGGATCAATACGATATTTTTATAGC
TTTTCATCAATTTCCGGTTTTTAAATGAAAATCAATAAATTGTCTTCGCT
TTTTTGTCGTTTAGTTTTGTTGAGTTTGTTGGATTTCAATCATGGATCAA
TGATTGATAATGTTTCCTGTGGGCGTTACCGGGCTTTGAGGTTGGAGCTA
AGATTATTAAGTGATTTCGGCAGGTTACGGATTAAAATTCATGCATTTAT
ATTTTGACATGTTTCCAATATGGGTAAGCTAGGGATAAATACTGCGAGTT
AGCCAAGATTCAGCACTTAAAACTCAAAACTTTGGACTTATTGTGTCATA
CAGTGATTAATACTCGAAAAACTGGTTTTATCAAACTTCACTATCCGTAT
CAATCGAATGGTTATTTAAAATTCTGTTTGCTTTCTTTTACATGTAATAA
TATTTTATCG
back to top

protein sequence of SMED30010532-orf-1

>SMED30010532-orf-1 ID=SMED30010532-orf-1|Name=SMED30010532-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=921bp
MPLKIGKSKSSSGSELIHTHSCPDDSVTHTKKNRGLRRLFDRAKYSSSAS
KVSTSENSNTKSPQYTNKLSDAGSNLTSLDSSPKSQQTNTCHSVSPKLYT
SSCASSIEELSKVALNSNGINTGVSSSAIPCSPIQDVILEEDYEEALLVT
NKTQSSLANEPESTAKDGGTQPVTLSSVKFNQGIYNEPKDTAKGLNKEII
ETCRLSQITPTNQFKEIRSRSGSDTDPLIVHPELGVGGRCSTNSSSVGSA
LTLSESPAVVPQSCSPQNQSITLQGLPTVPTAVPPSTIALSINVHTTLQT
SSGPPTVYTNSPKGNTVICHHPSSPFAPPTNSKPNSSSNPTSCIGSASNH
SPSSDRLSSSPKVVVESPDRKLSGSNKNLTANSNIVSRRPGRFGKSTPSD
VTQSSNKQTPEFSPLQDGQPPVRHSERRSEYYSKQPVYEEAWDLKLRRIC
KDMVEKSGKSSQCGIERMQDNYSAINSGLPSVPNSIINSFNRPQSAAGAR
CRTDSPSSKYASPPAVPPHRRNSVHYKLTHGLSFEDPKLFNDQLNTNCQT
SQSINDCRTSNFGNDDSIGRALPLKPNLKHNINPSFDDQGLTTDYDYAYN
ETWSLGVQLNMAFNLTNNDSTNNGPGATNKKDTFTTNNSLTAGYMDKIDS
VDSEESSSLSTSQETSNNYLKDKNQNSNENKKQLNLVEDELMSITNTTSN
DNDSLSNDSYEEPWDVRHGRVISELTSARLIDPACVLPVHDQPTSSSRGG
IPSPPNNHKSHAFNHNRNVNRHQTDSKSHGVNMPPHTHSKRQRSVSASRR
LGASGSISSNSIINKSINLEDQPWYHEDCTRQQAEQLLIGAKEGSFLVRK
SETSRNDFSLTIKHNNDFLHMKISKNPRGFILGQYSQPYVTIPHMLHHYS
LTMVPVKGADAVLLKIPITR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
Vocabulary: molecular function
TermDefinition
GO:0005070SH3/SH2 adaptor activity
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0009967positive regulation of signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 672..692
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 328..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 777..806
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 774..806
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..512
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 656..676
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 76..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 332..363
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 373..417
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..520
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 652..681
NoneNo IPR availablePANTHERPTHR15127FAMILY NOT NAMEDcoord: 69..920
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 826..840
score: 43.42
coord: 845..855
score: 61.84
coord: 857..868
score: 17.95
coord: 890..904
score: 17.7
IPR000980SH2 domainSMARTSM00252SH2_5coord: 824..907
e-value: 3.2E-24
score: 96.5
IPR000980SH2 domainPFAMPF00017SH2coord: 826..901
e-value: 1.6E-16
score: 60.1
IPR000980SH2 domainPROSITEPS50001SH2coord: 826..920
score: 17.463
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 808..922
e-value: 7.3E-25
score: 89.3
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 799..920