SMED30010528

Overview
NameSMED30010528
Smed IDSMED30010528
Length (bp)2125
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010528 (SMED30010528) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010528 (SMED30010528) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010528

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30010528h1SMcG0019657 Contig45929newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010528h1SMcG0019657 Contig45929uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30010528h1SMcG0019657 dd_Smed_v4_1473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010528h1SMcG0019657 dd_Smed_v4_1473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010528h1SMcG0019657 dd_Smed_v4_1473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010528h1SMcG0019657 dd_Smed_v4_1473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010528h1SMcG0019657 dd_Smed_v4_1473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010528h1SMcG0019657 Contig37481newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010528h1SMcG0019657 Contig37481uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30010528h1SMcG0019657 dd_Smed_v6_1754_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010528h1SMcG0019657 dd_Smed_v6_1473_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30010528h1SMcG0019657 dd_Smed_v4_1754_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010528 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002992:21444..25096 +9994
Homology
BLAST of SMED30010528 vs. Planmine SMEST
Match: SMESG000014705.1 (SMESG000014705.1)

HSP 1 Score: 1229.54 bits (3180), Expect = 0.000e+0
Identity = 626/634 (98.74%), Postives = 629/634 (99.21%), Query Frame = 3
Query:  174 MMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARXXXXXXXXXXXXXXXXXXFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAIENGRVKDIFNKLLNEIPMLKQKMNNYSKEDAKYEGSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNKHSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQE 2075
            MMLKNFILTLGGFLVLPLVTLANQ FIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVI+NYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVKLSFT FHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSE+VNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRS LSDSEWIFNCSAR+KLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSK YVSTELSKLKRQFAIENGRVKDIFNKLLNEIPMLKQKMNNYSKEDAKYEGSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNKHSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSV FTRVELNRLGLLYGNTIKINCDVQE
Sbjct:    1 MMLKNFILTLGGFLVLPLVTLANQRFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIKNYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVKLSFTSFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEMVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSSLSDSEWIFNCSARYKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKKYVSTELSKLKRQFAIENGRVKDIFNKLLNEIPMLKQKMNNYSKEDAKYEGSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNKHSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVKFTRVELNRLGLLYGNTIKINCDVQE 634          
BLAST of SMED30010528 vs. Planmine SMEST
Match: SMESG000014711.1 (SMESG000014711.1)

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 495/663 (74.66%), Postives = 558/663 (84.16%), Query Frame = 3
Query:  156 MSFFLKMMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARXXXXXXXXXXXXXXXXXXFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAI---ENGRVKDIFNKLLNEIPMLKQKMNNYS------KEDAKYE-------------GSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNK-HSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQE 2075
            M+FFLKMMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVI+NYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKV+LSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSE+VNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINV+YAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSAR+KLNNSDGIYHKSVKFMSEG++I ILD+ N+ET I IK+ + K Y+ + ++++         EN ++     +LLNEI MLK  M NYS      KE+ KYE              S+IS N+ D  +   EFQKLKEDVIKQNDDISGLKLKTE I+M+L  ++T+++ + + +KA   ++E   + I F   HLFW+VPI+  V  ID+++    KE  ++ FYTQIKNY+L+L++ FTP  IE+Y+YL  +RRNK + +PFKSQITI+VVHKLLP++ LDR I S I T PG+S +++FTR ELN+LG L  N I I CDV+E
Sbjct:    1 MTFFLKMMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIKNYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVELSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEMVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVIYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARYKLNNSDGIYHKSVKFMSEGDKITILDIDNIETMIIIKVSEMKRYIDSHMNRMANNLNFMLKENAKMNQTNKELLNEISMLKNIMKNYSVNAKELKENIKYEIGKMNITYKKLVSKSEISTNL-DSGVPKMEFQKLKEDVIKQNDDISGLKLKTEFIEMDLKTEKTLSKIVQQAIKAMIKSNEALKSQIAFTKFHLFWIVPITWTVTGIDVDESVKKKEATNDPFYTQIKNYKLHLYASFTPTKIEYYLYLYDNRRNKRNGIPFKSQITISVVHKLLPNVKLDRTIYSKIYTIPGVSKTISFTRTELNKLGFLEENRITIICDVKE 662          
BLAST of SMED30010528 vs. Planmine SMEST
Match: SMESG000014711.1 (SMESG000014711.1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 490/657 (74.58%), Postives = 552/657 (84.02%), Query Frame = 3
Query:  174 MMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARXXXXXXXXXXXXXXXXXXFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAI---ENGRVKDIFNKLLNEIPMLKQKMNNYS------KEDAKYE-------------GSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNK-HSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQE 2075
            MMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVI+NYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKV+LSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSE+VNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINV+YAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSAR+KLNNSDGIYHKSVKFMSEG++I ILD+ N+ET I IK+ + K Y+ + ++++         EN ++     +LLNEI MLK  M NYS      KE+ KYE              S+IS N+ D  +   EFQKLKEDVIKQNDDISGLKLKTE I+M+L  ++T+++ + + +KA   ++E   + I F   HLFW+VPI+  V  ID+++    KE  ++ FYTQIKNY+L+L++ FTP  IE+Y+YL  +RRNK + +PFKSQITI+VVHKLLP++ LDR I S I T PG+S +++FTR ELN+LG L  N I I CDV+E
Sbjct:    1 MMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIKNYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVELSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEMVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVIYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARYKLNNSDGIYHKSVKFMSEGDKITILDIDNIETMIIIKVSEMKRYIDSHMNRMANNLNFMLKENAKMNQTNKELLNEISMLKNIMKNYSVNAKELKENIKYEIGKMNITYKKLVSKSEISTNL-DSGVPKMEFQKLKEDVIKQNDDISGLKLKTEFIEMDLKTEKTLSKIVQQAIKAMIKSNEALKSQIAFTKFHLFWIVPITWTVTGIDVDESVKKKEATNDPFYTQIKNYKLHLYASFTPTKIEYYLYLYDNRRNKRNGIPFKSQITISVVHKLLPNVKLDRTIYSKIYTIPGVSKTISFTRTELNKLGFLEENRITIICDVKE 656          
BLAST of SMED30010528 vs. Planmine SMEST
Match: SMESG000014711.1 (SMESG000014711.1)

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 466/633 (73.62%), Postives = 528/633 (83.41%), Query Frame = 3
Query:  246 MFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARXXXXXXXXXXXXXXXXXXFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAI---ENGRVKDIFNKLLNEIPMLKQKMNNYS------KEDAKYE-------------GSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNK-HSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQE 2075
            MFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVI+NYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKV+LSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSE+VNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINV+YAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSAR+KLNNSDGIYHKSVKFMSEG++I ILD+ N+ET I IK+ + K Y+ + ++++         EN ++     +LLNEI MLK  M NYS      KE+ KYE              S+IS N+ D  +   EFQKLKEDVIKQNDDISGLKLKTE I+M+L  ++T+++ + + +KA   ++E   + I F   HLFW+VPI+  V  ID+++    KE  ++ FYTQIKNY+L+L++ FTP  IE+Y+YL  +RRNK + +PFKSQITI+VVHKLLP++ LDR I S I T PG+S +++FTR ELN+LG L  N I I CDV+E
Sbjct:    1 MFIMKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIKNYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVELSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEMVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVIYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARYKLNNSDGIYHKSVKFMSEGDKITILDIDNIETMIIIKVSEMKRYIDSHMNRMANNLNFMLKENAKMNQTNKELLNEISMLKNIMKNYSVNAKELKENIKYEIGKMNITYKKLVSKSEISTNL-DSGVPKMEFQKLKEDVIKQNDDISGLKLKTEFIEMDLKTEKTLSKIVQQAIKAMIKSNEALKSQIAFTKFHLFWIVPITWTVTGIDVDESVKKKEATNDPFYTQIKNYKLHLYASFTPTKIEYYLYLYDNRRNKRNGIPFKSQITISVVHKLLPNVKLDRTIYSKIYTIPGVSKTISFTRTELNKLGFLEENRITIICDVKE 632          
BLAST of SMED30010528 vs. Planmine SMEST
Match: SMESG000014711.1 (SMESG000014711.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 463/630 (73.49%), Postives = 525/630 (83.33%), Query Frame = 3
Query:  255 MKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARXXXXXXXXXXXXXXXXXXFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKSVKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAI---ENGRVKDIFNKLLNEIPMLKQKMNNYS------KEDAKYE-------------GSKISQNIQDLLIGTKEFQKLKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEFDTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELYLHSLFTPKNIEFYVYLSASRRNK-HSLPFKSQITIAVVHKLLPSINLDRKILSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQE 2075
            MKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVI+NYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKV+LSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSE+VNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINV+YAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSAR+KLNNSDGIYHKSVKFMSEG++I ILD+ N+ET I IK+ + K Y+ + ++++         EN ++     +LLNEI MLK  M NYS      KE+ KYE              S+IS N+ D  +   EFQKLKEDVIKQNDDISGLKLKTE I+M+L  ++T+++ + + +KA   ++E   + I F   HLFW+VPI+  V  ID+++    KE  ++ FYTQIKNY+L+L++ FTP  IE+Y+YL  +RRNK + +PFKSQITI+VVHKLLP++ LDR I S I T PG+S +++FTR ELN+LG L  N I I CDV+E
Sbjct:    1 MKVESTTKFPFYFNTPFKIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSGDFFTILSWRRNVIKNYIELILLFPMAASNKLVEIYEISAANEAEYFEIKENSKLARLLYKSKIILSLSPKVELSFTPFHGKRDEFLSGETVTVTCQSSGFAILTRPNISNLNEFTVVSELNSEMVNEIKVKIKLQSSDHGKTLKCDAGKLTGKFSINVIYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVKGPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARYKLNNSDGIYHKSVKFMSEGDKITILDIDNIETMIIIKVSEMKRYIDSHMNRMANNLNFMLKENAKMNQTNKELLNEISMLKNIMKNYSVNAKELKENIKYEIGKMNITYKKLVSKSEISTNL-DSGVPKMEFQKLKEDVIKQNDDISGLKLKTEFIEMDLKTEKTLSKIVQQAIKAMIKSNEALKSQIAFTKFHLFWIVPITWTVTGIDVDESVKKKEATNDPFYTQIKNYKLHLYASFTPTKIEYYLYLYDNRRNKRNGIPFKSQITISVVHKLLPNVKLDRTIYSKIYTIPGVSKTISFTRTELNKLGFLEENRITIICDVKE 629          
The following BLAST results are available for this feature:
BLAST of SMED30010528 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010528 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014705.10.000e+098.74SMESG000014705.1[more]
SMESG000014711.10.000e+074.66SMESG000014711.1[more]
SMESG000014711.10.000e+074.58SMESG000014711.1[more]
SMESG000014711.10.000e+073.62SMESG000014711.1[more]
SMESG000014711.10.000e+073.49SMESG000014711.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010528 ID=SMED30010528|Name=SMED30010528|organism=Schmidtea mediterranea sexual|type=transcript|length=2125bp
TTGATTATCAAAACTTTTTAATTATCAAAAGCTGTTTACAATTTCAATTT
CAAAAAATTAAAATTTAAAATTTTAAAAAAAATTCATTATTTTGTTTTAC
TGAATAAATTCAAGTTGAATATAAATTAAACGTTTATCAGATTTATTTTC
ATTTAATGTCATTTTTTTTGAAAATGATGCTTAAAAATTTTATTTTAACA
TTGGGAGGATTCCTCGTGCTACCCCTTGTCACTCTGGCAAACCAAATGTT
CATCATGAAGGTCGAGTCAACCACAAAATTTCCATTCTATTTCAATACTC
CCTTCAAAATTAAATTCGTTCCCGATTCATTGAATGGAACAATTTCGGTG
AACTCAGATTTTGCTTCCTTGGAAATCCGAATTACAGACAAAACAGAGTT
CGAATTTGAGAGGCTTCAAATCCTTTACAAATCGGAGTCGAAAGTTTATT
CTGGAGACTTTTTCACGATTTTAAGCTGGAGAAGAAATGTCATCGAAAAC
TATATCGAGTTGATTTTGTTATTCCCGATGGCGGCAAGCAACAAATTAGT
AGAGATCTATGAAATATCCGCGGCGAATGAAGCCGAGTATTTCGAAATCA
AGGAAAATAGCAAACTAGCAAGGCTTTTGTACAAGTCAAAAATAATATTA
TCTTTATCCCCAAAAGTTAAGTTGTCATTCACGCCTTTTCATGGAAAACG
AGATGAATTCCTGTCAGGTGAAACTGTGACAGTAACATGCCAGTCCTCGG
GATTTGCCATTCTGACTCGGCCGAATATCTCAAATTTGAATGAGTTTACA
GTCGTATCCGAACTCAATTCAGAAATAGTAAATGAGATCAAGGTAAAGAT
AAAATTACAGAGCTCTGATCATGGGAAAACGCTGAAATGCGATGCAGGAA
AGCTAACTGGAAAATTCTCTATCAATGTTATGTATGCTCCTTCGAATGTC
AAGATCTCCCCAGATTTCAACAGTGTTGTTAAAATAAATTCCAACATTTC
ATGCGATCCAGGAAACGGCTATCCTATTCCCAACACATCCTGGACCCTTG
TAAAAGGTCCGAGTAATTTACCAGTACTATATTCCATCGACAAGGAAAAA
AGGAAGATTAAATTCATTAGAAGCCCTCTTTCAGATTCTGAATGGATTTT
CAATTGCAGCGCTCGCTTTAAGCTGAATAATTCGGACGGGATTTACCACA
AAAGTGTGAAATTCATGAGTGAAGGAGAGGAAATTATAATTCTGGATATG
GGTAACTTAGAAACGTTTATTAAAATAAAATTGATTCAATCAAAGAATTA
TGTTTCCACTGAATTGTCGAAATTAAAAAGACAATTTGCAATAGAAAATG
GCAGGGTAAAAGATATTTTCAATAAACTTTTGAATGAGATTCCGATGCTG
AAACAAAAAATGAATAATTATTCGAAAGAAGACGCTAAATATGAAGGTAG
CAAAATCTCCCAAAATATTCAAGATTTACTCATAGGAACGAAAGAGTTTC
AAAAGTTAAAAGAAGATGTTATCAAGCAGAACGACGATATTAGCGGACTG
AAATTGAAGACGGAAACTATTAAAATGAACCTAAATTATGATAGGACAAT
TACTCAAGCAATTGTTAAACAGTTAAAAGCTTCGGCTCTAACGCATGAGG
AATTTGACACTGATATTAAGTTTGCCCTTACGCATTTGTTCTGGCTTGTT
CCAATCTCAATACGTGTAAGAAACATAGACATTGAGGATGAAGGACCAAA
CAAAGAACACGTAAGCAATGCATTTTATACTCAAATCAAAAACTATGAAC
TTTATCTTCATTCTTTGTTTACCCCAAAGAACATTGAATTCTATGTATAT
CTTTCTGCTAGTCGACGAAACAAACATAGCCTACCATTCAAAAGTCAAAT
AACAATTGCAGTGGTCCATAAATTGTTACCGAGTATAAACTTGGATCGGA
AAATCCTCTCTACAATACGTACGGCCCCCGGCATTAGTGATTCGGTTACG
TTTACCAGAGTGGAGCTCAACCGTCTAGGATTGCTGTATGGAAATACAAT
TAAAATAAATTGCGACGTTCAGGAAATCTAAAATAATATTTTGATTATAA
TAATAAAAATTGCCTTTTAAAAAAA
back to top

protein sequence of SMED30010528-orf-1

>SMED30010528-orf-1 ID=SMED30010528-orf-1|Name=SMED30010528-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=642bp
MSFFLKMMLKNFILTLGGFLVLPLVTLANQMFIMKVESTTKFPFYFNTPF
KIKFVPDSLNGTISVNSDFASLEIRITDKTEFEFERLQILYKSESKVYSG
DFFTILSWRRNVIENYIELILLFPMAASNKLVEIYEISAANEAEYFEIKE
NSKLARLLYKSKIILSLSPKVKLSFTPFHGKRDEFLSGETVTVTCQSSGF
AILTRPNISNLNEFTVVSELNSEIVNEIKVKIKLQSSDHGKTLKCDAGKL
TGKFSINVMYAPSNVKISPDFNSVVKINSNISCDPGNGYPIPNTSWTLVK
GPSNLPVLYSIDKEKRKIKFIRSPLSDSEWIFNCSARFKLNNSDGIYHKS
VKFMSEGEEIIILDMGNLETFIKIKLIQSKNYVSTELSKLKRQFAIENGR
VKDIFNKLLNEIPMLKQKMNNYSKEDAKYEGSKISQNIQDLLIGTKEFQK
LKEDVIKQNDDISGLKLKTETIKMNLNYDRTITQAIVKQLKASALTHEEF
DTDIKFALTHLFWLVPISIRVRNIDIEDEGPNKEHVSNAFYTQIKNYELY
LHSLFTPKNIEFYVYLSASRRNKHSLPFKSQITIAVVHKLLPSINLDRKI
LSTIRTAPGISDSVTFTRVELNRLGLLYGNTIKINCDVQEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 405..425
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 179..265
e-value: 4.7E-5
score: 25.6