SMED30010526

Overview
NameSMED30010526
Smed IDSMED30010526
Length (bp)774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010526 (SMED30010526) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010526 (SMED30010526) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010526 (SMED30010526) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010526 (SMED30010526) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30010526SMESG000072556.1 dd_Smed_v4_10620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010526SMESG000072556.1 dd_Smed_v4_10620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010526 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000867:3674..9479 +3822
Homology
BLAST of SMED30010526 vs. Ensembl Celegans
Match: C24A1.3 (pep chromosome:WBcel235:III:692547:696456:-1 gene:WBGene00016030.1 transcript:C24A1.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C24A1.3)

HSP 1 Score: 48.9062 bits (115), Expect = 2.060e-6
Identity = 34/140 (24.29%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  133 FLVDKSGNTAMHYIVKNKNMEILNRVISY---SNLRLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIEN 543
             L D  GN A+HY  K+ ++ ILN +I     +N R+   N  G ++ +++CY+G   I++  +  + T  N + +  V             +  +L  +L+++  +  + +  +    + LH+A  H  + IV++L+EN
Sbjct:  243 LLADDEGNQALHYAAKSGSLVILNMLIKQVRGTNDRICARNLYGDTALHLSCYSGRLDIVKSILDSSPT--NIVNMENVFSETPLHAACTGGKSIELVSFLMKYPGVDPNYQGQD--GHTALHSACYHGHLRIVQYLLEN 378          
BLAST of SMED30010526 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194460:210063:1 gene:WBGene00185078.1 transcript:F40G9.17.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 46.9802 bits (110), Expect = 4.567e-6
Identity = 24/45 (53.33%), Postives = 29/45 (64.44%), Query Frame = 1
Query:  457 KELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTAL 591
            K  NS  ++ LH A S   +EIVK LIE DPN+I + DK G TAL
Sbjct:  112 KHTNSNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKFGATAL 156          
BLAST of SMED30010526 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194462:200328:1 gene:WBGene00185078.1 transcript:F40G9.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 46.9802 bits (110), Expect = 4.567e-6
Identity = 24/45 (53.33%), Postives = 29/45 (64.44%), Query Frame = 1
Query:  457 KELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTAL 591
            K  NS  ++ LH A S   +EIVK LIE DPN+I + DK G TAL
Sbjct:  112 KHTNSNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKFGATAL 156          
BLAST of SMED30010526 vs. TrEMBL
Match: A0A445CJB6 (ANK_REP_REGION domain-containing protein OS=Arachis hypogaea OX=3818 GN=Ahy_A06g026075 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.481e-8
Identity = 45/170 (26.47%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILN-KEGISSYYIACYNG----WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDK 633
             + SG TA++   +N N++I+  +I Y ++ L     K G  +++IA  NG     K+++E F + + T          M N T       + + ++ ++L E      S  + N   +++LH+A  +  +E++K L+  +P L    DKKG+TAL +A++    D +D+
Sbjct:   45 TNNSGETALYVAAENDNLDIVKELIKYHDIGLAGFKAKNGFDAFHIAAKNGNLEILKVLMEAFPEVSMTVD--------MSNTTALHTAAAQGYIEVVNFLFEKGSSLISIAKSNG--KTVLHSAARNGHVEVIKALLSREPELATRVDKKGQTALHMAVKGQNLDLVDE 204          
BLAST of SMED30010526 vs. TrEMBL
Match: A0A1J7GX95 (ANK_REP_REGION domain-containing protein OS=Lupinus angustifolius OX=3871 GN=TanjilG_06230 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.262e-7
Identity = 44/182 (24.18%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNLR-LEILNKEGISSYYIACYNGWKMIIEIFVKY-AKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSAN-ESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKK 675
            V++ G TA+    +  +++++  +++YS ++ L   N+ G   ++IA   G + I+++ + + ++  K F        N T       + H ++   L+   P   S+ E++ +N ++ LH A     +++VK L+  DP L    DKKG+TAL +A++    D + +    + A+++L  K
Sbjct:  113 VNELGETALFTAAEKGHLDVVKELLTYSTIKALSFKNRSGFDPFHIAANKGHQAIVQVLLDHDSQLIKTF-----AQSNATPLISAATRGHANVVELLLSQDP---SQLEISRSNGKNALHLAARQGHVDVVKLLLRKDPQLARRTDKKGQTALHMAVKGTSCDVVRQLLNADSAIVMLPDK 286          
BLAST of SMED30010526 vs. TrEMBL
Match: A0A4V6A7Y0 (Ankyrin repeat-containing protein OS=Populus alba OX=43335 GN=D5086_0000190150 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.908e-7
Identity = 48/178 (26.97%), Postives = 84/178 (47.19%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNL-RLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLK 669
            V++ G+TA+    +  ++E++  ++ Y+    +   N+ G+   ++A  NG + I+++ +++  T    +       N T       K H  + H L+   P      + N  N   LH A     IE+VK L++ DP L    DKKG+TAL +A+         K    E+AVLLL+
Sbjct:  137 VNELGDTALSTAAERGHLEVVKELLKYTTEDAISHRNRSGLDPLHLAASNGHQAIVQLLLEHDPTMGKTVG----QSNATPLISAATKGHAAVVHELLSKDPSLLEMTKSNGKNA--LHLAARQGHIEVVKALLDEDPQLARRTDKKGQTALHMAV---------KGLSCEVAVLLLE 299          
BLAST of SMED30010526 vs. TrEMBL
Match: A0A444YMV1 (ANK_REP_REGION domain-containing protein OS=Arachis hypogaea OX=3818 GN=Ahy_B06g082099 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.308e-7
Identity = 44/170 (25.88%), Postives = 85/170 (50.00%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILN-KEGISSYYIACYNG----WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDK 633
             + SG TA++   +N N++I+  +I Y ++ L     K G  +++IA  NG     K+++E F + + T          M N T       + + ++ ++L E      S  + N   +++LH+   +  +E++K L+  +P L    DKKG+TAL +A++    D +D+
Sbjct:   45 TNNSGETALYVAAENDNLDIVKELIKYHDIGLAGFKAKNGFDAFHIAAKNGNLEILKVLMEAFPEVSMTVD--------MSNTTALHTAAAQGYIEVVNFLFEKGSSLISIAKSNG--KTVLHSTARNGHVEVIKALLSREPELATRVDKKGQTALHMAVKGQNLDLVDE 204          
BLAST of SMED30010526 vs. TrEMBL
Match: A0A5N5MDB2 (Uncharacterized protein OS=Salix brachista OX=2182728 GN=DKX38_010330 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 8.313e-7
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNL-RLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLK 669
            V++ G+TA+    +  ++E++  ++ Y+    +   N+ G+   ++A  NG + I+++ +++  T    +       N T       K H  + H L+   P      + N  N   LH A     +E+VK L++ DP L    DKKG+TAL +A+         K    E+AVLLL+
Sbjct:  145 VNELGDTALSTAAERGHLEVVKELLKYTTKDAISHKNRSGLDPLHLAASNGHQAIVQLLLEHDPTMGKTVG----QSNATPLISAATKGHSAVVHELLSKDPSLLEMTKSNGKNA--LHLAARQGHVEVVKALLDKDPQLARRIDKKGQTALHMAV---------KGVSCEVAVLLLE 307          
BLAST of SMED30010526 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 50.0618 bits (118), Expect = 1.300e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNG------WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    V    E+ L   R+I+  +  +   L D +GNTA+HY V + N  I+ +++  +   +   NK G +   +A           +++ E+F K    +K            TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D    TAL IALE   +D         IAVLL
Sbjct:  899 VSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHSNFHIVKKLLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDMRVVEELFSKGDVNSK------ASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKD---------IAVLL 1094          
BLAST of SMED30010526 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 50.0618 bits (118), Expect = 1.429e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNG------WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    V    E+ L   R+I+  +  +   L D +GNTA+HY V + N  I+ +++  +   +   NK G +   +A           +++ E+F K    +K            TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D    TAL IALE   +D         IAVLL
Sbjct: 1100 VSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHSNFHIVKKLLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDMRVVEELFSKGDVNSK------ASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKD---------IAVLL 1295          
BLAST of SMED30010526 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 50.0618 bits (118), Expect = 1.456e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNG------WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    V    E+ L   R+I+  +  +   L D +GNTA+HY V + N  I+ +++  +   +   NK G +   +A           +++ E+F K    +K            TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D    TAL IALE   +D         IAVLL
Sbjct: 1110 VSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHSNFHIVKKLLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDMRVVEELFSKGDVNSK------ASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKD---------IAVLL 1305          
BLAST of SMED30010526 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 49.6766 bits (117), Expect = 1.759e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNG------WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    V    E+ L   R+I+  +  +   L D +GNTA+HY V + N  I+ +++  +   +   NK G +   +A           +++ E+F K    +K            TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D    TAL IALE   +D         IAVLL
Sbjct: 1096 VSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHSNFHIVKKLLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDMRVVEELFSKGDVNSK------ASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKD---------IAVLL 1291          
BLAST of SMED30010526 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 49.6766 bits (117), Expect = 1.759e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNG------WKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    V    E+ L   R+I+  +  +   L D +GNTA+HY V + N  I+ +++  +   +   NK G +   +A           +++ E+F K    +K            TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D    TAL IALE   +D         IAVLL
Sbjct: 1096 VSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHSNFHIVKKLLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDMRVVEELFSKGDVNSK------ASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKD---------IAVLL 1291          
BLAST of SMED30010526 vs. Ensembl Nematostella
Match: EDO36063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL9])

HSP 1 Score: 46.595 bits (109), Expect = 2.897e-6
Identity = 37/157 (23.57%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  136 LVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALE 606
            L D  GN A+HY V  +N +++N +++   + + ++NK G SS  +A   G                     CQ            + Q+ ++A  L +   +    K  +   ++ L  AVS  ++++V  L+E D + +  +D +G TA+  A E
Sbjct:   76 LPDAEGNNALHYAVTYRNWKVVNVLLNTGCVDVNLVNKAGYSSVMLAAVTG---------------------CQ------------KDQYRNVARRLFQMGDVN---KRYDETGQTPLMLAVSRGRLDMVDLLLETDAD-VNAQDNEGSTAIMCASE 195          
BLAST of SMED30010526 vs. Ensembl Medaka
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:101162911])

HSP 1 Score: 48.521 bits (114), Expect = 4.591e-6
Identity = 48/209 (22.97%), Postives = 85/209 (40.67%), Query Frame = 1
Query:   40 ISNS*KTVGFTAENILKRLRDITEGIYHYPDFLVDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHP-IKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLL 663
            +S+    +    ++ L+R   ++  +  Y   + D +GNTA+HY V + N +++  ++      +   NK G +   +A     +   ++ V      K  +         TG  L +     D+   L+     +   + E ++A    L  A  H  +EIVK L+        + D  G +AL IALE   +D         IAVLL
Sbjct:  983 VSSQKAALAAMVDDYLRRFEAVSPAVLRYIVNMADGNGNTALHYSVSHSNFQVVKTLLDADVCNVNQQNKAGYTPIMLAALAAVETPKDMSVVEELFGKGDVNARASQAGQTGLMLAVSHGRMDMVRALLAHGADVNVQDDEGSTA----LMCASEHGHVEIVKLLLAQPGCDATLSDGDGSSALSIALEAGHKD---------IAVLL 1178          
BLAST of SMED30010526 vs. Planmine SMEST
Match: SMESG000072556.1 (SMESG000072556.1)

HSP 1 Score: 263.462 bits (672), Expect = 2.479e-90
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 1
Query:  361 MKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK 750
            MKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK
Sbjct:    1 MKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK 130          
BLAST of SMED30010526 vs. Planmine SMEST
Match: SMESG000072556.1 (SMESG000072556.1)

HSP 1 Score: 257.299 bits (656), Expect = 4.992e-88
Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 1
Query:  370 MTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK 750
            MTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK
Sbjct:    1 MTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK 127          
BLAST of SMED30010526 vs. Planmine SMEST
Match: SMESG000020707.1 (SMESG000020707.1)

HSP 1 Score: 47.3654 bits (111), Expect = 6.035e-6
Identity = 43/158 (27.22%), Postives = 73/158 (46.20%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKN-MTGP---QLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIA 600
            VD  G T MH   KN + +++   +      L  +N EG++  ++A  NG   +I+ F+K+ K      F+   +KN  TG     L  E  H D+   L+E      +  E N+   + LH A  +  I+++K+L     +L  +  K G T + +A
Sbjct:  257 VDIKGQTPMHLAAKNDHTDVVKLFLRCRPELLVAINLEGMNCVHLAASNGSLSVIKEFMKFNK------FIIHGVKNKSTGSTPLHLAAEGGHVDIVKTLLE---AGANPAEENNDGMTCLHVAAKYGHIQLLKYL-NTKISLKVVSAKTGMTPIHVA 404          
BLAST of SMED30010526 vs. Planmine SMEST
Match: SMESG000031930.1 (SMESG000031930.1)

HSP 1 Score: 47.3654 bits (111), Expect = 6.675e-6
Identity = 45/166 (27.11%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  142 DKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIFVK--------YAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIYE 615
            D   +TA+H  V +  +E +  +++ +   + +LNK+  ++Y++A  +G + I+EIF+K          K  K        M N      +L K   DL    IE                + LH AV  K +  VK L+EN   L +++DK G TAL +A+++ +
Sbjct:  305 DSDRDTALHLAVNSSRLESVEALLN-AGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIEL--------------RTALHIAVKRKYLSFVKHLVENKAEL-DLKDKNGNTALHVAMKVNQ 454          
BLAST of SMED30010526 vs. Planmine SMEST
Match: SMESG000020707.1 (SMESG000020707.1)

HSP 1 Score: 46.9802 bits (110), Expect = 8.253e-6
Identity = 43/158 (27.22%), Postives = 73/158 (46.20%), Query Frame = 1
Query:  139 VDKSGNTAMHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIFVKYAKTTKNFIFLCQVMKN-MTGP---QLLLEKQHYDLAHWLIEFHPIKWSEKELNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIA 600
            VD  G T MH   KN + +++   +      L  +N EG++  ++A  NG   +I+ F+K+ K      F+   +KN  TG     L  E  H D+   L+E      +  E N+   + LH A  +  I+++K+L     +L  +  K G T + +A
Sbjct:  257 VDIKGQTPMHLAAKNDHTDVVKLFLRCRPELLVAINLEGMNCVHLAASNGSLSVIKEFMKFNK------FIIHGVKNKSTGSTPLHLAAEGGHVDIVKTLLE---AGANPAEENNDGMTCLHVAAKYGHIQLLKYL-NTKISLKVVSAKTGMTPIHVA 404          
The following BLAST results are available for this feature:
BLAST of SMED30010526 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C24A1.32.060e-624.29pep chromosome:WBcel235:III:692547:696456:-1 gene:... [more]
F40G9.174.567e-653.33pep chromosome:WBcel235:III:194460:210063:1 gene:W... [more]
F40G9.174.567e-653.33pep chromosome:WBcel235:III:194462:200328:1 gene:W... [more]
back to top
BLAST of SMED30010526 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A445CJB65.481e-826.47ANK_REP_REGION domain-containing protein OS=Arachi... [more]
A0A1J7GX951.262e-724.18ANK_REP_REGION domain-containing protein OS=Lupinu... [more]
A0A4V6A7Y01.908e-726.97Ankyrin repeat-containing protein OS=Populus alba ... [more]
A0A444YMV12.308e-725.88ANK_REP_REGION domain-containing protein OS=Arachi... [more]
A0A5N5MDB28.313e-726.40Uncharacterized protein OS=Salix brachista OX=2182... [more]
back to top
BLAST of SMED30010526 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kank1a1.300e-625.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.429e-625.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.456e-625.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.759e-625.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.759e-625.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
back to top
BLAST of SMED30010526 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010526 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360632.897e-623.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010526 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kank1a4.591e-622.97KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
back to top
BLAST of SMED30010526 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072556.12.479e-90100.00SMESG000072556.1[more]
SMESG000072556.14.992e-88100.00SMESG000072556.1[more]
SMESG000020707.16.035e-627.22SMESG000020707.1[more]
SMESG000031930.16.675e-627.11SMESG000031930.1[more]
SMESG000020707.18.253e-627.22SMESG000020707.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010526 ID=SMED30010526|Name=SMED30010526|organism=Schmidtea mediterranea sexual|type=transcript|length=774bp
GAAGAGCGCGAGAATAAGAGAAAATAGAAGCCATCAGACATTTCTAACAG
CTAGAAGACAGTTGGATTTACTGCAGAAAATATTTTGAAGAGATTACGTG
ATATTACGGAAGGGATATATCATTATCCTGATTTCCTTGTGGATAAAAGT
GGAAATACAGCCATGCATTACATAGTGAAGAATAAAAATATGGAGATTTT
AAACCGTGTAATATCGTATTCAAATTTGCGATTGGAGATTTTGAACAAAG
AAGGGATATCATCTTATTATATTGCATGCTACAATGGATGGAAAATGATA
ATTGAAATTTTTGTTAAATATGCGAAGACGACAAAGAATTTTATATTTTT
ATGTCAAGTAATGAAGAATATGACGGGACCGCAATTATTATTGGAAAAGC
AGCATTATGATTTAGCTCATTGGTTGATTGAGTTTCATCCAATTAAATGG
TCTGAAAAAGAGTTAAATTCCGCCAACGAATCAATTCTTCACACAGCAGT
GTCTCATAAGCAGATTGAAATAGTTAAATTCCTTATTGAAAACGATCCAA
ATCTCATTGAAATGAGAGACAAGAAAGGACGGACTGCTTTAGATATAGCT
TTAGAAATCTATGAAAGGGATGAATTGGACAAAACTCAGATTCGAGAAAT
CGCAGTTTTATTACTAAAGAAAAAGGCTCGTCATATTCTGCAACAAAATA
AACCTATTTACAATAAATTAAAAAACAACGAATTCAAATCGAATAACAAA
TAAATATTATTTTTTTTGTGAAAA
back to top

protein sequence of SMED30010526-orf-1

>SMED30010526-orf-1 ID=SMED30010526-orf-1|Name=SMED30010526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MHYIVKNKNMEILNRVISYSNLRLEILNKEGISSYYIACYNGWKMIIEIF
VKYAKTTKNFIFLCQVMKNMTGPQLLLEKQHYDLAHWLIEFHPIKWSEKE
LNSANESILHTAVSHKQIEIVKFLIENDPNLIEMRDKKGRTALDIALEIY
ERDELDKTQIREIAVLLLKKKARHILQQNKPIYNKLKNNEFKSNNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction