SMED30010523

Overview
NameSMED30010523
Smed IDSMED30010523
Length (bp)14718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010523 (SMED30010523) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010523 (SMED30010523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010523 (SMED30010523) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010523 (SMED30010523) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30010523 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 119.013 bits (297), Expect = 1.928e-25
Identity = 88/304 (28.95%), Postives = 145/304 (47.70%), Query Frame = -2
Query: 5961 NQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRV---KEEDRGKTAFSDGKGLYEF-NVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQ-KFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYL 6851
            + +T +  Y   +P E+FDQ+  A +FT ++L     +  V   + ED  K AF  G  L E  +  PF L+  P   Q  ++++L+ +     L Y  +++I+S   EEHL  V  V  R +   +     K ++ +  V ++G +++ +G++ N + +  +  YP P     +R F+     YR F++ FS IA+PL   L  + +F WG  +Q AF  LK      P+L  P     F L T  +  AL A L Q   +  K    A+ SR++ P E  YS  E + L +      + +YL
Sbjct:  638 DMLTNRQDYIQMIP-ELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAF--GLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYL 938          
BLAST of SMED30010523 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 119.013 bits (297), Expect = 1.928e-25
Identity = 88/304 (28.95%), Postives = 145/304 (47.70%), Query Frame = -2
Query: 5961 NQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRV---KEEDRGKTAFSDGKGLYEF-NVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQ-KFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYL 6851
            + +T +  Y   +P E+FDQ+  A +FT ++L     +  V   + ED  K AF  G  L E  +  PF L+  P   Q  ++++L+ +     L Y  +++I+S   EEHL  V  V  R +   +     K ++ +  V ++G +++ +G++ N + +  +  YP P     +R F+     YR F++ FS IA+PL   L  + +F WG  +Q AF  LK      P+L  P     F L T  +  AL A L Q   +  K    A+ SR++ P E  YS  E + L +      + +YL
Sbjct:  638 DMLTNRQDYIQMIP-ELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAF--GLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYL 938          
BLAST of SMED30010523 vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 115.931 bits (289), Expect = 1.947e-25
Identity = 65/242 (26.86%), Postives = 117/242 (48.35%), Query Frame = -2
Query: 4830 LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLV---ERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMP 5546
            L+I+  + +  +L + H+   G H    +TL+ ++S Y+W ++  DVK W  +C+ C   +NT   I  P + +     P  +  +D++GP   + + + Y ++  D FTKW     + +  A  +++  + NI F YG P+K++ DQ   F  ++   +  LFGI ++  S     T G V   E    T+   +S +      +WDD +    FA+     + T  TP++ M+ R   MP
Sbjct:   62 LVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAII-NIFFLYGPPQKIIMDQRDEFIQQINIELYRLFGIKQIVIS----HTSGTVNPTESTPNTIKAFLSKHCADHPNNWDDHLSAVSFAFNVTHLEPTKNTPYFQMFSRNPYMP 296          
BLAST of SMED30010523 vs. Ensembl Human
Match: NYNRIN (NYN domain and retroviral integrase containing [Source:HGNC Symbol;Acc:HGNC:20165])

HSP 1 Score: 100.523 bits (249), Expect = 9.387e-20
Identity = 50/179 (27.93%), Postives = 95/179 (53.07%), Query Frame = -2
Query: 5052 NGILKFWKNGEALI-IIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPV-PAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFG 5582
            +G+L F  + +  + ++P + R  L+   HD  LG H    +T  +L+   +WP M++ VK++C SC  CI R   G ++KV   P P+   AP     ++++GP+  + +G+K++++  D  T+W EA+ +       +A++ ++++  R+G P +L   QG  F   +  S     G
Sbjct: 1520 SGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDIPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIESPWPLRSTAPWSNLQIEVVGPVTISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAAQGPQFARHVLVSCGLALG 1698          

HSP 2 Score: 73.559 bits (179), Expect = 1.291e-11
Identity = 53/188 (28.19%), Postives = 89/188 (47.34%), Query Frame = -2
Query: 5853 IKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYS--TIEKETLALVYGITTFRQYL------LGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQE 6392
            +  + +  +P +   +  F+G    +R  I D+  +  PL++LLK+   + W Q  + AF  LK  LV+   L  P+    F L    S+VAL A+L Q+  G K H IAY S+ L P E++    +      A+ + +  F + +      L   +   T  +P +     R S + LIRWS+ +Q+
Sbjct: 1079 LAHLAQLTIPSNFTALSFFMGFMDSHRDAIPDYEALVGPLHSLLKQKPDWQWDQEHEEAFLALKRALVSALCLMAPNSQLPFRLEVTVSHVALTAILHQEHSGRK-HPIAYTSKPLLPDEESQGPQSGGDSPYAVAWALKHFSRCIGDTPVVLDLSYASRTTADP-EVREGRRVSKAWLIRWSLLVQD 1264          
BLAST of SMED30010523 vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 91.2781 bits (225), Expect = 2.884e-19
Identity = 45/160 (28.12%), Postives = 84/160 (52.50%), Query Frame = -2
Query: 5070 LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNF-QSEMFKS 5546
            L+I+  + +  +L + H+   G H    +TL+ ++S Y+W ++  DVK W  +C+ C   +NT   I  P + +     P  +  +D++GP   + + + Y ++  D FTKW     + +  A  +++  + NI F YG P+K++ DQ   F Q ++F S
Sbjct:   62 LVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAII-NIFFLYGPPQKIIMDQRDEFIQQKVFIS 218          
BLAST of SMED30010523 vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.064e-121
Identity = 258/857 (30.11%), Postives = 431/857 (50.29%), Query Frame = -2
Query: 4530 LLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGR--KFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRI--PENN-SEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFR-YGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYME----IPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDK-KAHAHGIKIGDLVYLNRPE-PLKGLSPKLQRPFKGPY---KVCDTTETNLKLLP 7046
            L   +P K K Y +    ++  ++ I+      IIR S+SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+++  A +FT +DL   Y+  R++  D  KTAF+  +G +E+ VLPFGL+ APA FQ  +N VLR +  +   VY+DDI+IFS+  +EH++ V  V +RL    L +K  KC +    V ++GHI+S  G++ +P+ I+ V ++P P     +++FLG A++YR+FI++FS +A PL +L      F W    + AF+ LK   V+ PIL  PD ++QF++  DAS V +GA+L Q+   + K H  AY S  L P E+NY    +E LA+   +  +R +L G    F V+TDH  L+++   +   S+  RW++    ++F I YR G  N   DA+SR+  P +  S   P   +G + A I             E +S ++  +                         NG+        + + +P + R  ++   H   +  H    +TL  +K +++WPTM +DV+++  +C VC   +++ +     L+P+ VP+ P    ++D +  LP ++ GN  ++   D F+K     ++P   +     + V + +FR +G P  +++D+G  F S  ++    L G     +S +HPQ++G  ER N  L   +   V++    W   +    +A+ +    STG +PF             L +QPP+   +E    +P   A +Q + +  W +A  T+     + K   D+ ++      +G  V+L+    PL+ +  KL   F GP+   K+       LKL P
Sbjct:  493 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYFSHRLSPAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIRSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSRLFDPSDRLSSPDPVLPQGIVVANI-----------SWEIESRVRTAL-------------------------NGVTPPIGCPPSRLFVPEELRSDVVRWGHSSKVACHPGVSRTLFVIKQRFWWPTMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVVLTVVDRFSKAAHFISLPKLPSARETAVAVIDHVFRIHGLPTDVVSDRGPQFVSRFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSSTGLSPFQ----------CSLGYQPPVFPSLESEVAVPSVHAFVQ-RCRRTWNRARQTLLRVGTRTKAKADRHRSKPPVYVVGQKVWLSSKNIPLRTVCNKLAPKFIGPFIVTKIISPVAIRLKLPP 1301          
BLAST of SMED30010523 vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.624e-121
Identity = 261/852 (30.63%), Postives = 428/852 (50.23%), Query Frame = -2
Query: 4530 TPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRK--FTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEG-TPEK-VEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPN-QKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYME----IPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDK-KAHAHGIKIGDLVYLNRPE-PLKGLSPKLQRPFKGPY---KVCDTTETNLKLLP 7034
            +P K K Y +    ++  ++ I+      IIR S+SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+++  A +FT +DL   Y+  R++E D  KTAF+  +G +E+ VLPFGL+ APA FQ  +N VLR +  +   VY+DDI+IFS+  +EH++ V  V +RL    L +K  KC +    V ++GHI+S  G++ +P+ ++ V ++P P     +++FLG A++YR+FI++FS +A PL  L      F W    Q AF+ LK   V+ PIL  PD ++QF++  DAS V +GA+L Q+   + K H  AY S  L   E+NY    +E LA+   +  +R +L G    F V+TDH  L+++   +   S+  RW++    +DF I YR G  N   DA+SRI +++    +PE  V   +F  I AV          E +S ++  +E                         G+        + + +P + R  ++   H   L  H    +TL  +K +++WP M +D++N+  +C VC   + + +     L+P+ VP+ P    A+D +  LP  + GN  I+   D F+K      +P    A   A   ++++   +G P  +++D+G  F S+ ++    L G     +S +HPQ++G  ER N  L  M+   V++    W   +    +A+ +    +TG +PF             L +QPP    +E    +P   A +Q + +  W +A  T+     + K   D+ ++      +G  V+L+    PL+ +  KL   F GP+   K+       LKL P
Sbjct:  523 SPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKMHPCAYFSHRLNNAEQNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIQSAKRLNSRQARWALFFGRFDFSISYRPGSKNVKPDALSRIFDHSERASSPETIVPRRLF--ISAVT--------WEIESRVRMALE-------------------------GVTPPPGCPPSRLFVPEELRSDVIRWGHSSKLACHPGVSRTLYLIKQRFWWPVMARDIRNFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHIALDFVTGLPP-SNGNTVILTVVDRFSKATHFIPLPKLPSARETAAAVIDHVFRIHGLPTDVVSDRGPQFISKFWREFCHLMGATVSLSSGFHPQSNGQTERANQDLERMLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFE----------CSLGYQPPAFPSLESEVAVPSAHAFVQ-RCRRTWNRARQTLLQVGLRTKAKADRHRSKPPVYVVGQKVWLSSKNIPLRTVCNKLAPKFIGPFSVTKIISPVAVRLKLPP 1327          
BLAST of SMED30010523 vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.029e-119
Identity = 255/821 (31.06%), Postives = 420/821 (51.16%), Query Frame = -2
Query: 4581 AMKEF-------GIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKN-NKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE--KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGT-IFAAIKAVNNMSELQN-DQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPN-QKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPI----SQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHG--IKIGDLVYLNRPE-----PLKGLSPKLQRPFK 6965
            AM E+       G IR S SP S+    VKKKDG LR C+DYR LN++T K  YP+P+     +Q+ +ARY+T +DL   YN  R++  D  KTAFS  +G YE+ V+PFGL+  P+ FQ  MN V R +    V     II+SN  +EH++ V  V +R+   +L  K  KCE+ + ++ ++G++IS  G+  +   ++ V+ +P+P++  E+++FLG A++YR+FI+ FS IA PL  + K+N +K  W    + AF+ LK +  T PILR P+    FI+  DASN  +GAVL Q+ +G+  K +  A+ SR L   E+NY    +E LA+   +  +R +L G  ++FT+ TDH  L++L   +    +  RW++    +DF + YR G  N+ ADA+SR+ E+ +  + E +  T +  A    + ++E+Q  ++EN+  +                                         LI +P   R  LL   HD    GH     TL  +K++++WP++ +DV N+   CK+C + + + +     L+P+PVP  P    A+D +  LP  ++ N  I+   D F+K      +P    A   A     ++   +G P  +++D+G  F S ++ ++     I    TS YHPQ++G  ER N  +I  + SY +++Q DW  ++    +A  + +  +TG TPF  +          L +QPP+     +  E+P     +Q + + VW +A   +     + +E    +    G   + G  V+L+  +     P + LSP+   PFK
Sbjct:  531 AMSEYIDEELAKGFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKFRYPLPLVPPALEQLRKARYYTKLDLRSAYNLVRIRAGDEWKTAFSTTRGHYEYTVMPFGLSNCPSVFQSFMNDVFRDMLDRWV-----IIYSNTMKEHVEHVRMVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQR-QGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLRSAKRLNPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPV------------------------------------DCPNHLIFVPNNIRTRLLTHIHDTPSSGHPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTKASHQTPAGLLQPLPVPQRPWSHIAVDFITDLP-VSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQEVIRFLRSYCHQQQHDWSRYLMWAEYAQNSLIKPATGITPFKCI----------LGYQPPLFPWSGEPTELPAVTDWLQ-RSEDVWNQAHRHLMRAVRR-REIQANRHRRQGPTYQPGQWVWLSTRDLRLRLPCRKLSPRYVGPFK 1296          
BLAST of SMED30010523 vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 417.157 bits (1071), Expect = 4.347e-119
Identity = 271/876 (30.94%), Postives = 433/876 (49.43%), Query Frame = -2
Query: 4473 LLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQK--FEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYME----IPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDK-KAHAHGIKIGDLVYLNRPE-PLKGLSPKLQRPFKGPY---KVCDTTETNLKLLPFRSKKANPMIVHANRCKLV 7046
            L   +P K   + +    ++  DR I    + G+IR S+SP  +    VKKKDG LR C+DYR LN +T K+ YP+P+    F+ +  A+ FT +DL   Y+  R++E D  KTAF+   G +E+ VLPFGLT APA FQ  +N VLR +  R   VY+DDI+IFS   + H++ V  V +RL   +L +K  KC +    + ++G IIS   +Q +P  I+ V E+P P     +++FLG A++YR+FI++F  IA PL  L      F W    Q AF+ LK + V+ P+L  PD  +QFI+  DAS+V +GAVL Q+   +G K H  A+ S  L P E+NY    +E LA+   +  +R +L G  + F V+TDH  L+++   R    +  RW++    + F + +R G  N   DA+SR+ E      P K E ++ A +     ++ +  D E                     +R+  A  K  +   +          + +P + R  ++   H   L  H   R++L+ +  +++WP+M +DV+ +  +C VC   + +       L+P+P+P+ P    A+D +  LPE +KGN  I+   D F+K    + IP  K   A   A++ ++++   +G P  +++D+G  F S  +K      G     +S +HPQT+G  ER N  L   +    +     W   +    +A+ +  + +TG +PF             + FQPP+    E    +P   A ++ + +  W KA   +     + K   D+ +  A     G  V+L+  + PL+  S KL   F GPY   KV       LKL P +  + +P I H +R K V
Sbjct:  508 LPGTSPPKGHLFSLSGPEREAMDRYINESLKTGLIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNDITVKNRYPLPLMSSAFELLQGAKVFTKLDLRNAYHLVRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQALVNDVLRDMVNRFVFVYLDDILIFSPCLQIHIQHVRQVLQRLLENQLYVKAEKCVFHAQSIPFLGFIISAGEIQADPCKIRAVAEWPTPDSRKALQRFLGFANFYRRFIRNFGQIAAPLTALTSPKVWFKWNSDAQEAFDELKSRFVSAPVLSIPDPEQQFIVEVDASDVGVGAVLSQRSCLDG-KVHPCAFFSHRLNPSERNYDVGNRELLAVRLALGEWRHWLEGAAQPFLVWTDHKNLEYIRSARRLTPRQARWALFFDRFKFTLSFRPGTKNVKPDALSRLFE-----VPGK-EKSVDAILPKEMVVASISWDIE---------------------RRVEKAIQKISVPGRV------PAGRLFVPTRLRSEVIQWGHSSRLACHPGVRRSLALIHQRFWWPSMAKDVRQFVAACSVCAQNKTSNAPPVGLLRPLPIPSRPWSHVALDFVTGLPE-SKGNTVILTVVDRFSK--SVHFIPLPKLPSAKETAQVVIDHVFRIHGLPVNVVSDRGPQFVSRFWKEFCRQIGASTSLSSGFHPQTNGQSERANQDLERTLRCLASHNPSSWCQQLSWVEYAHNSLPSSATGLSPFE----------CSIGFQPPLFPSQEPEAAVPSALAFVR-RCRRTWRKAREALVRVGRRTKAAADQHRTPAPHYICGQRVWLSTKDLPLRVPSRKLAPRFIGPYQITKVLSPVVVRLKLPP-KLGRVHP-IFHVSRVKPV 1333          
BLAST of SMED30010523 vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 416.772 bits (1070), Expect = 6.070e-119
Identity = 268/903 (29.68%), Postives = 446/903 (49.39%), Query Frame = -2
Query: 4530 EVVSNDLNEMQKKEFTKLLRKYRD---IFAK-HEYDLGLTNVIEHEIPLLDET-PIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGR--KFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFR-YGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYME----IPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDK-KAHAHGIKIGDLVYLNRPE-PLKGLSPKLQRPFKGPY---KVCDTTETNLKLLP 7178
              VS  + + ++ + + + R+Y D   +F+K     L      +  I LL  T P K K Y +    ++   + I+      IIR S+SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+++  A +FT +DL   Y+  R++  D  K+AF+  +G +E+ VLPFGL+ APA FQ  +N VLR +  +   VY+DDI+IFS+  +EH++ +  V +RL    L +K  KC +    V ++GHI+S  GL+ +P+ IK V  +P P     +++FLG A++YR+FI++FS +A PL  L      F W    + AF+ LK   V+ PIL  PD ++QF++  DAS V +GA+L Q+   + K H  AY S  L   E NY    +E LA+   +  +R +L G    F V+TDH  L+++   +   S+  RW++    ++F I YR G  N   DA+SR+  ++SE T   +E  +   I   N   E+++                K+R   D               G+        + + +P K R  ++   H   +  H    +T   +K +++WP + +DV+++  +C VC   + + +     L+P+ VP+ P    ++D +  LP  + GN  I+   D F+K      +P   +     + V N +FR +G P  +++D+G  F S+ ++    L G     +S +HPQ++G  ER N  L   +   V++    W   +    +A+ +    +TG +PF             L +QPP+   +E    +P   A +Q + +  W++A  T+     + K   D+ ++      +G  V+L+    PL+ +  KL   F GP+   K+       LKL P
Sbjct:  472 SAVSRSVFQEEQMDLSNVPREYHDLKRVFSKSRAASLPPHRPYDCAIDLLPGTSPPKGKLYSLSAPEREAMGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSKTPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYYSHRLSAAESNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSRL-FDSSERT-SSLEPVVPKRIVISNITWEIES----------------KVRAALD---------------GVTPPIGCPPSRLFVPEKLRSDVIRWGHSSKVACHPGVSRTSFVIKQRFWWPALARDVRDFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPP-SNGNTVILTVVDRFSKAAHFVPLPKLPSARETAVAVINHVFRIHGLPTDVVSDRGPQFISKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFQ----------CSLGYQPPVFPSLESEVAVPSVHAFVQ-RCRRTWSRARQTLLQVGVRTKAKADRHRSKPPVYVVGQKVWLSTKNIPLRTVCNKLAPKFIGPFIVTKIISPVAIRLKLPP 1329          
BLAST of SMED30010523 vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 520.776 bits (1340), Expect = 6.147e-155
Identity = 312/998 (31.26%), Postives = 506/998 (50.70%), Query Frame = -2
Query: 4635 EVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQ--------KKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKF------------------------IWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENN---------------------------SEGTPEKVEGTI------FAAIKAVN-------NMSELQNDQENDSELKQFMEQ----------------AVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKF-----QPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYL 7340
            + +K     V V + N++ +PV LH  + LG++   S+     + R+    K    VS +L ++         K    K L ++  +F++++ D+G +   +H+I L ++ P + +  RI     ++  + +  +K  GII++S SP++S IV+V+KK+G +R CVDYR LNQ T  D Y  P  ++  + +  +++F+V+DL  GY Q  +  ED+ KTAF    G +EFN +P GL GAPATFQR M   +  +     LVY+DD+I+F    EEH + +  VF RL+   LK+ P KC++ +  V YVGH++S  G+ T+P  I+ V  +P P+   E+R FLG   YYR+F+K FS +AQPLN LL+ N +                          W +    AF+ LK  L   P+L   D TK + L  DAS   LG +L Q++  E    +A+ SRSL P E+NY   + E LAL + +     +YL G +F V TD+NPL +++      +   RW  AL  Y F ++YR G+ N +AD +SR P  +                           S    EK+  T+      +  + +V        N  +++ DQ  D   +  ME                 A  + KE D  RL D     +++        + +  +++P KHRD++LM  HD    GHL   KTL  ++ +++WP M+QDV+++C SC  CI R+    +   PL  M    +P+++  +D L   P+   G   ++V  D++T++ +A+   +Q+A T+A++ VE     YG PK++ +DQG++F+S++   +  + G+ K  T+PYHPQ D   ERFN TL++M+ +    K+  W   I   + AY +  N +TG +P++LM+ R+  +PID  F       P+  +     Y   ++  +Q  + +A   +     + K  YDKK   H ++ GD V L
Sbjct:  219 DCLKKNCGTVTVGLKNTTNEPVFLHSHSLLGRVYSASLVPVAALGRD----KAEATVSAELFDLSNSVIPPEWKSRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQEYNKEL-RPVAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKLDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRRPHGDLHPDDEWIEIPAPGVRTMCQGITGRCQSGNFAEKIGMTVRGIPKLYCNVTSVGTSTMPALNKGDIKRDQSEDPLCQMAMEALRKKQVQILKTDSHPLASLLVKEWDRLRLRDG----LVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDEH--GHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSR-AAPLSHMES-HSPLDLVCIDFLSIEPDEG-GTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKKTHWSRHIATVVHAYNSTKNGATGYSPYFLMFGREARLPIDTVFGVTADDTPVKSHSS---YVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKIHDLQPGDRVLL 1199          
BLAST of SMED30010523 vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 417.157 bits (1071), Expect = 1.019e-125
Identity = 244/731 (33.38%), Postives = 384/731 (52.53%), Query Frame = -2
Query: 4851 SDRQITAMKEF-------GIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNK-FIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR--IPENNS--EGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMY 6983
            S  +  AMKE+       G IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FDQ+  A+ F+ +DL   YN  R++E D  KTAF+   G YE+ V+PFGL  APA FQ  +N + R +  +  +VY+DDI+IFS D E H   V+    RL+   L  K  KC +   ++ ++G+IIS RG + +P  +  ++++P+P+    +++F+G A+YYR+FIK FS    P+ +L++K  +   W  +   AF +LK+  ++  +LR P+    F +  DAS+V  GA+L Q+   + K H  AY S+     E+NY    +E LA+   +  +R  L G     T+YTDH  L++L   +    +  RWS+    + F + YR G  N  ADA+SR   PE+    E  P      I A++                  L QF EQ +          L+ + +      G          +  +P + R  +L Q H     GH  + KTL  L+   +WPT+ +DV+++  +C VC T + +  +    L P+PVP+ P     MD +  LP +  GN  I V  D F+K   A+ +P +K   A  +A++F+++I   +G P ++++D+G  F S  ++S+    G+    +S YHPQT+G  ER N  L   + ++V+  Q DW D +    FA+ NA + STG +PF  +Y
Sbjct:   11 SPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQARWSLFFSRFHFVLTYRPGTKNRKADALSRSFSPEDRLPIEREPIIPPSRIIASV------------------LPQFAEQIL----------LSQSAAPPDTPIG----------MAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLQRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPVPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSK--MAHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNARHSSTGRSPFLSVY 700          
BLAST of SMED30010523 vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 436.417 bits (1121), Expect = 7.199e-125
Identity = 295/951 (31.02%), Postives = 472/951 (49.63%), Query Frame = -2
Query: 4473 GKLSKMS--VETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEF-------GIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNK-FIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR--IPENNSEGTPEKVEGTI--FAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKN-NMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAH-AHGIKIGDLVYL-NRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLV 7250
            G++S+ S   + +C IP+ ++      V S   + +       + R + D+F K   +  L     ++ P+ D  P  + P    Y     S  +  AMKE+       G IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FDQ+  A+ F+ +DL   YN  R++E D  KTAF+   G YE+ V+PFGL  APA FQ  +N + R +  +  +VY+DDI+IFS D E H   V+    RL+   L  K  KC +   ++ ++G+IIS RG + +P  +  ++++P+P+    +++F+G A+YYR+FIKDFS    P+ +L++K  +   W  +   AF +LK+  ++  +LR P+    F +  DAS+V  GA+L Q+   + K H  AY S+     E+NY    +E LA+   +  +R  L G     T+YTDH  L++L   +    +  RWS+    ++F + YR G  N  ADA+SR   PE+     P + E  I  F  I +V               L QF EQ +  +        + A S   I             +  +P + R  +L Q H     GH  + KTL  L+   +WPT+ +DV+++  +C VC T + +  +    L P+P+P+ P     MD +  LP +  GN  I V  D F+K   A+ IP +K   A  +A +F+++I   +G P ++++D+G  F S  ++S+    G+    +S YHPQT+G  ER N  L   + ++V+  Q DW D +    FA+ NA + STG +PF  +Y +     P DL          E+P    L    M  +W      ++ +   +K   D++   +   K+G+ V+L +R   LK  SPKL   F GP+ + +        L    +   P + H +  K V
Sbjct:  451 GQISRWSQYCQRHCLIPQPLQRVT---VSSTSFSAL-----PSVYRDFSDVFCKKSAEF-LPPHRRYDCPI-DLLPGTMPPRGRTY---PLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQARWSLFFSRFNFVLTYRPGTKNRKADALSRSFSPEDR---LPIEQEPIIPPFRIIASV---------------LPQFAEQILLSQ--------SAAPSDTPI------------GMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKM--AHFIPLRKLPSAVELAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNASHSSTGRSPFLSVYGQHPLAFPQDLLLS-------EVPAADDLAAH-MSVIWAATKSNLEKSSLVHKTFADRRRKPSPPYKVGEKVWLSSRNIRLKVPSPKLGPKFLGPFSISEVINPVAVRLQLPPEMRIPNVFHVSLLKPV 1339          
BLAST of SMED30010523 vs. Ensembl Xenopus
Match: ENSXETT00000042189.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460667.1:82848:87648:1 gene:ENSXETG00000017765.1 transcript:ENSXETT00000042189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 434.876 bits (1117), Expect = 1.246e-124
Identity = 295/949 (31.09%), Postives = 470/949 (49.53%), Query Frame = -2
Query: 4473 GKLSKMS--VETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEF-------GIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDF-SHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGE-KDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTI--FAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKN-NMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAH-AHGIKIGDLVYL-NRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLV 7250
            G++S+ S   + +C IP+ ++      V S   + +       + R + D+F K   +  L     ++ P+ D  P  + P    Y     S  +  AMKE+       G IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FDQ+  A+ F+ +DL   YN  R++E D  KTAF+   G YE+ V+PFGL  APA FQ  +N + R +  +  +VY+DDI+IFS D E H   V+    RL+   L  K  KC +   ++ ++G+IIS RG + +P  +  ++++P+P+    +++F+G A+YYR+FIKDF SHIA  L+ + K      W  +   AF +LK+  ++  +LR P+    F +  DAS+V  GA+L Q+   + K H  AY S+     E+NY    +E LA+   +  +R  L G     T+YTDH  L++L   +    +  RWS+    ++F + YR G  N  ADA+SR   +  +  P + E  I  F  I +V               L QF EQ +  +        + A S   I             +  +P + R  +L Q H     GH  + KTL  L+   +WPT+ +DV+++  +C VC T + +  +    L P+P+P+ P     MD +  LP +  GN  I V  D F+K   A+ IP +K   A  +A +F+++I   +G P ++++D+G  F S  ++S+    G+    +S YHPQT+G  ER N  L   + ++V+  Q DW D +    FA+ NA + STG +PF  +Y +     P DL          E+P    L    M  +W      ++ +   +K   D++   +   K+G+ V+L +R   LK  SPKL   F GP+ + +        L    +   P + H +  K V
Sbjct:  451 GQISRWSQYCQRHCLIPQPLQRVT---VSSTSFSAL-----PSVYRDFSDVFCKKSAEF-LPPHRRYDCPI-DLLPGTMPPRGRTY---PLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSHIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQARWSLFFTRFNFVLTYRPGTKNRKADALSR-SFSPKDRLPIEQEPIIPPFRIIASV---------------LPQFAEQILLSQ--------SAAPSDTPI------------GMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKM--AHFIPLRKLPSAVELAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNASHSSTGRSPFLSVYGQHPLAFPQDLLLS-------EVPAADDLAAH-MSVIWAATKSNLEKSSLVHKTFADRRRKPSPPYKVGEKVWLSSRNIRLKVPSPKLGPKFLGPFSISEVINPVAVRLQLPPEMRIPNVFHVSLLKPV 1339          
BLAST of SMED30010523 vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 410.994 bits (1055), Expect = 3.892e-123
Identity = 200/465 (43.01%), Postives = 297/465 (63.87%), Query Frame = -2
Query: 5790 VVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR-HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLL--KKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR 7175
             +S+ L+  Q+ +  K+LR Y  +F+ +    G T+  EH++    + PI+   YR+    + E   QI  M  FG+I  S SP++S +V+V KKDG  RFCVDYR+LN VT  D YP+P   E+ D++G A+Y T +DL++GY Q  +    + K+AF    GLY+F V+PFG+  APATFQR +N +L G++  A  Y+DDI +FS  +EEHL+ ++ VF +++ A L +KP KC    AEV Y+GH +    L+ +P  ++ + ++P+PK   +V  FLG + YYRKFI ++S +A+PL  L   +++   +W    ++A N LK+ L ++P+L  PDF+++FIL TDASN  LGAVL Q     ++H +AY SR L P E  Y+TIEKE LA+V+ +   + YL GR+FTV TDHNPL WL +      KL+RWS+ LQ+Y+F I++R GK + NAD +SR
Sbjct:  292 TISDHLHLSQQDQLRKILRSYSPMFSANP---GRTHWAEHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEKECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQRVSGDNGKLLRWSLLLQQYNFTIQHRKGKEHHNADGLSR 753          

HSP 2 Score: 144.05 bits (362), Expect = 1.034e-33
Identity = 85/233 (36.48%), Postives = 131/233 (56.22%), Query Frame = -2
Query: 4554 DYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQ----PPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPY----KVCDTT 5228
            DY T++PEA A+    A T+A   ++ I  R G P ++L+DQG  F S++ + +    G+  +++SPYHPQT+GL ERFNGTL  M+ ++V   +KDW+ ++   LFAYR    +STG +PF L+Y R+   P+DL  +     P SQ + I  Y    +++++ + + A   +   Q++ K  YD+KA       GD V L  P        KLQ  ++GPY    K+ DTT
Sbjct:    2 DYATRYPEAVALRKIDAPTVADALIQ-IFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCEYWEGAPQSQEVPIIPYVLKFRQRLEQMTSLAHDHLSAAQQRQKVWYDRKARERRFMEGDKVLLLVPT----RHDKLQAAWEGPYVVTHKLHDTT 229          
BLAST of SMED30010523 vs. Ensembl Mouse
Match: Gin1 (gypsy retrotransposon integrase 1 [Source:MGI Symbol;Acc:MGI:2182036])

HSP 1 Score: 108.997 bits (271), Expect = 2.788e-23
Identity = 60/237 (25.32%), Postives = 114/237 (48.10%), Query Frame = -2
Query: 4845 LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLV---ERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLR 5546
            L+++  + +  +L + H+   G H    +TL+ ++S Y+W ++  DVK W  +C+ C   +NT   I  P + +P+   P  +  +D++GP   + + + Y ++  D FTKW     + +  A  I++  + NI F YG P+K++ DQ   F  ++   +  LFG  ++  S    +  G V   E    T+   +S +       WD+ +    FA+     +    TP++ M+ R
Sbjct:   62 LVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPQQHLPMVGNPWSVVTVDLMGPFHTSNRSHVYAIIMTDLFTKWVMILPLCDVSASEISKAII-NIFFLYGPPQKIIMDQRDEFIEQINVELYRLFGAKEIVIS----RASGSVNPAENTPSTIKTFLSKHCADHPNSWDEHLPALSFAFNVTHLEPNKNTPYFQMFNR 291          
BLAST of SMED30010523 vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 95.1301 bits (235), Expect = 2.343e-18
Identity = 49/181 (27.07%), Postives = 92/181 (50.83%), Query Frame = -2
Query: 5052 NGILKFWKNGEA---LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPV-PAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFG 5582
            +G+L F   GE    + ++P + R  L+   HD  +G H     T   ++   +WP M+  V+++C SC  CI R   G ++KV   P P+   AP     ++++GP+  + +G+K++++  D  T+W EA+ +       +A++ ++++  R+G P +L   QG  F   +  S     G
Sbjct: 1463 SGLLMF--KGERHPRVWVVPRQLRRDLIFSVHDSPIGEHQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQIEVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQFARHVLVSCGLALG 1641          

HSP 2 Score: 68.9366 bits (167), Expect = 2.069e-10
Identity = 52/188 (27.66%), Postives = 85/188 (45.21%), Query Frame = -2
Query: 5853 IKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYS--TIEKETLALVYGITTFRQ------YLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQE 6392
            + ++ +  +P +   +  F+G    +R  I D+  +  PL+ LLK+   + W Q  + +F  LK  LV    L  P+    F L    S V+L A L Q+  G K H IAY S+ L P E +    +      A+ + +  F +       +L   +   T  +   W  + R S + LIRWS+ LQ+
Sbjct: 1022 LAQLAQLNIPSNFTALSFFMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK-HPIAYTSKPLLPDEDSEGPQSGGDSPYAVAWALKHFARCVGDNPVVLRLSYASRTTVDNEAWDSR-RASKAWLIRWSLLLQD 1207          
BLAST of SMED30010523 vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 95.1301 bits (235), Expect = 2.343e-18
Identity = 49/181 (27.07%), Postives = 92/181 (50.83%), Query Frame = -2
Query: 5052 NGILKFWKNGEA---LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPV-PAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFG 5582
            +G+L F   GE    + ++P + R  L+   HD  +G H     T   ++   +WP M+  V+++C SC  CI R   G ++KV   P P+   AP     ++++GP+  + +G+K++++  D  T+W EA+ +       +A++ ++++  R+G P +L   QG  F   +  S     G
Sbjct: 1463 SGLLMF--KGERHPRVWVVPRQLRRDLIFSVHDSPIGEHQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQIEVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQFARHVLVSCGLALG 1641          

HSP 2 Score: 68.9366 bits (167), Expect = 2.069e-10
Identity = 52/188 (27.66%), Postives = 85/188 (45.21%), Query Frame = -2
Query: 5853 IKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYS--TIEKETLALVYGITTFRQ------YLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQE 6392
            + ++ +  +P +   +  F+G    +R  I D+  +  PL+ LLK+   + W Q  + +F  LK  LV    L  P+    F L    S V+L A L Q+  G K H IAY S+ L P E +    +      A+ + +  F +       +L   +   T  +   W  + R S + LIRWS+ LQ+
Sbjct: 1022 LAQLAQLNIPSNFTALSFFMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK-HPIAYTSKPLLPDEDSEGPQSGGDSPYAVAWALKHFARCVGDNPVVLRLSYASRTTVDNEAWDSR-RASKAWLIRWSLLLQD 1207          
BLAST of SMED30010523 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 95.1301 bits (235), Expect = 2.466e-18
Identity = 85/337 (25.22%), Postives = 151/337 (44.81%), Query Frame = -2
Query: 5961 RDSASPFSSSIVIVKKKDGDLRFCVDYRKL-NQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKE-----EDRGKTAFSDGKGLYEFNVL-PFGLTGAPATFQRGMNYVLRGIRHALVYID--DIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQ-KFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYL 6941
            R++  P S+ +    ++    R   +Y  L + +T +  Y   VP E+FDQ+  A +FT ++L  G  +  ++      ED  + +F  G GL++     PF +          ++++L+ I    V     +++++S   EEH + V  V  R +   +     K ++ +     +G  IS +G++ N + +  +   PVP     ++  + L   YR F+++F+ IA PL   L  +  + WG+ +Q A  +LK     +P+L  P     F L TD +   L A L Q   E  K    A+ SR L   E  Y  +E   L +      + +YL
Sbjct:  867 RETLEPVSARMQEKARQQEKAREQEEYWILYDMLTDRQDYTQMVP-ELFDQLHGAAWFTKLEL-LGIKESEMRHTVTHTEDTWRASF--GFGLHQMRCYRPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYL 1199          
BLAST of SMED30010523 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 95.1301 bits (235), Expect = 2.466e-18
Identity = 85/337 (25.22%), Postives = 151/337 (44.81%), Query Frame = -2
Query: 5961 RDSASPFSSSIVIVKKKDGDLRFCVDYRKL-NQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKE-----EDRGKTAFSDGKGLYEFNVL-PFGLTGAPATFQRGMNYVLRGIRHALVYID--DIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQ-KFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYL 6941
            R++  P S+ +    ++    R   +Y  L + +T +  Y   VP E+FDQ+  A +FT ++L  G  +  ++      ED  + +F  G GL++     PF +          ++++L+ I    V     +++++S   EEH + V  V  R +   +     K ++ +     +G  IS +G++ N + +  +   PVP     ++  + L   YR F+++F+ IA PL   L  +  + WG+ +Q A  +LK     +P+L  P     F L TD +   L A L Q   E  K    A+ SR L   E  Y  +E   L +      + +YL
Sbjct:  867 RETLEPVSARMQEKARQQEKAREQEEYWILYDMLTDRQDYTQMVP-ELFDQLHGAAWFTKLEL-LGIKESEMRHTVTHTEDTWRASF--GFGLHQMRCYRPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYL 1199          
BLAST of SMED30010523 vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 2.596e-123
Identity = 288/861 (33.45%), Postives = 445/861 (51.68%), Query Frame = -2
Query: 5211 KGSPVRCLIGMDILEQLDGVSLDLKTGNLI---AGETGKIIHRA-GEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVP-----VHITNSSKKPVQ---LHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVS-NDLNEMQKKEFTKLLRKYRDIFAKHEYD-LGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIV-KKKDGD----LRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQ-QNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRI-------PENNSEGTPEKVEGTIFAAIKAVN-----------------------NMSELQNDQENDSELKQFM-------EQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKW 7610
            K + ++CLI         G ++++ + N+       T   IH + G + VN+++ IP  S++++          +F+  P     E YDL +  +++      +      V + N+  K ++    H ++    ++ M  +T  + P  +    E ++     LN  +K+    LL+KY DI   HE D L  TN  +H I      P+  K Y  P  ++ E + QI  M   GIIR S SP++S I +V KK+D       R  +DYRKLN++T  D +PIP   E+  ++G   YFT IDL KG++Q  +  E   KTAFS   G YE+  +PFGL  APATFQR MN +LR +  +H LVY+DDII+FS   +EHL+ +  VF++L  A LK++  KCE+ K E  ++GH+++  G++ NP+ I+ +++YP+P    E++ FLGL  YYRKFI +F+ IA+P+   LKKN K      +  +AF  LK  +   PIL+ PDFTK+F L TDAS+VALGAVL Q       H ++Y SR+L  HE NYSTIEKE LA+V+   TFR YLLGR F + +DH PL WL + +D  SKL RW + L E+DF+IKY  GK N  ADA+SRI        E       E     IF   + +N                       +++++  D     + +Q++       + A+ I  + D++ +  A  K  I+    K  ++   L  I   A+ ++ L++  H+  L  H   +KT       Y++P  +  ++N  N C +C   +   +   +P K  P P    E   +DI      +++G  Y+    D ++K+
Sbjct:   21 KENNLKCLIDT-------GSTVNMTSKNIFDLPIQNTSTFIHTSNGPLIVNKSIIIP--SKILFPTT------NEFLLHP---FSENYDLLLGRKLLAEAKATISYRDQEVTLYNNKYKLIEGIATHEQSHFQNVN-MIPDTMLRQPNKISPILESDLYRLEHLNNEEKQRLCALLQKYHDI-QYHEGDKLTFTNQTKHTINTKHNLPLYSK-YSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ-----DGHPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNSKLTRWRVKLSEFDFDIKYIKGKENCVADALSRIKLEETYLSEQTQHSAEEDNSDLIFITERPLNTFNRQVIFSKGPPDIKVTKYFKKHITQIFYDIMTREKAEQYLIDHFCGKKSALYIESDADFE-VIQAAHKLAINTKYTKILRSTILLKNITTYAEFKE-LILTAHEKLL--HPGIQKTTKLFGETYYFPNSQLLIQNIINECSICNLAKTEHRNTDMPTKTTPKPEHCREKFMIDIY-----SSEGKHYVSCI-DIYSKF 845          
BLAST of SMED30010523 vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.042e-122
Identity = 259/730 (35.48%), Postives = 385/730 (52.74%), Query Frame = -2
Query: 5211 RNVKVYKEPE-VVSNDLNEMQKKEFTK----------------LLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKK-----DGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQ-NAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRI---PENNSEGTPEKVE----GTIFAAIKAVNNMSE----LQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANS---KYVIHNGILKFWKNGEALIIIPAKHRD--------------------------ALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKW 7205
            +N+ + + PE + S+D   ++K +F++                LL K+R++  K    L  TN I+H +     +PI  K Y +   H+ E + Q+  M   G+IR+S SP++S   +V KK         R  +DYRKLN++T  D YPIP   E+  ++G+ +YFT IDL KG++Q  + EE   KTAFS   G YE+  +PFGL  APATFQR MN +LR +  +H LVY+DDIIIFS    EHL  ++ VF +L  A LK++  KCE+ K E  ++GHI++  G++ NP  +K +  YP+P    E+R FLGL  YYRKFI +++ IA+P+ + LKK  K    +++   AF  LK  ++  PIL+ PDF K+F+L TDASN+ALGAVL Q       H I++ SR+L  HE NYS IEKE LA+V+   TFR YLLGR+F + +DH PL+WL   ++  +KL RW + L EY F+I Y  GK N+ ADA+SRI     ++SE T    E      I    K +N   +    +++D+      K F      I  + D   L  A      + IH  I  + ++     I+   H +                           +++Q H+  L  H   +K     K  +F+P  +  ++N  N C +C   +   +  K+PLK  P P    E   +DI      +++G  YI    D ++K+
Sbjct:  131 QNLYIQRTPESIASSDQESIKKLDFSQFRLDHLNQEETFKLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQ-----NGHPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEPGAKLERWRVRLSEYQFKIDYIKGKENSVADALSRIKIEENHHSEATQHSAEEDNSNLIHLTEKPINYFKKQIIFIKSDKNKVEHSKIFGNSITTI--QYDVMTLEKAKQILLDHFIHRNITIYIESDVDFEIVQRAHIEIVNTTYTKVIRSLFLLKNVGSYAEFKEIILQSHEKLL--HPGIQKMTKLFKENHFFPNSQLLIQNIINECNICNLAKTEHRNTKMPLKITPNPEHCREKFVVDIY-----SSEGKHYISCI-DIYSKF 845          
BLAST of SMED30010523 vs. UniProt/SwissProt
Match: sp|P0CT40|TF29_SCHPO (Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.112e-110
Identity = 262/861 (30.43%), Postives = 443/861 (51.45%), Query Frame = -2
Query: 4545 IEHEIPLLDET-PIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSAS--KLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQN----DQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIP--AKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQ---SVWTKAGLTIKHNQEKYKETYDKKAHA-HGIKIGDLVYLNRPEP-LKGLSPKLQRPFKGPYKVCDTTETN 7064
            +E E+ L  E   + I+ Y +P       + +I    + GIIR+S +  +  ++ V KK+G LR  VDY+ LN+  + + YP+P+ +++  ++  +  FT +DL   Y+  RV++ D  K AF   +G++E+ V+P+G++ APA FQ  +N +L   +  H + Y+DDI+I S    EH+K V+ V ++LK+A L I  +KCE+ +++V ++G+ IS +G     +NI KV ++  PK+  E+RQFLG  +Y RKFI   S +  PLN LLKK+ ++ W   Q  A   +K+ LV+ P+LR  DF+K+ +L TDAS+VA+GAVL QK + +K + + Y S  +   + NYS  +KE LA++  +  +R YL      F + TDH  L   + +       +L RW + LQ+++FEI YR G AN  ADA+SRI +  +E  P+  E      +  ++   + +N    +  ND++L   +    K R E++ +          + +G+L    N +  I++P   +    ++ +YH+     H       + +  ++ W  + + ++ +  +C  C   ++   K   PL+P+P    P E  +MD +  LPE++  N   VV  D F+K   A  +P  K   A+  AR+F + +I  +G PK+++ D    F S+ +K     +      + PY PQTDG  ER N T+  ++    +     W D I     +Y NA++ +T  TPF +++          ++ P +S  +E+P +     E  Q    V+      +  N  K K+ +D K       + GDLV + R +      S KL   F GP+ V   +  N
Sbjct:  400 LEFEVELTQENYRLPIRNYPLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLPLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVD-ETEPIPKDSEDNSINFVNQISITDDFKNQVVTEYTNDTKLLNLLNNEDK-RVEENIQ----------LKDGLL---INSKDQILLPNDTQLTRTIIKKYHEEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVV-VDRFSKM--AILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPNTWVDHISLVQQSYNNAIHSATQMTPFEIVH----------RYSPALSP-LELPSFSDKTDENSQETIQVFQTVKEHLNTNNIKMKKYFDMKIQEIEEFQPGDLVMVKRTKTGFLHKSNKLAPSFAGPFYVLQKSGPN 1231          
BLAST of SMED30010523 vs. UniProt/SwissProt
Match: sp|P0CT37|TF24_SCHPO (Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-4 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.112e-110
Identity = 262/861 (30.43%), Postives = 443/861 (51.45%), Query Frame = -2
Query: 4545 IEHEIPLLDET-PIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSAS--KLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQN----DQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIP--AKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQ---SVWTKAGLTIKHNQEKYKETYDKKAHA-HGIKIGDLVYLNRPEP-LKGLSPKLQRPFKGPYKVCDTTETN 7064
            +E E+ L  E   + I+ Y +P       + +I    + GIIR+S +  +  ++ V KK+G LR  VDY+ LN+  + + YP+P+ +++  ++  +  FT +DL   Y+  RV++ D  K AF   +G++E+ V+P+G++ APA FQ  +N +L   +  H + Y+DDI+I S    EH+K V+ V ++LK+A L I  +KCE+ +++V ++G+ IS +G     +NI KV ++  PK+  E+RQFLG  +Y RKFI   S +  PLN LLKK+ ++ W   Q  A   +K+ LV+ P+LR  DF+K+ +L TDAS+VA+GAVL QK + +K + + Y S  +   + NYS  +KE LA++  +  +R YL      F + TDH  L   + +       +L RW + LQ+++FEI YR G AN  ADA+SRI +  +E  P+  E      +  ++   + +N    +  ND++L   +    K R E++ +          + +G+L    N +  I++P   +    ++ +YH+     H       + +  ++ W  + + ++ +  +C  C   ++   K   PL+P+P    P E  +MD +  LPE++  N   VV  D F+K   A  +P  K   A+  AR+F + +I  +G PK+++ D    F S+ +K     +      + PY PQTDG  ER N T+  ++    +     W D I     +Y NA++ +T  TPF +++          ++ P +S  +E+P +     E  Q    V+      +  N  K K+ +D K       + GDLV + R +      S KL   F GP+ V   +  N
Sbjct:  400 LEFEVELTQENYRLPIRNYPLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLPLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVD-ETEPIPKDSEDNSINFVNQISITDDFKNQVVTEYTNDTKLLNLLNNEDK-RVEENIQ----------LKDGLL---INSKDQILLPNDTQLTRTIIKKYHEEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVV-VDRFSKM--AILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPNTWVDHISLVQQSYNNAIHSATQMTPFEIVH----------RYSPALSP-LELPSFSDKTDENSQETIQVFQTVKEHLNTNNIKMKKYFDMKIQEIEEFQPGDLVMVKRTKTGFLHKSNKLAPSFAGPFYVLQKSGPN 1231          
BLAST of SMED30010523 vs. UniProt/SwissProt
Match: sp|P0CT35|TF22_SCHPO (Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-2 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.112e-110
Identity = 262/861 (30.43%), Postives = 443/861 (51.45%), Query Frame = -2
Query: 4545 IEHEIPLLDET-PIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLG--RKFTVYTDHNPLQWLMKHRDSAS--KLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQN----DQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIP--AKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQK---ADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQ---SVWTKAGLTIKHNQEKYKETYDKKAHA-HGIKIGDLVYLNRPEP-LKGLSPKLQRPFKGPYKVCDTTETN 7064
            +E E+ L  E   + I+ Y +P       + +I    + GIIR+S +  +  ++ V KK+G LR  VDY+ LN+  + + YP+P+ +++  ++  +  FT +DL   Y+  RV++ D  K AF   +G++E+ V+P+G++ APA FQ  +N +L   +  H + Y+DDI+I S    EH+K V+ V ++LK+A L I  +KCE+ +++V ++G+ IS +G     +NI KV ++  PK+  E+RQFLG  +Y RKFI   S +  PLN LLKK+ ++ W   Q  A   +K+ LV+ P+LR  DF+K+ +L TDAS+VA+GAVL QK + +K + + Y S  +   + NYS  +KE LA++  +  +R YL      F + TDH  L   + +       +L RW + LQ+++FEI YR G AN  ADA+SRI +  +E  P+  E      +  ++   + +N    +  ND++L   +    K R E++ +          + +G+L    N +  I++P   +    ++ +YH+     H       + +  ++ W  + + ++ +  +C  C   ++   K   PL+P+P    P E  +MD +  LPE++  N   VV  D F+K   A  +P  K   A+  AR+F + +I  +G PK+++ D    F S+ +K     +      + PY PQTDG  ER N T+  ++    +     W D I     +Y NA++ +T  TPF +++          ++ P +S  +E+P +     E  Q    V+      +  N  K K+ +D K       + GDLV + R +      S KL   F GP+ V   +  N
Sbjct:  400 LEFEVELTQENYRLPIRNYPLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLPLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVD-ETEPIPKDSEDNSINFVNQISITDDFKNQVVTEYTNDTKLLNLLNNEDK-RVEENIQ----------LKDGLL---INSKDQILLPNDTQLTRTIIKKYHEEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVV-VDRFSKM--AILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPNTWVDHISLVQQSYNNAIHSATQMTPFEIVH----------RYSPALSP-LELPSFSDKTDENSQETIQVFQTVKEHLNTNNIKMKKYFDMKIQEIEEFQPGDLVMVKRTKTGFLHKSNKLAPSFAGPFYVLQKSGPN 1231          
BLAST of SMED30010523 vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 525/1146 (45.81%), Postives = 730/1146 (63.70%), Query Frame = -2
Query: 4437 LTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSV-ETNCKIPRNVKVYK---EPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLVPEEDESRYPLRS 7862
            L    + P+I +Q+N     AL+D+GS  T+++   L  + +  IKPT   V+ +S   LN IGQL     I ++ I+   +++K  P  C+IGM  L +L G+  D  + N +     +II     ++V +  TIP  +E+V        D+   IFEPN    +   L +   V   +N  +PV   N S   +QL     +G + ++ V E N       KV++    P    + LN  Q +    + +KY  +FA  ++DLG TN+I+H IPL  + PIK +PY+  Y  + E  +Q+  MK   +IR+S SP++S IV+VKKKDG +RFCVDYRKLN VTRKDTYP+P   EM D++  +++FT +DL  GY Q  + EED+ KTAF+ G+GLYEFNVLPFGLTGAPATFQR M+++L    HA+VYIDDI+I+S DF+EHL D+  V +RL+ A LKIKP KCEW K+ V ++GH++S  G++ +P N++K++ +  P     +++FLG+A YYRKFI +F+ IA PL  L KKN+  +W +  Q +F  LK +L+  P+LR PD  K FI+MTDAS  A+GAVLGQK E  KDHVIAYASR L+ HE NYS IEKE LA+VY +  F  Y+  RK  +YTD  PLQWLM H+DS+S+LIRWS+ LQEYD +IKYR GKANANAD +SR+ E      P +   ++ A      + +EL   Q  D  L   +E    I+        + AN +Y + + ILK+    + L +IP K ++ ++ +YHDG +GGHLS +KT+S + ++Y+W  ++ DVK WC +C +C+ R+      +  LKP+  P+ PME TAMDI+GPLPETTKGNKYI+VF DYFTKWPEA A+P+QKA TIA++F+E+IIF+YG P KL+TDQG NF SE+   + + F I K  TS YHPQ+DGLVERFN TL  M+S+Y N +Q DWD++I PCLFAYRN V++ST +TPF+LM+LR+  +PIDL      + YM+  +Y   M+EK++ VWT A L +   QE YKE YD+        +GD V L+ P   KGL+ KL +P+ GPYKV + T  NLK+   + ++A  MIVH NRC+     D  RYPLR+
Sbjct: 1077 LVDNVESPKILVQINGRTRIALIDTGSGATLLNYEGLKPQYRRLIKPTCLKVQGMSGTILNPIGQLLCELTICNQKISSELVVVKNLPYPCIIGMSTLSKLKGIVFD-PSCNRLKTLNNEIIDNMN-IYVTEDTTIPKWNEVVMPMQIHCNDDKTVIFEPNDIFADTNCLSVATTVTNTDNSTIPVRFVNYSNDNIQLQQGQHIGTIHEIDVVEVNV-----AKVFEGGMPPNFPFDYLNNEQNQAMENIFQKYSKVFATDDFDLGKTNIIKHFIPLDKDNPIKQRPYKAAYALKGEIKKQVEDMKHNKVIRNSFSPWASPIVMVKKKDGTMRFCVDYRKLNTVTRKDTYPLPRIDEMLDKLNNSKFFTSLDLQSGYWQIEISEEDKYKTAFTTGEGLYEFNVLPFGLTGAPATFQRCMSHILMDASHAMVYIDDILIYSIDFDEHLHDITMVLQRLELAGLKIKPRKCEWAKSMVTFLGHLVSSEGIKPDPKNVEKIKNFEKPVKVKGIQRFLGMAGYYRKFIPNFAKIASPLFDLTKKNDNTLWTEKHQESFEELKNRLIHFPVLRFPDMNKDFIIMTDASGYAIGAVLGQKDEMLKDHVIAYASRILKSHEVNYSVIEKEALAIVYSVKQFHHYIWSRKIILYTDQRPLQWLMTHKDSSSRLIRWSLLLQEYDIDIKYRQGKANANADFLSRMDE------PVQCMVSMLANF----DKNELLQAQRADKGLFYIIEDTANIQNN------SFANPRYELQSRILKYVTGNKVLTVIPDKLQEKIIKEYHDGPMGGHLSAKKTISAIGNRYYWKNLKDDVKEWCKTCNICLRRKGRAPS-RALLKPISSPSTPMETTAMDIMGPLPETTKGNKYILVFSDYFTKWPEAKALPDQKAQTIAKVFIEDIIFKYGAPSKLITDQGTNFLSEVMSEVNEFFKIDKHTTSAYHPQSDGLVERFNRTLEQMLSAYTNERQTDWDEYIAPCLFAYRNTVHESTKQTPFFLMFLREPKLPIDLTLVETKTCYMDEYNYVQDMKEKLKDVWTTAKLNMNFYQESYKEYYDRHISTPSFMVGDFVLLHTPLHEKGLTNKLYKPYDGPYKVIEVTPQNLKIQNTKKRQAKIMIVHKNRCRKFHASD--RYPLRN 2196          

HSP 2 Score: 451.44 bits (1160), Expect = 3.878e-123
Identity = 263/694 (37.90%), Postives = 411/694 (59.22%), Query Frame = -2
Query: 8064 SLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVKRTTFVFYCGKWSHSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITG---------EQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKKATYNTMKKIWGKFMFIGQACAGLXXXXXXXXXXXXXXXXVLSTHRLYAITGWSWKLVIGCIPLLARFFIT---HHQYQELEILKARILKKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQE---LSG-MNKEALRTYQILKE---PLLNASSVD 10088
            ++ AYDC   ++G  +SL++  EC +AYP +F+      YH+YQE G   S  +ECTV R   + +CG  SHS+++K  S+   + I   NC  AF+  ++++   + L+AK    I+E +   G I  +G C+G  Y      I +A+V+E Y   +++ + +FD DT ++ +  +C+ K + C  G++ ++YD+  ++CNLV LK+++F  I G         +++  +P+KI     T        +    TP VL++    D +R +RK+   KCGQ+VY TNY  I VS   + EA   I   +I L  YFNNK DYL+H     +E++YRE+IINDC LN+EILR +MA+ +TNPN+ AP++    GVF+R+ GE L ++KCK V VK+     CT+ELPV    K  ++EPVTR+LL + +K K ++C+ L +P Y+L+  +WI  P    +  P+  +LT L+  V F+ L+ L +SG+Y  + +E+AR+ LL+P  ++R++ E+V+T L  G+ + NYE LL+P+H++KA  N MKK+WG+F+  GQA AGL+GIY + + +K  I QV ST+ LY I G+SWKL++G IP LAR FI+   H +  ++E         KK +   T  +RDE  +         ++VD+ E   L+G  N+E  RT  +  E   PLLN+   D
Sbjct:  390 AIKAYDCDNAKLGTQFSLLDAEECPEAYPNQFEKRFNRIYHIYQERGLIYSAAKECTVTRRRSIRWCGHHSHSAIIKQPSMIEYLNIGHRNCEDAFRLKEIRLADKLILKAKPGILIQEDIIKVGSIAFDGTCEGGEYWYQGKKIKQALVIETYQITIKKSEVAFDPDTNEMMSRSYCSAKSNFCFDGKTSIIYDIRKQECNLVFLKTVNFDVIRGKIFDNNLFIDKLNSRPKKIYRTEKT--------INSHITPVVLIANKTSDAIRLVRKDQVVKCGQSVYLTNYDRIVVSTVRVKEAIIKISKKEINLAVYFNNKADYLYHHQLRQIEDLYREMIINDCKLNREILRTKMALIVTNPNIAAPVIPLGKGVFSRVLGEVLQTFKCKQVEVKINISSDCTHELPVIYKNKFMYLEPVTRLLLPDVIKVKKIKCSPLFSPAYKLSDNTWIVTPSLTPIAPPKRFQLTNLRNAVKFSRLKDLMKSGLYDKKAMEDARKYLLYPQVRDRILTEIVETSLGDGN-RPNYELLLSPNHFEKAAKNVMKKVWGRFLIFGQAIAGLMGIYYVVIFLKTFIEQVTSTYELYKIMGFSWKLILGIIPCLARPFISKKLHDKINDVE---------KKYANRHTYSNRDEEIN---------VHVDDTETTVLNGDQNEERRRTVNVAGEQIYPLLNSKKKD 1056          
BLAST of SMED30010523 vs. TrEMBL
Match: A0A1Y1KUJ8 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 438/1203 (36.41%), Postives = 688/1203 (57.19%), Query Frame = -2
Query: 4380 MTLTKRGKQPRIFI--QMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGE----VFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVE---KYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPE-----VVSN--DLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNM-----SELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDA-----------NSKYVIHNGILKFWKNGEAL-----IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKF-QPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLVPEEDESRYPLRSKQNKVTGQTKLKQKFTKNP 7868
            + +T  GK   ++I  ++N      LVD+G++ TI    +L  K   +I  +   +++ +   +   G++ +   IG   I H  LI   S  + ++GMD+L++L G  LD+K G L  G+     H   E    +     + IP  SE +     M+  +G +  + +  +VE   + +  +   +VKV+N  VP+ I N    PV+L  +T +G+   +S   + K   N+   K P      V+ N  DL+  Q+++   +L ++RD+FA ++ D G T+++ H+I   +  PI+ +P R+P   +DE++  I  M++ G+I  S SP+SS IV+VKKKDG  RFCVDYR LN VT+KD+YP+P   +  D +  A++F+ +DL  GY Q  ++  DR KTAFS G GL++F V+PFGL  APATF+R M  VLRG+  +  LVY+DD+I+    FEEHLK++  VF RL+ A LK+ P KC   + EV Y+GHI+SR G+  +P+ I  ++E+P+P++  E+R FLGL +YYR+F+K F++IA+PL  L ++ N++ W +  Q AF  L++ L + PIL  P    +F+L TDASN A+GAVL Q  +G+ + VIAY S+ L   E+NY    +E L +V     F +YL GRKF + TDH  L+WL++ R+   ++ RW   LQEYD++I++R GK + NADA+SR P  ++     K+E  I    +          SE++  QEND  +K  +   ++  +  DW+ ++             NS  +  N + +  ++ +       +++P      +L + HDGA GGH    KTL R++ +++W   ++DV+ WC  C++C T      K K P++   V  +PME  A+DI GP PET  GNKYI+V  DYFTKW EAYAIPNQ+A T+A + V+    R+G P ++ +DQG+NF+S +F+ +  L G  K  T+P HPQ+DG+VER N T+   +S  V   QK+WD ++   L AYR+AVN++TG+TP  LM  R+  +P DL+F + P  +Y+   +Y   ++ KM  +   A   I+   ++ K  Y+ ++     + GDLV+L+ P+  +GLSPKLQR ++GPY+V    + N  +   R     P +VH NR         +RY   +   +V G  + ++ F   P
Sbjct:  383 VNITSSGKVLSLYIDGRVNGEDRSLLVDTGATRTIARPELL--KNHSRISSSTVQLKTATGERIKTHGEIQMSVTIGKTTINHQVLIADISD-QFILGMDLLKKL-GAVLDVKKGVLKVGDEELPFHEDKEDVIRLLTTHDVIIPGLSEKI----IMTTLDG-YCRQGSLRIVEALNQKEFLVARALVKVQNG-VPIRIMNLKDSPVKLSKRTVVGQCVPISAIRSVK-SENLSKGKYPRELIDMVIKNTPDLDNRQRQKVKNMLVEFRDVFAVNDQDKGKTSIVTHKINTGNSQPIRQQPRRLPLAKRDEAEEIIRDMRKQGVIEPSNSPWSSPIVLVKKKDGSTRFCVDYRLLNSVTKKDSYPLPRIDDTLDTLSGAQWFSTLDLKSGYWQVGMESTDREKTAFSIGSGLWQFTVMPFGLCNAPATFERLMEAVLRGLTWQTCLVYLDDVIVVGKTFEEHLKNLREVFGRLREANLKLSPKKCFMFQKEVKYLGHIVSRDGVTADPEKIIAIQEWPIPENKHEIRSFLGLCTYYRRFVKGFANIAKPLIKLTEEGNEYEWSEDCQRAFEHLRQALTSAPILGYPRNEGKFVLDTDASNTAIGAVLSQLQDGQ-ERVIAYFSKVLSKPERNYCVTRRELLGVVKACEHFHKYLYGRKFLIRTDHAALKWLLQFRNPEGQVARWLERLQEYDYDIEHRAGKVHNNADALSRRPCKDNCTHCSKIEDKIGHLRRTTVESEEWKPSEIKTAQENDPSIKTVL-NWMRHGQRPDWQDISATSPEVKSYWGQWNSLTLKDNLLYRTLESEDGTESTLQLVVPRSKVSEVLRKLHDGASGGHFGITKTLQRVRERFYWVNRKEDVRRWCQKCELCATGNGPVSKKKAPMRQYNV-GSPMERVAIDIAGPFPETDGGNKYILVAMDYFTKWTEAYAIPNQEAATVAEVLVKEFFTRFGVPIEIHSDQGRNFESALFQDVCRLVGANKTRTTPLHPQSDGMVERMNRTMGKYLSKVVAEHQKNWDQYLHLFLMAYRSAVNETTGQTPACLMLGRELRLPCDLEFGRKPHEEYVAGENYVDQLKAKMNDIHDLARSHIQIASDRMKNQYNLRSANETFEAGDLVWLHNPQRRRGLSPKLQRQWEGPYEV--IKKINDVIYRIRMNHRKPKVVHINRL--------ARYAGSNNNEEVRGIREEERSFGIEP 1561          
BLAST of SMED30010523 vs. TrEMBL
Match: A0A4Y2ICH8 (Transposon Ty3-I Gag-Pol polyprotein (Fragment) OS=Araneus ventricosus OX=182803 GN=TY3B-I_1407 PE=4 SV=1)

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 420/1152 (36.46%), Postives = 653/1152 (56.68%), Query Frame = -2
Query: 4485 LVDSGSSHTIISENVLN-VKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGE------TGKIIH-RAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCK----IPRNVKVYKEPEVVSN------DLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNS----EGTPEKVEGTIFAAIKAVNNMS-------ELQNDQENDSELKQFMEQAVKIRKEQDWKRL---TDANSKYV-------IHNGIL-KFWK--NGEAL---IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANR 7799
            LVD+G++ T++  ++   +KE++     +  +++ +  +  I G+L+     G R   H   +   +   C++G+D L++ +  ++DL+   +  G       +  + H ++  + V +   IP +SE +            +      + V +  + +   +V +E + +PV + N +  P           L K +V   C+    I    + + E + +S+       LNE Q++E  KLL++++++F+  + D+G  N+ +H I   D  PIK  P R+P   ++E+D  +  M + GII +S+ P++S IV+VKKKDG  RFCVDYRKLN++T+KD+YP+P   +  D +  +++FT +DL  GY Q  ++ EDR KTAF+ G+GL++F V+PFGL  APATF+R M  VLRG+     LVY+DDIII    FEEHL ++  VF+RL+ A LK+ P KC + + EV Y+GH+IS  G++T+P  IK V ++P P+   +VR FLGL +YYR+F+K+FS IA+PL+ L +  + F W +  + +FN+LK+ L ++PIL  P   K FIL TDASN  +GAVL Q   G ++ VIAY S+SL   E+NY    KE LA+V  I  F  YL GRKF + TDH  L+WL+  ++   ++ RW   LQEYDFEI++R G ++ NADA+SR P   S        +K    +  ++K +   S       E+Q  Q  D  +K  +E+ +       W+ +   + A  +Y        + +G+L + W+  NG +    +I+P      +L + HD A GGH    KTLS+ + +++W  +  DV+NWC  C  C  R+    + K  L+   V  AP E  A+DILGP P TTKGN+Y++V  DYFTKWPEA  IP+Q+A T+A   V + I  YG P  L +DQG NF S +F  + +L GI K  T+  HP++DG+VERFN T++N +S +V+R Q DWD  +   L AYR+A ++ TG TP  +++ R   +P D+ F  P        +Y   ++ +++SV   A   IK   E+ K  YD +A  H  K GDLV++  P+  +GLSPKLQ+ ++GPY V       +  +  RS  A P ++H NR
Sbjct:    2 LVDTGANVTLLRTDLAQKLKEQLIYTAPNISLKTATGEKTEIRGKLDASIECGSRKFHHRIYVADITDP-CILGLDFLQKFN-FTVDLEKNEIRTGGEEIPLFSASVQHSKSCSILVKKRTIIPARSECLIQGIPEVPGQFRYAVTDFHSQVPQKGVLVAATLVDLERKAIPVRVLNLNNTP---------KILDKGAVIATCEPVVDIVARPQEFSEAQHLSSILESLEMLNEKQRREVRKLLKEFQNLFSTCDADVGHCNMTQHRINTGDHPPIKQYPRRLPLSRKEEADHLVKDMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDTLDALNGSQWFTTLDLKSGYWQVEIRPEDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFEEHLSNLRKVFQRLQKANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKIKAVVDWPRPETVHDVRSFLGLCTYYRRFVKNFSTIARPLHKLTEAKSNFNWKEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGIGAVLSQNI-GNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFKEPEGQIARWIQRLQEYDFEIQHRKGTSHGNADALSRSPCTESCKHCTNAEKKFGMEMDISVKVLTTTSVDPWSSCEIQKAQLEDPNIKPILEKKLYSADRPSWQEIAPESPATKRYWALWDSLHLKDGVLYRRWESDNGSSCRWQLILPKSRIPEVLRETHDSASGGHFGVMKTLSKTRERFYWDRLRTDVENWCRECHACGARKGPKTRTKGRLQRYNV-GAPFERMALDILGPFPVTTKGNRYVLVLMDYFTKWPEAIPIPDQEASTVAEELVRSWISCYGVPMILHSDQGTNFNSALFTKLCELLGILKTRTTALHPESDGMVERFNRTILNHLSLFVSRNQTDWDTHLPLFLLAYRSAEHEVTGLTPAEMLFGRTLRLPCDILFGRPSETPSSPIEYMKNLEARLESVHAFARERIKLASERMKTRYDSRATDHHFKEGDLVWMYNPKRRRGLSPKLQQNWEGPYTVVKKLNDVVYRVQ-RSPSAKPKVIHINR 1139          
BLAST of SMED30010523 vs. TrEMBL
Match: A0A4Y2IQ81 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_511 PE=4 SV=1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 432/1224 (35.29%), Postives = 678/1224 (55.39%), Query Frame = -2
Query: 4485 REMKPVENIALQCEGMVGERIEPS-----SAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEAL--VDSGSSHTIISENVLN-VKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGE------TGKIIH-RAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCK----IPRNVKVYKEPEVVSN------DLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNS----EGTPEKVEGTIFAAIKAVNNMS-------ELQNDQENDSELKQFMEQAVKIRKEQDWKRL---TDANSKYV-------IHNGIL-KFWK--NGEAL---IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANR 7994
            R++  V+    + EG+ G+  EP      S    R   L       +   +  GK+  ++++ +   ++ L  VD+G++ T++  ++   +KE++     +  +++ +  +  I G+L+     G R   H   +   +   C++G+D L++ +  ++DL+   +  G       +  + H ++  V V +   IP +SE +            +      + V +  + +   +V +E + +PV + N +  P           L K +V   C+    I    + + E + +S+       LNE Q++E  KLL++ +++F+  + D+G  N+ +H I   D  PIK  P R+P   ++E+D  +  M + GII +S+ P++S IV+VKKKDG  RFCVDYRKLN++T+KD+YP+P   +  D +  +++FT +DL  GY Q  ++ EDR KTAF+ G+GL++F V+PFGL  APATF+R M  VLRG+     LVY+DDIII    FEEHL ++  VF+RL+ A LK+ P KC + + EV Y+GH+IS  G++T+P  IK V ++P P+   +VR FLGL +YYR+F+K+FS IA+PL+ L +  + F W +  + +FN+LK+ L ++PIL  P   K FIL TDASN  +GAVL Q   G ++ VIAY S+SL   E+NY    KE LA+V  I  F  YL GRKF + TDH  L+WL+  ++   ++ RW   LQEYDFEI++R G ++ NADA+SR P   S        +K    I  ++K +   S       E+Q  Q  D  +K  +E+ +       W+ +   + A  +Y        + +G+L + W+  NG +    +++P      +L + HD A GGH    KTLS+ + +++W  +  DV+NWC  C  C  R+    + K  L+   V  AP E  A+DILGP P TTKGN+Y++V  DYFTKWPEA  IP+Q+A T+A   V + I  YG P  L +DQG NF S +F  +  L GI K  T+  HP++DG+VERFN T++N +S +V+R Q DWD  +   L AYR+A ++ TG TP  +++ R   +P D+ F  P        +Y   ++ +++SV   A   IK   E+ K  YD +A  H  K GDLV++  P+  + LSPKLQ+ ++GPY V       +  +  RS  A P ++H NR
Sbjct:   81 RDLLEVQQEGARAEGVPGDCFEPGKLTHGSLAGRRLPSLNRAPEEGLRVSSLSGKKNGLYLEGSICGIQCLMLVDTGANVTLLRTDLAQKLKEQLIYTAPNISLKTATGEKTEIRGKLDASIECGSRKFHHRIYVADITDP-CILGLDFLQKFN-FTVDLEKNEIRTGGEEIPLFSASVQHSKSCSVLVKKRTIIPARSECLIQGIPEVPGQFRYAVTDFHSQVPQKGVLVAATLVDLEREAIPVRVLNLNNTP---------KILDKGAVIATCEPVVDIVARPQEFSEAQHLSSILESLEMLNEKQRREVRKLLKELQNLFSTCDADVGHCNMTQHRINTGDHPPIKQYPRRLPLSRKEEADHLVKDMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDTLDALNGSQWFTTLDLKSGYWQVEIRPEDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFEEHLNNLRKVFQRLQKANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKIKAVVDWPRPETVHDVRSFLGLCTYYRRFVKNFSTIARPLHKLTEAKSNFNWTEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGIGAVLSQNI-GNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFKEPEGQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRPCTESCKHCTNAEKKFGMEIDISVKVLTTTSVDPWSSCEIQKAQLEDPNIKPILEKKLYSADRPSWQEIAPESPATKRYWALWDSLHLKDGVLYRRWESDNGSSCRWQLVLPKSRIPEVLRETHDSASGGHFGVMKTLSKTRERFYWDRLRTDVENWCRECHACGARKGPKTRTKGRLQRYNV-GAPFERMALDILGPFPVTTKGNRYVLVLMDYFTKWPEAITIPDQEASTVAEELVRSWISCYGVPMILHSDQGTNFNSALFTELCKLLGILKTRTTALHPESDGMVERFNRTILNNLSLFVSRNQADWDTHLPLFLLAYRSAEHEVTGLTPAEMLFGRTLRLPCDILFGRPSETPSSPIEYMKNLEARLESVHAFARERIKLASERMKTRYDSRATDHHFKEGDLVWMYNPKRRRSLSPKLQQNWEGPYTVVKKLNDVVYRVQ-RSPNAKPKVIHINR 1290          
BLAST of SMED30010523 vs. TrEMBL
Match: A0A4Y2I372 (Transposon Ty3-G Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-G_423 PE=4 SV=1)

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 418/1152 (36.28%), Postives = 652/1152 (56.60%), Query Frame = -2
Query: 4485 LVDSGSSHTIISENVLN-VKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGE------TGKIIH-RAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCK----IPRNVKVYKEPEVVSN------DLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRH--ALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSE---GTPEKVEGT-IFAAIKAVNNMS-------ELQNDQENDSELKQFMEQAVKIRKEQDWKRL---TDANSKYV-------IHNGIL-KFWKNGEAL-----IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANR 7799
            LVD+G++ T++  ++   +KE++     +  +++ +  +  I G+L+     G R   H   +   +   C++G+D L++ +  ++DL+   +  G       +  + H ++  V V +   IP +SE +            +      + V +  + +   +V +E + +PV + N +  P           L K +V   C+    I    + + E + +S+       LNE Q++E  KLL++++++F+  + D+G  N+ +H I   D  PIK  P R+P   ++E+D  +  M + GII +S+ P++S IV+VKKKDG  RFCVDYRKLN++T+KD+YP+P   +  D +  +++FT +DL  GY Q  ++ EDR KTAF+ G+GL++F V+PFGL  APATF+R M  VLRG+     LVY+DDIII    FEEHL ++  VF+RL++A LK+ P KC + + EV Y+GH+IS  G++T+P  IK V ++P P+   ++R FLGL +YYR+F+K+FS IA+PL+ L +  + F W +  + +FN+LK+ L ++PIL  P   K FIL TDASN  +GAVL Q   G ++ VIAY S+SL   E+NY    KE LA+V  I  F  YL G+KF + TDH  L+WL+  ++   ++ RW   LQEYDFEI++R G ++ NADA+SR P   S       EK  G  I  ++K +   S       E+Q  Q  D  +K  +E+ +       W+ +   + A  +Y        + +G+L + W++ +       +I+P      +L + HD A GGH    KTLS+ + +++W  +  DV+ WC  C  C  R+    + K  L+   V  AP E  A+DILGP P TTKGN+Y++V  DYFTKWPEA  IP+Q+A T+A   V + I  YG P  L +DQG NF S +F  +  L GI K  T+  HP++DG+VERFN T++N +S +V+R Q DWD  +   L AYR+A ++ TG TP  +++ R   +P D+ F  P        +Y   ++ +++SV   A   IK   E+ K  YD +A  H  K GDLV++  P+  +GLSPKLQ+ ++GPY +       +  +  RS  A P ++H NR
Sbjct:    2 LVDTGANVTLLRTDLAQKLKEQLIYTAPNISLKTATGEKTEIRGKLDASIECGSRKFHHRIYVADITDP-CILGLDFLQKFN-FTVDLEKNEIRTGGEEIPLFSASVQHSKSCSVLVKKRTIIPARSECLIQGIPEVPGQFRYAVTDFHSQVPQKGVLVAATLVDLEREAIPVRVLNLNNTP---------KILDKGAVIATCEPVVDIVARPQEFSEAQHLSSILESLEMLNEKQRREVRKLLKEFQNLFSTCDADVGHCNMTQHRINTGDHPPIKQYPRRLPLSRKEEADHLVKDMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDTLDALNGSQWFTTLDLKSGYWQVEIRPEDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLSSEACLVYLDDIIIVGRTFEEHLSNLRKVFQRLQNANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKIKAVVDWPRPETIHDLRSFLGLCTYYRRFVKNFSTIARPLHKLTETKSNFNWTEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGIGAVLSQNI-GNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGQKFLLRTDHASLRWLLNFKEPEGQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRPCGESCKHCSNAEKRFGIEIDTSVKVLTTTSVDPWSSCEIQKAQLEDPAIKTILEKKLMSADRPSWQEIAPESPATKRYWALWDSLHLKDGVLYRRWESDDGRSCRWQLILPKSRIPEVLRETHDSASGGHFGVMKTLSKTRERFYWDRLRADVEKWCRECHACGARKGPKTRTKGHLQRYNV-GAPFERMALDILGPFPVTTKGNRYVLVLMDYFTKWPEAIPIPDQEASTVAEELVRSWISGYGVPMILHSDQGTNFNSALFTELCKLLGILKTRTTALHPESDGMVERFNRTILNHLSLFVSRNQTDWDTHLPLFLLAYRSAEHEVTGLTPAEMLFGRTLRLPCDILFGRPSETPSSPNEYMKNLEARLESVHAFARERIKLASERMKTRYDSRATDHHFKEGDLVWMYNPKRRRGLSPKLQQNWEGPYTIVKKLNDVVYRVQ-RSPNAKPKVIHINR 1139          
BLAST of SMED30010523 vs. Ensembl Cavefish
Match: ENSAMXT00000048272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000106.1:219951:223307:1 gene:ENSAMXG00000032559.1 transcript:ENSAMXT00000048272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 341/934 (36.51%), Postives = 518/934 (55.46%), Query Frame = -2
Query: 4638 IPRNVK-VYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIP---------------------------------ENNSEGTPEK-----VEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQD-----WKRLTDANS----------------------KYVIHNGIL--KFWKNGEA----LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDL--KFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVY 7211
            IP +++ +Y++   V   L+   + E  +LL  Y D+F+    DLG T++++H+I LL   P+K +P R+ +  Q ESD QI    E G+   S S ++S IV+V+KKD   R CVDYR LN  T KD YP+P  Q+  + +  A++F+ +DL  GY Q  +    R   AF   KGL+ +NV+PFGL  APATFQR M+ VL G++    LVY+DDII+   D  E L+ +  VF R + A LK+KP+KC   + EV Y+GHI+S +G+ T+P+ ++KV+++P P    EVRQF+GLA+YYR+F++DF+ IA+PL+ L KK+ +F W    Q AF  LK  L +TP+L  P      IL TDASN  +GAVL Q  +G  + V+AY SR L   E+NY T  +E LA+V     FRQYLLGR F V +DH+ L+WL+  ++   +L RW   L EYDF++ +R G  + NAD MSR P                                 +N++  TP +     VE    A ++ V  +S+L  DQ +   +   +E     +K        W+ L + +                       +  + +G+L  +F+ N E      +I+P   R  +  Q HDG +GGH    +TL+R++++Y+W  M +D+  WC +C  C  +    K  + P+  + V  APME  A+D++GP+ ET + N+YI+V  DYFTKW EAYA+PN +A T+A +     + RYG P+ L +DQG NF+SE+F+ + +L G+ K  T+P+ PQ+DG VERFN TL  ++++   R   DWD      + AYR   + STG TP  +++ R+   PIDL     P        P+Y   ++++++     A   +  + E+ K+ YDK    +  ++G+ V+
Sbjct:   20 IPPHLQTLYRDSAAV---LSANDRLELAQLLSTYGDVFSTGPTDLGRTSLVQHDIQLLPGPPVKQQPRRMAFEKQIESDAQIQQSLESGLASPSNSSWASPIVLVRKKDQTYRLCVDYRALNARTVKDAYPLPRIQDTLETLSTAKWFSTLDLASGYWQVALTPRARKAVAFCSRKGLFTWNVMPFGLCNAPATFQRLMDRVLAGLQWETCLVYLDDIILLGKDVPEILQRLAQVFDRFRQANLKLKPTKCCLFRREVSYLGHIVSAQGIATDPEKVRKVQQWPQPTCVSEVRQFVGLAAYYRRFVQDFATIAKPLHELTKKHVRFQWTPECQTAFEELKSSLTSTPVLGYPRDHGNLILDTDASNFGIGAVLSQVQDG-AERVLAYGSRRLSSTEQNYCTTRRELLAVVEFTRHFRQYLLGRPFIVRSDHSSLRWLVNMKEPEGQLARWLEKLAEYDFQVVHRPGHHHQNADVMSRRPCRTTCPCNMTDPADVACKVTHRGVQCDLEPHITQNSAAATPPELRVVGVEEHHKAGVRTVTTVSQLDKDQASTLFMGWSLEDLRAAQKADPDIGPLWRWLDEGSERPTWADVSPLGPAIKAYWSQWKRLYMRDGVLVRRFYSNNETEFHPQMILPRVFRQDVQQQMHDGPVGGHFGVERTLARVQTRYYWYQMREDITLWCRTCTSCAAKARPPKTPQAPMGTVRV-GAPMERIAIDLMGPMNETDRHNRYILVAQDYFTKWVEAYALPNDQAVTVAEVLTSEWVCRYGAPQTLHSDQGSNFESEVFQKMCELLGVEKTRTTPFRPQSDGQVERFNATLQKILATTAERCHWDWDLMTPFAVMAYRATKHSSTGLTPNMMLFGRELTEPIDLVAGLPPDHDDAKTPPEYVIQLRDRLELAHNIAREVLGQSVERAKKQYDKNVLKNRYEVGEAVW 948          
BLAST of SMED30010523 vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 357/1015 (35.17%), Postives = 537/1015 (52.91%), Query Frame = -2
Query: 4635 VVKVENQIVPVHITNSSKKPVQLHPKTKLG----------KLSKMSVETNCKIPRNVKV--------------YKEPEVVSNDLNEMQKKEF---------TKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYR-IPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNK---------------FIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGIT-TFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIP-----------------------ENNSEGTPEKVEGT---------------IFAAIKAVNNMS--ELQNDQEND------------------SELKQFMEQAVKIRKEQDWKRLT---DANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQ-PPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYL 7337
            V  V+   VPV I N S +P+++ P+  +           ++ ++ +ET    P  +K               +  PE     L ++ K  F         T  + K  D+F+KH  D G T V++HEIPL+D  P ++ PYR IP        + IT M+E G+IR S SP++S IV+V KKDG LR C+DYRKLN  + +D +P+P  +E  + +GEA+YF+ +DL  GY Q  V E D+ KTAFS   GL+E N +PFGL  +P+TFQR M      +     L+Y+DDI+IFS  F+EHL+ ++ VF RL+   LK+KP KC   + EV+Y+GH++S  G++T+PD I KV  + VP++  E+ QFLG A YYR+FI+ ++ IA PL  L   + +               FIW +  +NAF TLK KL T P+L   D+++ F+L TDAS   LGAVL Q  +G ++ VIAYASR L P E  Y   + E LAL + +T  F  +L G KF+V TD+NPL+++M      +   RW   L  +DF+I+YR G  NANAD +SR+P                       +   +     V+GT               + A   A+ +MS  E++  Q  D                  S   Q  EQ   +RKE  WK+L    D   ++V       F++     +++P K R  +    HD +  GH    +T + ++ +++WP M  DVK WC  C+ C  R+     ++ PL  +    AP+E+  +D L  + ++  G + I+V  D+F++W +AY   +QKA+T+A++  +N   ++G P KL  DQG+NF+S + K +  L G  K +TSPYHPQ +G  ERFN TL+N++ +   + +  W ++I     AY    + STG TP+YLM+ R   +PIDL F   P + Y E  DY   + + ++    +A LT +H+++  K+ YD KA       GD V +
Sbjct:  103 VANVKRSCVPVRIMNLSGRPMKIWPQAPIAEVFLVKQVSERVEEVGLETIKLPPHGMKAQAHTLQAGPAQDKPHSRPERDILSLLDLSKACFETENQYLQMTDKILKNSDVFSKHHLDYGHTTVVKHEIPLVDPRPFRL-PYRKIPPSQYQAVRKAITEMEEAGVIRPSKSPYASPIVVVTKKDGSLRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFSRTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDPDKISKVAGWKVPENRHELLQFLGFAGYYRRFIEGYASIAAPLYRLTSGDPRKKKRGRKGPPAVGLPFIWTEECENAFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQVQDG-RERVIAYASRGLNPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAKLDATGQRWVAQLSMFDFDIRYRQGGCNANADGLSRMPASEVAEALHTCPQLVPTSSQKQSQEKGDSAERAVDGTSSESGSNKEPSADQFLSAGSDALPSMSKQEIRAAQRTDPVIGPVLYYKCQYAKPKRSARTQSNEQEKLLRKE--WKKLVVKDDILFRHVRDRQRGSFYQ-----LVLPEKFRGYVKSSLHDES--GHFGVERTFALVRERFYWPRMFNDVKTWCEQCERCCLRKTPTAGLRAPLVSIHT-NAPLELICIDFLT-VEKSKGGFENILVVTDHFSRWAQAYPTKDQKAETVAKVLWKNFFCKFGFPAKLHADQGRNFESTVVKELCRLTGTQKSHTSPYHPQGNGTTERFNRTLMNLMGTLPPQSKARWHEYIDALTHAYNCTRHDSTGYTPYYLMFGRHPRLPIDLVFGLAPATDYCEHSDYAKTLHDSLKYACEQANLTSRHSKDTQKKHYDVKAKVRQFTPGDRVLI 1104          
BLAST of SMED30010523 vs. Ensembl Cavefish
Match: ENSAMXT00000042253.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000503.1:15658:18693:-1 gene:ENSAMXG00000039114.1 transcript:ENSAMXT00000042253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 325/904 (35.95%), Postives = 504/904 (55.75%), Query Frame = -2
Query: 4566 LNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDE--TPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHA--LVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIP------ENNSEGTPEKVEGTIFAAIKA-------VNNMS--ELQNDQENDSELKQFMEQAVKIRKEQDW----------KRLTDANSKYVIHNGIL-KFWK---NGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQ----EKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKV 7160
            L+E Q+     L+ ++R  FA  E +   T++  H I   D   +  +    R+ +  +  +++ +  M   G+I  S+SP+S+ +V+ KKKDG+ RFCVDYR+LN VT+ D+YP+P   +  DQ+  + +F+ +DL  GY Q  + E DR KTAFS G  L+ F VLPFGL  +PATF+R M  VL GI  +  +VY+DD++    DF+  L  +E V   +++A LK+ P+KC   +  V ++GH++S  G++T+P   + V ++PVP++A  VR F+GLASYYR+FI+ F  +    + L +    F W    + AF  LK +L   P+L   +  +  + +  AS+  LGAVL Q  +G  + VIAY SR L   E+NY    +E LA+V G+  FR Y+ G  F + TDH  LQWLM+ R+   +L RW   +QE+ FE+ +R G+++ NADA+SR P      ++ +    +  E    AA+ A       V  +S  ++++ Q  D +L  +   A++      W          K L    + + + +G+L   W+   NG+ +  ++IP   RD++L   H     GH    KTL RL+ +++WP    DV+ + + C VC  ++   +  + PL P      PME  A+D+LGP P T  GN+Y++V  DYFTKWPEAYA+P+Q A T A + V     R+G P++L +DQG+NF+SE+   +  + GI K  T+P HPQ+DGLVERFN TL   ++   ++ Q+DWD  +   L A R+AV ++TG TP  LM+ R+   P+ L F  P     +  D  A + + + S+    GL  + NQ    +K K  YD +   + ++ G  V+L  P+  KGL PKLQ  + G  +V
Sbjct:   95 LSEPQQLRLRDLIERFRASFAVSERECTRTSLAFHSINTGDAQTSGWQTAAARLAFAKRVAAEQLVRDMASAGVIEPSSSPWSAPVVLAKKKDGNWRFCVDYRRLNAVTKLDSYPLPRIDDTLDQLSGSAWFSSLDLRSGYWQVPLAEGDREKTAFSLGSALWHFTVLPFGLCNSPATFERLMERVLSGIPRSCCVVYLDDVMAHGTDFDSALSHLEVVLGAIQAANLKLNPAKCNLLRQRVNFLGHVVSGAGVETDPKKTEAVRDWPVPRNAKMVRSFVGLASYYRRFIRGFRDVGGNASHLTRPGVTFRWSDEAERAFGELKSRLCNAPVLAYRNVREASLWIRIASDRGLGAVLSQVQDG-SERVIAYYSRRLDKAERNYCVTCRELLAVVEGLKHFRPYVYGVPFLLRTDHASLQWLMRFREPEGQLARWISRIQEFSFEVVHRPGRSHGNADALSRRPCVAVDCKHCARAEEKSAETAHCAAVSADVTGGVVVAQVSVEQIRDAQRADRDL-MWAVHALEANVTPSWEEVVPLGPVAKALRSNWASFSLSDGVLCHVWEDPANGQRVFRVVIPRALRDSVLRGVHGSPGAGHFGVTKTLKRLRQRFYWPGCRTDVELFVHCCDVCAAKKGPARAPRAPLHPYQC-GGPMERVAVDVLGPFPVTDSGNRYVLVAMDYFTKWPEAYAVPDQGAVTTADVLVREFFCRFGVPEELHSDQGRNFESEVMAEVCRILGIHKTRTTPLHPQSDGLVERFNCTLAAQLAMVSSKGQRDWDKHLPVVLLACRSAVQETTGFTPALLMFGRELRTPVALAFGAPPDGGEDAKDTPAFVSDLLSSLDFAHGLA-RSNQSAAGQKQKRAYDTRCFGNPLEAGARVWLYNPQRKKGLCPKLQSAWVGSCRV 994          
BLAST of SMED30010523 vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 590.112 bits (1520), Expect = 2.343e-174
Identity = 384/1161 (33.07%), Postives = 614/1161 (52.89%), Query Frame = -2
Query: 4479 LNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVY---CANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGK-------LSKMSV--ETNCKIPRNVKVYKE---PE-----------VVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRH--ALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLL-------KKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHE---KNYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLI---RWSIALQEYDFEIKYRTGKANANADAMSRIPEN---------------NSE---------GTPEKVEGTIFAAIKA-----VNNMS--ELQNDQENDSELKQFMEQAVKIR----KEQ-----DWKRLTDANSKYVIHNGIL----KFWKNGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPI--SQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKG-PYKVCDTTETNLKLLPFRSKKANPM-IVHANRCK 7685
            +N+I +L  +F  G  +   N    + S   C+    +L ++   S  L  G  I       +  AG     + +TIPP SE V    C     V     + EP   +     L + + + K  +  VPV + N S  P++L P++KL         LS+ +V  E    +     ++++   PE           V ++ L   Q +E   LL K++DIF+K + D G T  + H IP  D  P+K +  R+P     E  + + ++ + GI+ +S SP++S  VIV KKDG +RFC DYR+LNQVT KD YP+P  +E  D +G A++F+ +DL  GY Q  VK+ DR KTA +   GL++++ +PFGL  APATFQR M  VL  +     LVY+DDIIIFS DF+ H + +E VF RL+   LK+KPSKC   K EV ++GHIIS +G+Q + + ++ +E +P+PK   ++RQ LG  SYYR+F+  F+ +A+PL+ L+       +      W    Q AF+ LK  L++ P+L  PDFT+ FIL TD S   LGAVL QK +G  + VIAYASR LR  E   KNYS  + E LAL + +T  FR +L+  KF+V TDHNPL++L    DSA+  +   RW   + EY+F+I Y+ G+ NANAD +SR+P +               N+E             +VE  +  A++A     V+  S  E++  Q+ D +++      ++ +     EQ       ++L+    +  + +G L       ++GE +  +I+P   +  +    H+   GGH   R TL  ++  Y+WP+M +DV++W   CK C   ++   + + P+    V +AP+E+ AMD    L  ++ G + ++V  D FT++  A    NQ A T A+  +++    YG P +L +DQG+NF+S + K +  L+GI K  TSPYHPQ +   ERFN TL +M+ +    K+++W +++   +  Y + V+ STG +PFYL++ R   +P+D+     +  S +  + D+     EK+++    A    +    + K  YD+K++   ++ GD V L   +P +G + K+Q  ++  PY V     T++ +   + ++     +VH ++ K
Sbjct:  491 MNVISELQDVFMTGGEVKQMNRY-SQHSEEACV--RRVLARVGKESQYLGPGGKIG-----FVRMAG----REAVTIPPFSERVLEGRCRVPPKV-TCQVLVEPAPKVNMPKGLMVANVLAKAADGKVPVRVLNVSGCPIRLMPRSKLASVHKPQEVLSRQTVVLEEGDGVLHVRAIHRDDLVPECNEGQLPVPVQVNADGLTSSQYQELMDLLEKHKDIFSKSDSDFGYTTAVTHSIPTGDAPPVKQRHRRVPPQVFQEFKKHVQSLVDRGILEESCSPWASPAVIVIKKDGTVRFCCDYRRLNQVTCKDAYPLPRVEESLDALGNAQWFSTLDLTAGYFQVAVKDSDREKTAVTTPFGLFQWSRMPFGLCNAPATFQRLMGVVLGDLAFDILLVYLDDIIIFSRDFKSHCERLELVFNRLRHHGLKLKPSKCFLLKPEVKFLGHIISAKGVQVDAEKVRVLETWPIPKTVKDIRQVLGFMSYYRRFVPKFAQLAKPLHALVGGKMNRGRATGPITWSGECQTAFDKLKGCLMSPPVLAYPDFTQPFILTTDGSLHGLGAVLSQK-QGGTERVIAYASRGLRGSEKNDKNYSAFKLELLALKWAVTEKFRDFLMFAKFSVVTDHNPLRYL----DSANLGVVEQRWVAQMAEYNFDISYKPGRQNANADVLSRLPAHEEPEAKDTGKDFILINTEEVRACLWPAAERREVEPAVHVAVQASIRKGVSGYSWGEIEEQQKCDPDIRPVYSAVLRGKNLSPAEQRAMTPKLRKLSKQFDRLKLRHGALFRCICHPRDGEGVWQLIVPESLQRKVYESQHEH--GGHFGERSTLEMMRQSYYWPSMSRDVQDWIKQCKRCALAKDVLPRNRAPMTCSSV-SAPLEVLAMDYT-LLERSSGGYENVLVLTDMFTRFTVAVPTKNQTAHTTAKALLKHWFVHYGCPARLHSDQGRNFESHVIKELCKLYGIAKSRTSPYHPQGNANCERFNRTLHDMLRTLPPEKKRNWKEYLPELVMVYNSHVHSSTGYSPFYLLFGRDARLPLDVLGGKDLEDSDFDNLDDWVKSHHEKLKTSAEIAKAASQEASRRRKRVYDRKSYGALLRPGDRVLLRNHKP-RGRN-KIQDKWESHPYIVLKQNHTDIPVYTIQPERGGQTKVVHRDQLK 1627          
BLAST of SMED30010523 vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 577.4 bits (1487), Expect = 2.370e-173
Identity = 316/924 (34.20%), Postives = 523/924 (56.60%), Query Frame = -2
Query: 4824 DLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQ---------------------KKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVL--RGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLL-----------KKNNKFI---WGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEK---NYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEG-------------------TPEKVEGTIFAAIKAVNNMS--ELQNDQENDSELKQF--------MEQAVKIRKEQD--------WKRLTDANSKYVIHNGI-LKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPID 7358
            DL +   +V V   ++ V + N   +   L PKT LG+L  + + +    P+ V+V+++ +     +  +Q                     +++   LLR+++++F++H  DLG T +++H IPLLD  P++ +  R+P    D     I  + E  ++R S+SP++S IV+V+KKDG +R CVDYR+LN  TRKD +P+P  +E  D +  +++F+ +DL  GYNQ  V E+D+ KTAF    GL+EFN +PFGL  AP+TFQR M  +   +     L+Y+DDI+IFS+D ++HL+ ++ V  RL+   LK+K  KC + +  V Y+GH+IS  G++T+P+ I+ V ++  P    EVR FLG ASYYR+F++ F+ +A PL+ L+            K +  +   W ++ + +F  LK++LV  P+L   DFT+ FI+  DAS+  LGAVL Q+ EG K   IA+ASR LRP E+   NYS+++ E LAL + +T  FR+YLLG +FTVYTD+NPL +L   + +A +  RW+  L  +++E+KYR G +N NADA+SR+P +  +                    T  + +  I + + A+ + S  +LQ  Q  D  +  F           A ++R E++        W+R+ +     V++  + L   K+    +++P   +  +L+  HD    GH    +T   ++ + +WP M QD+K WC  C+ C   +    K++  +  + +   P+E+ AMD    L   + G + ++V  D F+K+ +AYA+ +QKA T+ R+ VE   + YG PK++ +DQG++F+ E+ K + + +GI K  T+PYHP+ +G  ERFN TL +++ +    K++ W   +   LFAY   ++QST  +P+ L++ +K  +PID
Sbjct:  229 DLLVPSALVSVGKGVLQVPVVNVGDQDRWLQPKTVLGELHVVQLMST---PKEVQVHRDDQGHVATVQSVQAERDSSIDFLQLSWPALSAQDQEQARALLRRHQNLFSEHAGDLGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVVQKKDGSIRLCVDYRQLNAKTRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYLGHVISESGVETDPEKIRAVVDWKRPTTVKEVRSFLGFASYYRRFVEGFAALAAPLHKLVGALQGSKKQPRSKMHSIVIPHWDEVCETSFRALKDRLVRAPVLGFADFTRPFIVEIDASHTGLGAVLSQEQEG-KRRPIAFASRGLRPSERNMSNYSSMKLELLALKWAVTEKFREYLLGTQFTVYTDNNPLSYLQSAKLAAVEQ-RWASQLALFNYELKYRPGTSNGNADALSRLPADTDQSSVGVRGISVPPEVPLADKETASRSQVVISSTVDAIPSRSSVDLQILQAADPLIAAFSVYWRRGQAPTARELRNEREGVKELVRQWQRIVERQG--VLYRSVQLPPAKHTVFQLVLPKALQTEVLLALHDQH--GHQGMERTTDLVRQRCYWPKMWQDIKKWCTECERCSIAKAMHPKVRTFMGSL-LATRPLEILAMD-FTVLERASNGQENVLVLTDVFSKFTQAYAVADQKASTVVRVLVEKWFYVYGVPKRIHSDQGRSFEGELLKHLCETYGIEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPPEKKRKWPQLLPHLLFAYNTTIHQSTQYSPYELLFGQKPQLPID 1141          
BLAST of SMED30010523 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.124e-33
Identity = 79/276 (28.62%), Postives = 142/276 (51.45%), Query Frame = -2
Query: 4830 KRLTDANSKYVIHNGILKFW---KNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTG-KKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIF-RYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLV-------ERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMP 5621
            + L    +K+V+   +L +    +    ++++    +  +LM  H     GH   +KT+ +L++ Y+W  M  DVKN   SC VC   RN G +++ +P   +   + P E+  +D+LGPLP T++ N+Y+++  DYF+KW EA  +  +  + +A      ++F RYG P+K+ +  GK F +++ KS T L   ++   SP   Q    V       +  N  L   ++   ++   DW+  ++  LF YR   + +T  +PFYLM+ R+  +P
Sbjct:   42 RALRKCANKFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC---RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASAL--TVVFCRYGFPRKVFSSLGKEFVTQVNKSST-LSRAYQ-RCSPSQTQVHAHVSVRVALNKATNQALKGCVNLVASQHPSDWESRVEQSLFEYRVGKHSTTQYSPFYLMFGREARLP 307          
BLAST of SMED30010523 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 1.497e-30
Identity = 75/276 (27.17%), Postives = 141/276 (51.09%), Query Frame = -2
Query: 4833 KRLTDANSKYVIHNGILKFW---KNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTG-KKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIF-RYGTPKKLLTDQGKNFQSEMFK------SITDLFGIWKLNTSP--YHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNM 5621
            + L    +K+V+   +L +    +    ++++    +  +LM  H     GH   +KT+ +L++ Y+W  M  DVKN   SC VC   RN G +++ +P   +   + P E+  +D+LGPLP T++ N+Y+++  DYF+KW EA  +  +  + +A      ++F RYG P+K+ +  GK F +++ K       I+           P  +H  T+  ++      +N+++S   +   DW+  ++  LF YR   + +T  +PFYLM+ R+  +
Sbjct:   42 RALRKCANKFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC---RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASAL--TVVFCRYGFPRKVFSSLGKEFVTQVNKIQHKKWCISHTLQNLCETRGPAGWHKATNQALK----GCVNLVAS---QHPSDWESRVEQSLFEYRVGKHSTTQYSPFYLMFGREARL 302          
BLAST of SMED30010523 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009777.1 (pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-1 gene:ENSPMAG00000008837.1 transcript:ENSPMAT00000009777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 6.693e-26
Identity = 62/243 (25.51%), Postives = 120/243 (49.38%), Query Frame = -2
Query: 4830 LIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNF----QSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMP 5546
            L+++  + + ++L + H     G   TRK L   +  Y+W  M  D++++ N+C++C  ++ + K+  +    +   + P E+  MD+LGP P T++ ++++++  DYFTKW E   + +Q A  +          R+G PKKL  +  + +      EMF+      G+     +  H   +G     +  L + +S    R  +DW+  ++  LF Y  + + +T  +PFYLM  R+  +P
Sbjct:   62 LVVMNEEDKRSILQRVHGADHCGQTRTRKLL---EEHYYWKGMVNDIRDYINACEIC--KQKSYKRSSISHVKLLKASYPWEVLGMDLLGPFPATSRAHRFVLLIVDYFTKWAELTPMTDQSAAHVVAALT-TAFHRFGFPKKLFCNVSEEYVAQINEEMFRHFPMCSGL-----AISHLWANGAHRGTSQALRDCVSKATGR-HRDWELQLEQRLFEYHTSKHSATRYSPFYLMLGREARLP 292          
BLAST of SMED30010523 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010393.1 (pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 gene:ENSPMAG00000009411.1 transcript:ENSPMAT00000010393.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.906e-6
Identity = 26/92 (28.26%), Postives = 36/92 (39.13%), Query Frame = -2
Query: 12162 CEHCKKSGHYSNQCWFKYGKNPSPNKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSC 12437
            C  C + GH + +C       P P    + N        CY CGK GHI+R C                + +  G   C++C   GH+AR C
Sbjct:   10 CYRCGEGGHIAREC-------PLPQDSVSSNT-----AACYNCGKGGHIAREC-------------PEGRQDRGGGPSCYTCGKQGHLAREC 76          
BLAST of SMED30010523 vs. Ensembl Nematostella
Match: EDO36176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG4])

HSP 1 Score: 59.6918 bits (143), Expect = 6.707e-10
Identity = 27/96 (28.12%), Postives = 43/96 (44.79%), Query Frame = -2
Query: 12150 CEHCKKSGHYSNQCWFKYGKNPSPNKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNS 12437
            C  C ++GH+S +C       P+   +    KR+     C++CGK+GH SR C  +           +   + +G   CH C   GH +R CP  +
Sbjct:   22 CHQCGEAGHFSREC-------PNKGNQGEPIKRMGGGGACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGRNCHKCGQEGHFSRECPNQA 110          

HSP 2 Score: 48.9062 bits (115), Expect = 3.544e-6
Identity = 27/93 (29.03%), Postives = 40/93 (43.01%), Query Frame = -2
Query: 12159 CEHCKKSGHYSNQCWFKYGKNPSPNKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCP 12437
            C  C K GH+S +C  +  +  +       +  IS    C++CG++GH SR C       + +   Q D         CH C   GH +R CP
Sbjct:   54 CHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGRNCHKCGQEGHFSREC------PNQAIQGQSDT--------CHKCGETGHYSRECP 132          
BLAST of SMED30010523 vs. Ensembl Nematostella
Match: EDO33875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR01])

HSP 1 Score: 56.9954 bits (136), Expect = 1.896e-9
Identity = 23/86 (26.74%), Postives = 54/86 (62.79%), Query Frame = -2
Query: 6318 DDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASY 6575
            DD+I F + FEEHL+ +E + + ++++  K    K ++    V ++GH+I + G++  P+ +  + ++  P + +E+R+F+G+ ++
Sbjct:    1 DDVICFHSSFEEHLRGIERMLQAVRASGFK-SIKKSQFATRSVKFLGHVIDQNGVRPQPEKL-DIRQWETPTNEEELRKFIGVCTF 84          
BLAST of SMED30010523 vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 430/1310 (32.82%), Postives = 668/1310 (50.99%), Query Frame = -2
Query: 4356 LPCNYSMMTLTKRGKQPR--IFIQMNKHKVE--ALVDSGSSHTIISENVLN-VKEKMQ--IKP-TDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGS-PVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNG-----------------DFIFEPNQTLVEKYDLPICDEVVKVENQI-VPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKI----------PRNVKVYKEPEVVSN-------DLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIR--HALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR----------IPE------------------------------------------NNSEGTPEK----VEGTIFAAIKAVNNMS--ELQNDQENDSELK---QFMEQAVKIRKEQDWKRLTDANSKY-------VIHNGIL--KFW-KNGEALI---IIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQ-PPISQYMEI-PDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVY--LNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKK---ANPMIVHANRCKLVPEEDESRYPLRSK-----QNKVTGQTKLKQKFTKNPTPVSYINK 7889
            LP      T+    K P   + +Q+  H V   AL+DSG+   ++  ++ + +   +Q  I P T   ++ +    L ++G++++  ++G R+I+ N +I   +     ++G   L Q     LD  +         K I   GE          P + +V  A T  ++ G                 D +  P +  V K+ + +   VV+    + +P+ + N S  PV L      G L    V    ++          P N   +  P+ +++       +L E  +     LLR Y D+F+    DLG TNV++H+I     + +K +P R+    Q+ +D+Q+    E G+ R S S +++ IV+VKKKD   R CVDYR LN  T KD YP+P  Q+  D +  A+YF+ +DL  GY Q  +    R   AF   KGL+E+NV+PFGL  APATFQR M+ VL G++    LVY+DDII+   +  + ++ +E VF RL+ A LK+KPSKC   + +V Y+GH++S +G+ T+P  I+KV+++P+PK+  EVRQF+GLASYYR+F+ DF+ IA+PL+ L KK  +F W    Q AF  LKE+L + PIL  P  + + +L TDAS+  +GAVL Q  +G ++ V+AY SR L   E+NY T  +E LA+V   + FRQYLLGR F + TDH+ L+WL + ++   +L RW   L EYDF++ +R GK + NADA+SR          +P+                                          N++   P++    V+ T  A +   +  +  ELQ  Q+ DS++     F +Q        +   L+ A   Y          NG+L  KF+ K+G+ L    ++P  +R  ++   H+G +GGH    +TL RLK++Y+W  M  DV  +C +C  C  R    K  + P+  + V  APME  A+D++GPL ET + N+YI+V  DYF+KW EAY +PN++A T+A   V   + RYG P +L +DQG NF+S +F+ + +L GI K  T+P+ PQ+DG VERFN TL   +++   R   DWD  I   L  YR   + STG TP  +++ R+   P+DL    PP +  ++  P+Y   ++++++     A   +    E+ K  YDK       KIGD V+  L   + +K    K    ++GPY V D    +L  L +R KK   +   IVH ++ KL      SR PL        Q   T + +  Q   ++  P++  N+
Sbjct:  512 LPSTNGNNTVVIYAKSPEEEMCVQIMIHGVRMCALLDSGARRKVLPLHLFHLIPNGIQPPISPSTVHTLQGIGPEGLAVLGEVDLPVNVGCRVISVNFIIADTTESTEVILGHPFLLQTQAC-LDYGS---------KEITLFGEKVPPFKPDPQPATHLVRVARTTVLEAGCEYIVPGTSQAGFATSEDLMLSPAKAFVSKHHVMVARSVVQPSQSLCIPIRVFNPSTSPVTLKKGVVAGVLQPAQVVGKVELSRPKDQPSHDPGNSFSFSVPQHLTDLYEESCANLPEESRYRLAGLLRSYSDVFSAGSTDLGRTNVVQHDILTTPGSAVKQQPRRMSREKQEAADQQVQQSLEAGLARHSNSSWAAPIVMVKKKDQSPRLCVDYRPLNDRTIKDAYPLPRIQDTLDTLSTAKYFSTLDLTSGYWQVEMTPRARKAAAFCTRKGLFEWNVMPFGLCNAPATFQRLMDRVLAGLQWEACLVYLDDIIVLGCNSNQMMERLEQVFTRLRQANLKLKPSKCRLFQEQVAYLGHVVSAQGISTDPQKIQKVQDWPIPKNISEVRQFVGLASYYRRFVADFATIARPLHELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQ-VQGGEERVLAYGSRRLTTTEQNYCTTRRELLAVVEFTSHFRQYLLGRSFVLRTDHSSLRWLTRLKEPEGQLARWLEKLAEYDFQVLHRPGKVHQNADALSRRPCRELCACKLPDPSTDSNTSQDKQVQCEFDDIVAETTISVVRPVGVAMIDQHDGNDAAVDPQRTLVGVDNTTSAPVPVFSGWTHEELQAAQKADSDMAPVFAFRQQGDDRPPWAEIASLSPATKAYWAQWKRLFFKNGVLMRKFYCKDGKMLFAQTLLPKTYRHTVMQHLHEGPIGGHFGAERTLGRLKTRYYWYNMRDDVTLFCQTCASCACRARPKKTPQAPMGSVRV-GAPMERIAVDVMGPLNETDRHNRYILVVQDYFSKWVEAYPVPNEQATTVAEKIVSEWVCRYGAPYELHSDQGANFESAVFQGMCELLGINKTRTTPFRPQSDGQVERFNATLQKTLAATAERCHWDWDIMIPYALMPYRATKHSSTGLTPNMMLFGREITEPMDLVVGLPPENLTVDTAPEYVQRLRQRLELSHQLARSVLGRAVERAKRQYDKNICQVQYKIGDAVWYLLKGTKRVKNKVRKFLPSYEGPYFVVD----HLDDLVYRIKKGPRSKAKIVHHDKLKLY----HSRVPLDGSWVSRTQENCTQRKQKHQSLGEDYGPLTLWNE 1801          
BLAST of SMED30010523 vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 343/907 (37.82%), Postives = 519/907 (57.22%), Query Frame = -2
Query: 4566 NDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDG-DLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIP-----------ENNSEGTPEKVEGT--------IFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDAN--SKYV--------IHNGIL-KFWK---NGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEI--PDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKV 7166
            + L   QK E  K+L +YRDIFA  E ++GLT+++ HEI   D  PIK +P R+P  HQ  +D  I  M   GII  S SP++S +V+VKKK G  +RFCVDYR LN VT+KD+YP+P   E  D +  + +F+ +DL  GY Q  +    R KTAF  G+GL++F VL FGL  APATF+R M  VL  I  +  LVY+DDI++    F+  L+ +  V +R+ +A LK+ P KC + + E+ ++GH I   G+ T  + ++ V ++P P    +++ FLGLASYYR+F++ FS IA PL  L +K+  F+W Q  + AF++LK+ L  +PIL  PD    FIL TDAS+V +GAVL Q      + V+AY S++L   E+ Y    +E LA+V  I  FR YL G  FTV TDH+ LQWLM  ++   ++ RW   L  + F +++R G  +ANADAMSR P               E    + E +        +   ++ V++ +E +  QE D +L+  + Q V+  ++ +W  +   +  SK +        + +G+L + WK    GE    +++P   R+++L   H  A  GH    KTL R++  ++W  + +DV+++C  C +C   +    + +  L+ +    APME  A+DI+GP P T +GN++++V  DYFTKWPEAYAIP+Q+A T+A   VE +  R+G  + + +DQG+NF+S +F ++ +  G+ K  T+P HPQ+DGLVERFN TL+  ++   +  Q DWD+ +   L AYR+AV  ST  TP  LM  R+   P ++ F  P         P+Y   +Q++M +    A   ++    + K  YD +A     K GDLV++  P+  KG  PKL   + GP +V
Sbjct:  227 DGLQPGQKDELWKVLLEYRDIFALSEDEVGLTHLVHHEIDTGDARPIKTRPRRLPLAHQVAADSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLSFGLCNAPATFERLMEKVLASIPRQECLVYLDDILVHGGSFKAALESLRKVLQRIAAAGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTPTTLRDLKSFLGLASYYRRFVRGFSCIAAPLFHLQRKDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQ-MGSAGERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLMTFKEPEGQIARWLEELASFSFTVEHRPGSRHANADAMSRRPCALAGCQYCEKREAREAVISREEQSHTGESSWPVCRLVQGVDS-TEWRAHQEQDVDLQPVL-QWVEAGRKPEWGEVAGCSPGSKGLFEKFDALRLKDGVLQRAWKEPATGEERWQVVVPRTLRNSVLQGCHGAAGSGHFGVSKTLRRIRQGFYWGQLRRDVEDFCRRCDICTAHKGPPDRSRAELQQLAA-GAPMERVAVDIMGPFPRTNRGNRFVLVAMDYFTKWPEAYAIPDQEAVTVADALVEGMFSRFGAAEVIHSDQGRNFESAVFSAMCERLGMRKTRTTPLHPQSDGLVERFNRTLVKQLAILTSAHQSDWDEHLPLVLMAYRSAVQDSTLCTPALLMLGRELRTPAEMSFGKPPDALGAPPGPEYARKLQDRMDTAHAFARNQLEKAGIRQKRNYDLRAKGKDFKAGDLVWVYNPKRKKGRCPKLDCQWVGPCEV 1129          
BLAST of SMED30010523 vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 575.474 bits (1482), Expect = 1.370e-172
Identity = 375/1180 (31.78%), Postives = 619/1180 (52.46%), Query Frame = -2
Query: 4647 PRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKP-TDEIVRSL------SKNELNI--IGQLNVIFHIGDRIIAHNALIM-----KGSPVRC--LIGMDILEQLDGVSLDLKTGNLIAGET-----GKIIHRAGEVFVNQTLTIPPQ----------------SEMVYCANTMS--VDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNV-KVYKE--------------PEVVSNDLNEMQKKEFTK---LLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVL--RGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLL---------KKNNKFI---WGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEK---NYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR-----------------IPENNSEGTPEKVEGTIFAAIKAV--NNMSELQNDQENDSELKQFM---EQAVKIRKEQ-------------DWKRLTDANSKYVIHNGILKFWKNGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDL---KFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGD 7841
            P + + M    +  LVD+GS  + I+E+      K   +P   E +RS       + N L I  +G L +   +  +++    +++      G P++   ++GM+I+++     L  + G+ + G++       +I  A +       T+ P                   +   A T S        +FEP  + +    L     +V+VE     + I N     V+LHP+T +G ++   V     +P+ V +V  E               ++ S DL+ +   E  K   LL KY  +F+ HE DLG T++I HEIPL+D+ P++ +  RIP      +   I  + +  +IR+S+SPF+S IV+++KKDG LR CVDYR+LN  TRKD +P+P  +E  D +  AR+F+ +DL  GY+Q  V E DR KTAF    GL+E+N +PFGL  AP+TFQR M  +   +  +  L+Y+DDII+FS+  E+HL+ +E V +RL+   LK+K +KC + + +V Y+GH+IS +G+ T+P  ++ V  +  P    ++R F+G ASYYR+F++ F+ +A PL+ L+         KK+ + +   W +  Q +F  LK KL TTP+L   DF++ FIL  DASN  LGAVL Q+ EG K   IAYASR LRP E+   NYS++  E LAL + +   FR+YLLG+K  VYTD+NPL +L   +  A +  RW+  L  +D EI+YR+G++N NADA+SR                 +P +  +    +  GT  A + A+  ++ S++ + Q  D  LK+F+   E+  +   E+              W RL +     V++  + +    GEA+  I++P   R+ +L   H     GH    +TL  L+ + +WP M  +V  WC+ C+ C   + T    + P+  + + + P E+ AMD    L  TT G + ++V  D F+K+  A A  +Q+A T+A++ V     ++G P ++ +DQG++F+S + + + DL+ + K  T+PYHP+ +G  ERFN TL +++ +    +++DW+  +   L++Y    + STGE+PF+LM+ ++  +P+D    + Q P+         +  +QE +Q    +  L  +  +EK     D++   H   + D
Sbjct:   29 PHLQVCMGGRSISCLVDTGSMVSTITESFF----KQNFEPWGPERLRSCQWLQLRAANGLAIPYLGYLELEVGLCGKLLPQCGVLVVKDIPGGGPLQAPGVLGMNIIQRCYQ-ELFAQYGSALFGQSEVSTAPDVIFGALKQCQQAQATVTPSMFNVRTRGRKARWISGGVLAIVAATCSEQCAGSAVLFEPCSSGLPA-GLLATPSLVRVERGTAYIPIINVGSTAVRLHPRTLVGTVAPAGV---VSLPKEVTEVQSEAAVVAAHAASTLPLAQLESVDLSALSAGEQEKVRTLLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEG-KVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAKLGAMEQ-RWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLSSPTLALLRQWNRLVEQGG--VLYRRVFRD-DGGEAVLQILLPGSIREEVLTAVHQQH--GHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHL-LASKPNEILAMD-FSVLEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQEPRLPVDFLLGRVQEPV---------EGTVQEWVQEHKARLKLAFEGTREKLLAAADRRKRGHDEGVRD 1181          
BLAST of SMED30010523 vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 575.474 bits (1482), Expect = 1.449e-172
Identity = 375/1180 (31.78%), Postives = 619/1180 (52.46%), Query Frame = -2
Query: 4647 PRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKP-TDEIVRSL------SKNELNI--IGQLNVIFHIGDRIIAHNALIM-----KGSPVRC--LIGMDILEQLDGVSLDLKTGNLIAGET-----GKIIHRAGEVFVNQTLTIPPQ----------------SEMVYCANTMS--VDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNV-KVYKE--------------PEVVSNDLNEMQKKEFTK---LLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVL--RGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLL---------KKNNKFI---WGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEK---NYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSR-----------------IPENNSEGTPEKVEGTIFAAIKAV--NNMSELQNDQENDSELKQFM---EQAVKIRKEQ-------------DWKRLTDANSKYVIHNGILKFWKNGEAL--IIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDL---KFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGD 7841
            P + + M    +  LVD+GS  + I+E+      K   +P   E +RS       + N L I  +G L +   +  +++    +++      G P++   ++GM+I+++     L  + G+ + G++       +I  A +       T+ P                   +   A T S        +FEP  + +    L     +V+VE     + I N     V+LHP+T +G ++   V     +P+ V +V  E               ++ S DL+ +   E  K   LL KY  +F+ HE DLG T++I HEIPL+D+ P++ +  RIP      +   I  + +  +IR+S+SPF+S IV+++KKDG LR CVDYR+LN  TRKD +P+P  +E  D +  AR+F+ +DL  GY+Q  V E DR KTAF    GL+E+N +PFGL  AP+TFQR M  +   +  +  L+Y+DDII+FS+  E+HL+ +E V +RL+   LK+K +KC + + +V Y+GH+IS +G+ T+P  ++ V  +  P    ++R F+G ASYYR+F++ F+ +A PL+ L+         KK+ + +   W +  Q +F  LK KL TTP+L   DF++ FIL  DASN  LGAVL Q+ EG K   IAYASR LRP E+   NYS++  E LAL + +   FR+YLLG+K  VYTD+NPL +L   +  A +  RW+  L  +D EI+YR+G++N NADA+SR                 +P +  +    +  GT  A + A+  ++ S++ + Q  D  LK+F+   E+  +   E+              W RL +     V++  + +    GEA+  I++P   R+ +L   H     GH    +TL  L+ + +WP M  +V  WC+ C+ C   + T    + P+  + + + P E+ AMD    L  TT G + ++V  D F+K+  A A  +Q+A T+A++ V     ++G P ++ +DQG++F+S + + + DL+ + K  T+PYHP+ +G  ERFN TL +++ +    +++DW+  +   L++Y    + STGE+PF+LM+ ++  +P+D    + Q P+         +  +QE +Q    +  L  +  +EK     D++   H   + D
Sbjct:   29 PHLQVCMGGRSISCLVDTGSMVSTITESFF----KQNFEPWGPERLRSCQWLQLRAANGLAIPYLGYLELEVGLCGKLLPQCGVLVVKDIPGGGPLQAPGVLGMNIIQRCYQ-ELFAQYGSALFGQSEVSTAPDVIFGALKQCQQAQATVTPSMFNVRTRGRKARWISGGVLAIVAATCSEQCAGSAVLFEPCSSGLPA-GLLATPSLVRVERGTAYIPIINVGSTAVRLHPRTLVGTVAPAGV---VSLPKEVTEVQSEAAVVAAHAASTLPLAQLESVDLSALSAGEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEG-KVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAKLGAMEQ-RWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLSSPTLALLRQWNRLVEQGG--VLYRRVFRD-DGGEAVLQILLPGSIREEVLTAVHQQH--GHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHL-LASKPNEILAMD-FSVLEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQEPRLPVDFLLGRVQEPV---------EGTVQEWVQEHKARLKLAFEGTREKLLAAADRRKRGHDEGVRD 1181          
BLAST of SMED30010523 vs. Ensembl Medaka
Match: ENSORLT00000044989.1 (pep primary_assembly:ASM223467v1:1:17572028:17576089:-1 gene:ENSORLG00000028051.1 transcript:ENSORLT00000044989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 558.91 bits (1439), Expect = 2.567e-167
Identity = 370/1109 (33.36%), Postives = 579/1109 (52.21%), Query Frame = -2
Query: 4629 LIGMDILE---QLDGVSLDLKTGNLIAGETGKIIHR-----------AGEVFVNQTLTIPPQS-EMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKM-SVETNCKIPRN--------VKVYKEPEVVSNDLNEM------------QKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYR-IPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGI--RHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPL----NTLLKKNN--------KFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEK---NYSTIEKETLALVYGITT-FRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRI-----PENNSE---------------GT---PEKV----------EGTIFAAIKAVNNMS--------------ELQNDQENDSELK---QFMEQAVKIRKEQ-------------DWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPID-LKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYD---KKAHAHGIKIGDLVYLNR 7589
            LIGM++++   +L   SLD   G  +     + + +           A  V       +P  S   VY        +G  + EP  T +    L +   +V V  ++ PV + N S++ + L PKT+LG LSK+  VE   ++  N        V + ++   VS D   +            Q+    KL+ +Y D+FA  + DLG  + I+HEI L D+ P+  +PYR +P     E    I  +   G+I++S S ++S IV+V+K D  LR CVDYR+LN  TR+D +P+P   E FD +  A++F+ IDL  GY+Q  V E DR KTAF    GL+E+  LPFG+   PATFQR M   +  +  +  LVY+DDI+++S  F+ HL  ++TVF+RL+   LK+K  KC + ++ V ++GH IS  G+ T+PD +  V+++PVP    E+R FLG  SYYR+F++ FS +A PL    NT L ++N        K +W    Q++F  LKE+L + P+L   +F+  FIL TDAS++ LGAVL Q  +GEK  VIAYASR LR  EK   NYS+++ E LAL + ++  FR YLLG KFTV TD+NPL  L   R  A +  RW   L  +DF+++YR G+ NA ADA+SR      PE N +               GT   P+ V          E    AA + V N                EL+  Q+ D  +K   QF +Q  K   +Q              W R+ D +   +++  I    K     +++P   +D++L   H+    GH    +T + LK + FW  M +DV+ W   C+ CI  +     I+ P+K   +   P+E+ A+D    L   + G + ++V  D FTK+ +A+   +QKADT A++ +     +YG P++L +DQG+NF+SE+ + +  L+G+ K  T+P+HPQ +   ERFN TL +++ +    K++ W +++   ++AY    + +TG +P+YL+Y    ++P+D L  Q  +       D+  + QE++     +   T +++++K  E  +    K +   ++IG LVYL +
Sbjct:   51 LIGMNVIKRCKELSIASLDSTLGGQLDSAWKETLQKLQMDDGAEKVSAARVASKNATHVPAASVATVYAKRGTKHSHGLLLLEPTNTPMPS-GLIVIPTLVDVAKRVFPVQVVNLSEEDLWLSPKTRLGILSKVECVEPAAEVSFNRISADHEEVTIEQKEASVSEDAPHLLLDHLKIGGTTEQQTRLAKLISQYTDVFALSDEDLGYADRIQHEIHLTDDVPV-TQPYRRVPPTQYKEVKDHIAQLLRKGVIQESTSAYASPIVLVRKADNSLRLCVDYRRLNAKTRRDAFPLPRIDECFDALHGAKFFSTIDLASGYHQVAVHENDRHKTAFITPFGLFEYTRLPFGVCNGPATFQRLMQATMSDLVFQIMLVYLDDILVYSPTFDGHLTRLQTVFQRLRETGLKVKVEKCNFLQSSVRFLGHQISADGIGTDPDKVAAVKQWPVPASVKELRSFLGFCSYYRRFLQGFSQLAGPLHDAVNTCLNQSNMSRSKNLFKSVWTAECQDSFEELKERLTSAPLLGYANFSLPFILETDASSLGLGAVLYQIQDGEK-RVIAYASRRLRGAEKNDRNYSSMKLELLALKWAVSEKFRGYLLGAKFTVMTDNNPLCHLDSARLGAVEQ-RWIAQLAPFDFDVRYRPGRCNAAADALSRQPLAGEPETNGDDEFDGCISICNMIQRGTSLDPDLVCEGIKCCQVREMRATAAEQVVENKDLQGNTPTLPGYSKEELRQFQQTDPTIKSFCQFWDQKTKPTYQQRRSLAKPVISLLRQWSRIIDVDG--LLYRVIEDDHKLECQQLLLPECLKDSVLESVHNQM--GHQGIERTQNLLKQRCFWVGMYEDVERWVKQCERCILTKLPQPHIRTPMKHF-LATRPLEVVAVD-FTLLEPASDGRENVLVVTDVFTKFTQAFPTRDQKADTTAKVLLREWFMKYGVPERLHSDQGRNFESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPPEKKRRWPEYLPELIYAYNVTPHATTGYSPYYLLYGVHPHLPVDALLNQDQVVDRKH--DWLVVHQERLHEAHNR---TRQYSEQKAAERLELEKSKVYCPPVEIGQLVYLRQ 1144          
BLAST of SMED30010523 vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 1426.38 bits (3691), Expect = 0.000e+0
Identity = 708/1120 (63.21%), Postives = 862/1120 (76.96%), Query Frame = -2
Query: 4959 ARFFITHHQYQELEILKARIL--KKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQELSGMNKEALRTYQILKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEGMVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENN-SEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNKYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQGKNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSY 8309
            ARFFITHHQY+E+  ++A++   +K +VS  + +   ++NND+ N+      Y     +    K  L   Q L EP+   S ++T +K   P +F+  AP YP ++L+EMKPVE+I  + +      IEP+SAEIERKNMLGLPC+Y+MMTL  +GKQPRI I  N+ KVE+L+DSGSS+TI+S+++L ++EK ++KPT +++RS+S N L+IIG+L     IGD  + H+  +M+ SPV CLIGMD++EQL G+SLDLKTG L+ G+T +  H+  EVF+NQTL +P +SE++Y A+ + V + + IFEPN+ L+EKY++P+CDEVVKV++Q VPV I N + KP+Q+ PKTKLGKL+K  +E   K+PRN+K+YK+P+V+SNDL E QK EFT+LL+KY+ +FAKHEYDLGLT VIEHEIPLLDETPIK+KPYRIPY+HQ+ESDRQI AMKEF IIRDS+SPFSSSI +VKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGE ++FTVIDLNKGYNQF+VKEEDR KTAFSDGKGLYEFNVLPFGLTGAPATFQRGMN+VLR I HALVYIDDIIIFSN F+EHLKDVETVF+RL  A LKIKPSKCEWGK+EV+YVGHIISR GLQ NP+N+KK++EYP+P++ D+VRQFLGLASYYRKFIK FSH+AQPLN LLKK  +F WG+ QQ AF  LK+ L+  PILRCP+F   FILMTDASN ALGAVLGQ+ EGEKDHVIAYASR+L+PHEKNYSTIEKETLAL YGI T                                            +IK++ G A  N       P NN S+        TIF AIK  NN+ ELQ DQEND EL Q  + AV I+KE DWK + D   KY+IH+G+LK  KN   LI++  KHR  L++ YHDGALGGHLS RKTLSRLK KY+W T+E DV+ WC++C+VC+TRRNTGKKIKVPLKPMPVP APME+TAMDI+GPLPET   NKYI+VFCDY TKWPEAYA+ NQKA+T+A+IFVENIIFRYG PKKLLTDQG NFQSE+F SIT+LFGI KL+TSP HPQTDGLVERF  TLINMI  +
Sbjct: 2964 ARFFITHHQYREMASVRAQLKTDQKSEVSLCAASDHNNDNNDDINDNKKEQRYFQKGIMKSEKKPEL---QFLLEPMPKLSGIETLSKWYTP-TFLPTAPKYPTEKLKEMKPVEHIQFELDN-----IEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNRRKVESLLDSGSSNTIVSDDLLTMEEKSKMKPTSKVIRSMSHNVLSIIGKLKAELIIGDHELVHHVSVMRNSPVGCLIGMDVMEQLQGISLDLKTGRLMKGQTDEKRHKVREVFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTKLGKLTKFEIEKTPKLPRNIKIYKQPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFKIIRDSSSPFSSSIAVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSNTFKEHLKDVETVFRRLLKANLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVKKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQPLNVLLKKQTQFKWGKSQQEAFKLLKKSLIKKPILRCPNFRIPFILMTDASNFALGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALAYGIAT--------------------------------------------QIKWKCGYAIEN-------PVNNESKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVVDEKHKYIIHDGLLKCIKNENLLIVVLTKHRTTLMLIYHDGALGGHLSARKTLSRLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKVPLKPMPVPGAPMEITAMDIVGPLPETINVNKYIIVFCDYLTKWPEAYAMQNQKAETVAKIFVENIIFRYGAPKKLLTDQGTNFQSELFISITELFGILKLSTSPCHPQTDGLVERFIRTLINMIKKF 4023          

HSP 2 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 406/676 (60.06%), Postives = 527/676 (77.96%), Query Frame = -2
Query: 8502 LATELKRRLPSIIKRNYEEKEFCEEAVIEDLTRTELDRDVILTVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEEL------------------IQKAESPKTETVRKKGKLAFPWXXXXXXXXXXXINTTNSLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVKRTTFVFYCGKWSHSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKK 10475
            + TE+K RLP +++R  E   FC++ +IE+L +  +D++V+LT L Y++LEIG +   E+DN ++LI  A   +N+Y MKW+ NNGGW++L                  +   +SPK   +RKK  + FPW ++ + +   I      + AYDCSQTEMG++YS+V++AEC + YP K KV N VKY+VYQES  RR+KVREC  KRTTFVF+CGKWSH+S++KM +IPRP+E++PENCLAAFQT +LKIN +IKL+AK+N +IRETV V+G+I+ +G C+GEPYKV+  II ++VV+EEY+++LREF+G FDD TGKLQTHPFCNM+QS+CQTGESILV+DV T  CNL  LK+M+FKE++GEQ RE  +   ++  ++ T R TP+  + T  VLMST   DGMRF++KE   KCGQ VY TNYKG+YVS+ M+ EA+T IH  DIKLT+YFNNKIDYL+HF QN +EN+YRE+I+NDC LNKEILRNRMAMAITNPNLVAPMLI+ENGVFARIFGEALYSYKCKAV VK+ KY++CTNELPV++NGK+RFMEP+TRILL+E  KPK LQCNRLLAPLYRL  +SWIALPD+R V+TP+ LELT L+YLVNFTSL +++Q G Y++EDIEEA+RNLLFPSKKERVI EM+DTILP+G  +    + +T   Y++
Sbjct: 2309 IVTEMKNRLPGVVQRFGENDNFCDKKLIENLIKNGIDKEVMLTSLTYMVLEIGAHAIAETDNLENLIDVAARTSNEYFMKWVKNNGGWKKLNNDLTVNEGDEKKLPYKPLNGKDSPK---LRKK--MIFPWAIVMLFICCTITTQATGMTAYDCSQTEMGKIYSVVDMAECPEVYPKKLKVENDVKYYVYQESDLRRAKVRECIAKRTTFVFFCGKWSHTSLIKMHAIPRPVEVMPENCLAAFQTEELKINPEIKLKAKVNQRIRETVVVKGVIQQDGTCEGEPYKVNGKIIKQSVVIEEYLTKLREFEGVFDDKTGKLQTHPFCNMRQSNCQTGESILVFDVKTDICNLAHLKTMTFKELSGEQFRESLDNFNINYKSNGTIRSTPVWTRKTTPVLMSTLPTDGMRFIKKEATNKCGQMVYATNYKGVYVSKMMVQEAKTKIHTNDIKLTHYFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRNRMAMAITNPNLVAPMLISENGVFARIFGEALYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKPKFLQCNRLLAPLYRLAQDSWIALPDYRGVRTPDKLELTNLEYLVNFTSLNRMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR----FFITHHQYRE 2975          

HSP 3 Score: 489.574 bits (1259), Expect = 8.048e-138
Identity = 317/778 (40.75%), Postives = 434/778 (55.78%), Query Frame = -2
Query: 10989 YNLRSQKQVQMANDNAV-----------MPLNREMI------DFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYGWTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDIKRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKELLEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAK-RSDAFGVNVERRERSITPVRAPWDEKKINQISSPILR---PNTRFQAGRSAMSVQSNGQVNNPQCEHCKKSGHYSNQCWFKYGKNPSPNKRF----TENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNSERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKLVAKFESDEETESHMIIGTVSEGEGKPAPKVRKIASDENPTALLARVEKLLEKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGNRD--DEILKQMQKFGKALRSTRDLDDIIVETT--GLDNVKCQFRVKAYGQIKDLKERILRQYSGWQ-VQLKFENRCLEDEEYLVDCGLIPGWXXXXXXXXXXNTLNSDRQNWEKILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTSYQAKLKEVIRKLGHDYEAADDSAKSLIIALNIAD-QRIEYYQEHWSVKAKKIRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNP 13229
            YNLR+QKQ ++   N++            P++          D+ASCQKLPV QYGGDPVEF DF  DYYMYA+AYGW+Q+IMVQR PLYLKGAAREAWQQ+DKR + NDWTKLKDA+A KL+GGDIKRIMRQKFYNRVQ PDESVSEFAYHLTTLA+KAFE+KP+Q D+ KQVKELL+DQF+TGV  EIKKALCYVDF+NFDEL+KKAMKIELNLK+ + ++++F    E R+RS++ ++    +K  +   SP  R   P+T     R  +++Q  G++   QC  C+  GH +  C       P  N+RF     +  R  SD        K       F            Q D  N N +I+               + S R  R I K    F+ D    ++M Y  + E     E E ++M  K          D ++E  ++I                          ++R+ KL+E    + S++   + ELS MSL+   LK  I LCA  ++ N    DEI   M+ FGKA R  + LD I ++      ++V C  R +    +KDLKER L++ +G Q +++KF+NR LED+E+L+DCG IPG KNK++V        + + + ++I+ +           KI   +  I  IE++   K  + + I PY    + Y  KLK ++R+ G +        K  IIA++  D  + EY +EHW  K +K+R++AA  +G DGIIVL FK  ELDDDEYL + G  P
Sbjct: 1523 YNLRNQKQSEIMASNSINNDQTLVSTVTTPVSNIQANMSASNDYASCQKLPVQQYGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAEKAFEIKPEQVDVVKQVKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIDESRDRSVSRIKNNLFQKSTS--PSPKFRVKSPSTSPSPQRDRVNLQ--GRI---QCHSCRGYGHMARSC-------PRNNERFQKPILKKIRFQSD--------KSQADNVAFV-----------QPD--NFNNRIE-----------DEVKQMSRRLDRLICK----FESDEETDNHMMYESQSE---ASETELKKMMIK---------DDLQSEKAIMI--------------------------ISRINKLIESRAAETSKIMTSLLELSQMSLSVQRLKNVIELCADYYEVNLKDRDEISNMMKIFGKAFRENKWLDFIFIDVVDKSRNSVIC-IRCEIGDYVKDLKER-LKENNGRQIIKVKFKNRYLEDDEFLIDCGFIPGNKNKLQVACMSKEEVAKKSDSQEIIGEWDGV-------KITEKLKLIDKIELEDKAKLEIVDIIRPYLYDKSRYGEKLKCLMRRFGRELRETRMELKPFIIAIDYEDWGKTEYIEEHWCTKVQKLRKRAANQIGKDGIIVLMFKDEELDDDEYLYDCGFKP 2203          
BLAST of SMED30010523 vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 1191.02 bits (3080), Expect = 0.000e+0
Identity = 588/968 (60.74%), Postives = 724/968 (74.79%), Query Frame = -2
Query: 5415 ARFFITHHQYQELEILKARIL--KKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQELSGMNKEALRTYQILKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEGMVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPE-KVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTME 8309
            ARFFITHHQY+E   ++A++   +K +VS  + + + ++NND+ N+      Y     +    K  L   Q L EP+   S ++T +K   P +F+  AP Y  ++L+EMKPVE+I  + +      IEP+SAEIERKNMLGLPC+Y+MMTL  +GKQPRI I  N  KVEAL+DSGSS+TI+S+++L ++EK ++KPT +++RS+S N L+II +L     IGD  + H   +M+ SPV CLIGMD++EQL  +SL LKTG L+ G+T +  H+  EVF+NQTL +P +SE++Y A+ + V + + IFEPN+ L+EKY++P+CDEVVKV++Q VPV I N + KP+Q+ PKT+LGKL+K  +E   K+PRN+K+YKEP+V+SNDL E QK EFT+LL+KY+ +FAKHEYDLGLT VIEHEIPLLDETPIK+KPYRIPY+HQ+E                                              +TRKDTYPIPVPQEMFDQMGE ++FTVIDLNKGYNQF+VKEEDR KTAFSDGKGLYEFNVLPFGLTGAPATFQR MN+VLR I HALVYIDD+IIFSN F+EHLKDVETVF+RL  AKLKIKPSKCEWGK+EV+YVGHIISR GLQ NP+N++K++EYP+P++ D+VRQFLGLASYYRKFIK FSH+AQ LN LLKK  +  WG+ QQ AF  LKE L+  PILRCP+F   FILMTDASN A GAVLGQ+ EGEKDHVIAYASR+L+PHEKNYSTIEKETLALVYGI TFRQYL+GRKF V T HNPLQWLMKH DSASKLIRWSIALQEYDFEIKYRTGK+N NAD +SRIP NN     E     TIF AIK  NN+ ELQ DQEND EL Q  + AV I+KE DWK + D   KY+IH+G+LK  KN   LI++P  H+  L++ YHDGALGG+LS RKTLSRLK KY+W T+E
Sbjct: 1501 ARFFITHHQYRETASVRAQLKTDQKSEVSLCAGSDNNNDNNDDINDNKKEQRYFQKGIIKSEKKPEL---QFLLEPMPKLSGIETLSKWYTP-TFLPTAPTYSTEKLKEMKPVEHIQFELDN-----IEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNGRKVEALLDSGSSNTIVSDDLLTIEEKSKMKPTSKVIRSMSHNVLSIIEKLKAELIIGDHELEHYVSVMRNSPVGCLIGMDVMEQLQEISLHLKTGRLMKGQTDEKGHKVREVFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTRLGKLTKFEIEKIPKLPRNIKIYKEPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEE----------------------------------------------ITRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSRIPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHDGLLKCVKNENLLIVVPTNHQTTLMLIYHDGALGGYLSARKTLSRLKQKYYWDTIE 2413          

HSP 2 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 385/660 (58.33%), Postives = 490/660 (74.24%), Query Frame = -2
Query: 8496 LATELKRRLPSIIKRNYEEKEFCEEAVIEDLTRTELDRDVILTVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEELIQKAESPKTETVRKKGKLAFPWXXXXXXXXXXXINTTNSLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVKRTTFVFYCGKWSHSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKKAT 10475
            + TE+K RL  + +R  E   FC++ +I +LT+   D++V+LT L Y +LEIG +   E+DN ++LI  A  + N+Y ++W+  NGG                                           + AYDCSQTEMG++YS+V++AEC DAYP K KV N VKY+VYQES  RR+KVREC VKRTTFVF+CGKWSH+S++KM +I R +E++PENCLAAFQT +LKIN +IKL+AK+NH+IRETV V+G+I  +G C+GEPY V           EEY++ELREF+G FDD+TGKLQTHPFCNM+QS+CQTGESILV+DV T  CNL  LK+M+FKE++GEQ RE P+   ++  ++ T R TP+  + T  VLMST   D MRF++KE   KCGQ VY TNY+G+YVS+ M  EA+T IH  DIKLT+YFNNKIDYL+HF QN +EN+YRE+I+NDC LNKEILR+RMAMAITNPNLVAPMLI+ENGVFARIFGEA YSYKCKAV VK+ KY++CTNELPV++NGK+RFMEP+TRILL+E  K K+LQCNRLLAPLYRL  +SWIALPD+R V+TP+ LELT L+YLVNFTSL K++Q G Y++EDIEEA+RNLLFPSKKERVI EM+DTILP+G  +    + +T   Y++  
Sbjct:  912 MVTEMKNRLLDVGQRFGENDNFCDKKLIGNLTKNGNDKEVMLTSLTYTVLEIGPHAIAETDNLENLIDVAARILNEYFIEWVKKNGG-------------------------------------------MTAYDCSQTEMGKIYSVVDMAECPDAYPKKLKVENDVKYYVYQESDLRRAKVRECIVKRTTFVFFCGKWSHTSLIKMHAISRQLEVMPENCLAAFQTEELKINPEIKLKAKINHRIRETVVVKGVITQDGTCEGEPYMVI----------EEYLTELREFEGVFDDETGKLQTHPFCNMRQSNCQTGESILVFDVKTNVCNLAHLKTMTFKELSGEQFRESPDNFNINYKSNGTIRSTPVWTRKTTPVLMSTLPTDSMRFIKKEATNKCGQMVYATNYRGVYVSKMMGHEAKTKIHTNDIKLTHYFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRSRMAMAITNPNLVAPMLISENGVFARIFGEAFYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKQKILQCNRLLAPLYRLAQDSWIALPDYRGVRTPDKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR----FFITHHQYRETA 1514          

HSP 3 Score: 590.497 bits (1521), Expect = 1.272e-170
Identity = 346/776 (44.59%), Postives = 474/776 (61.08%), Query Frame = -2
Query: 10989 DFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYGWTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDIKRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKELLEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAK-RSDAFGVNVERRERSITPVRAPWDEKKINQISSPILRPNTRFQAGRSAMSVQSNGQVNNP-QCEHCKKSGHYSNQCWFK--YGKNPSP------------------------------------------NKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNSERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKLVAKFESDEETESHMIIGTVSEGEGKPAPK--VRKIASDENPTALLARVEKLLEKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGN-RD-DEILKQMQKFGKALRSTRDLDDIIVETT--GLDNVKCQFRVKAYGQIKDLKERILRQYSGWQ-VQLKFENRCLEDEEYLVDCGLIPGWXXXXXXXXXXNTLNSDRQNWEKILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTSYQAKLKEVIRKLGHDYEAADDSAKSLIIALNIAD-QRIEYYQEHWSVKAKKIRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNP 13154
            D+ASCQKLPV QYGGDPV+F DFM DYYMYA+AYGW+Q+IMVQR  L LKGAAREAWQQ+DKR + NDWTKLKDA+A KL+GGDIKRIMRQKFYNRVQ PDESVSEFAYHLTTLA KAFE+KP+Q D+AKQ+KELL+DQF+TGV  EIKKALCYVDF+NFDEL+KK MKIELNLK+ + ++++F    E R+RS++P++    +K     +SP  +   +F+  +S  S   N +   P QC HC+K GH  NQCWFK   G++PSP                                          NK  T ++RI+ +++CY CGK+GH+SRNCF RSRS S SPSPQRD                                    + IRFQ D     N+ + Q + F +++E E ++M + L++L+ KFESDEET++HM+  + SE       K  ++     E    +++R+ KL+E   T+ S++   + ELS +SL+   LK  I LCA  ++ N +D DEI   M+ FGKA R  + LD I ++      ++V C    +    +KDLKER L++ +G Q +++KF+NR LED+E+L+DCG IPG KNK++V   +    +++ + +KI+ DL++ L   +  KI   +  I  IE+D + K  +   I PY    + Y  KLK ++R+ G +        K  IIA++  D  + EY +EHW  K +K+R++AA  +G DGIIVL FK  ELDDDEYL + G  P
Sbjct:   34 DYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKS----TSPSPKFRVKFEPRKSTCS--PNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGHSNSQCWFKNEEQRSPNRMWPDWLKSNGGKSFNKMSTNSQRINDNIQCYNCGKRGHVSRNCFARSRSPSTSPSPQRD------------------------------------RKIRFQSDKSQADNVAFVQPDNFNNRIEDEVKQMSRHLDRLICKFESDEETDNHMMYESQSEASDTEFKKIMIKDDLQSEKAIMIMSRINKLIESRATETSKIMTSLLELSQISLSVQRLKSVIELCADYYEVNLKDRDEISNMMKIFGKAFRENKWLDFIFIDVVDESRNSVIC-ILCEIGDYVKDLKER-LKENNGRQIIKVKFKNRYLEDDEFLIDCGFIPGNKNKLQVACMIREEVAEKSDSQKIIGDLREALNEWDGVKITEKLKLIDKIELDENAKLEIVNIIRPYLYDKSRYGEKLKCLMRRFGRELRETRMELKPFIIAIDYEDWGKTEYIEEHWCTKVQKLRKRAANQIGKDGIIVLMFKDEELDDDEYLYDCGFKP 765          
BLAST of SMED30010523 vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 555/913 (60.79%), Postives = 682/913 (74.70%), Query Frame = -2
Query: 5580 ARFFITHHQYQELEILKARIL--KKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQELSGMNKEALRTYQILKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEGMVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRGIRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAEVIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIKDFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQFILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENNSEGTPE-KVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHN 8309
            ARFFITHHQY+E   ++A++   +K +VS  + + + ++NND+ N+      Y     +    K  L   Q L EP+   S ++T +K   P +F+  AP Y  ++L+EMKPVE+I  + +      IEP+SAEIERKNMLGLPC+Y+MMTL  +GKQPRI I  N  KVEAL+DSGSS+TI+S+++L ++EK ++KPT +++RS+S N L+II +L     IGD  + H   +M+ SPV CLIGMD++EQL  +SL LKTG L+ G+T +  H+  EVF+NQTL +P +SE++Y A+ + V + + IFEPN+ L+EKY++P+CDEVVKV++Q VPV I N + KP+Q+ PKT+LGKL+K  +E   K+PRN+K+YKEP+V+SNDL E QK EFT+LL+KY+ +FAKHEYDLGLT VIEHEIPLLDETPIK+KPYRIPY+HQ+E                                              +TRKDTYPIPVPQEMFDQMGE ++FTVIDLNKGYNQF+VKEEDR KTAFSDGKGLYEFNVLPFGLTGAPATFQR MN+VLR I HALVYIDD+IIFSN F+EHLKDVETVF+RL  AKLKIKPSKCEWGK+EV+YVGHIISR GLQ NP+N++K++EYP+P++ D+VRQFLGLASYYRKFIK FSH+AQ LN LLKK  +  WG+ QQ AF  LKE L+  PILRCP+F   FILMTDASN A GAVLGQ+ EGEKDHVIAYASR+L+PHEKNYSTIEKETLALVYGI TFRQYL+GRKF V T HNPLQWLMKH DSASKLIRWSIALQEYDFEIKYRTGK+N NAD +SRIP NN     E     TIF AIK  NN+ ELQ DQEND EL Q  + AV I+KE DWK + D   KY+IH+
Sbjct: 1501 ARFFITHHQYRETASVRAQLKTDQKSEVSLCAGSDNNNDNNDDINDNKKEQRYFQKGIIKSEKKPEL---QFLLEPMPKLSGIETLSKWYTP-TFLPTAPTYSTEKLKEMKPVEHIQFELDN-----IEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNGRKVEALLDSGSSNTIVSDDLLTIEEKSKMKPTSKVIRSMSHNVLSIIEKLKAELIIGDHELEHYVSVMRNSPVGCLIGMDVMEQLQEISLHLKTGRLMKGQTDEKGHKVREVFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTRLGKLTKFEIEKIPKLPRNIKIYKEPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEE----------------------------------------------ITRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSRIPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHD 2358          

HSP 2 Score: 809.675 bits (2090), Expect = 0.000e+0
Identity = 385/660 (58.33%), Postives = 490/660 (74.24%), Query Frame = -2
Query: 8496 LATELKRRLPSIIKRNYEEKEFCEEAVIEDLTRTELDRDVILTVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEELIQKAESPKTETVRKKGKLAFPWXXXXXXXXXXXINTTNSLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVKRTTFVFYCGKWSHSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKKAT 10475
            + TE+K RL  + +R  E   FC++ +I +LT+   D++V+LT L Y +LEIG +   E+DN ++LI  A  + N+Y ++W+  NGG                                           + AYDCSQTEMG++YS+V++AEC DAYP K KV N VKY+VYQES  RR+KVREC VKRTTFVF+CGKWSH+S++KM +I R +E++PENCLAAFQT +LKIN +IKL+AK+NH+IRETV V+G+I  +G C+GEPY V           EEY++ELREF+G FDD+TGKLQTHPFCNM+QS+CQTGESILV+DV T  CNL  LK+M+FKE++GEQ RE P+   ++  ++ T R TP+  + T  VLMST   D MRF++KE   KCGQ VY TNY+G+YVS+ M  EA+T IH  DIKLT+YFNNKIDYL+HF QN +EN+YRE+I+NDC LNKEILR+RMAMAITNPNLVAPMLI+ENGVFARIFGEA YSYKCKAV VK+ KY++CTNELPV++NGK+RFMEP+TRILL+E  K K+LQCNRLLAPLYRL  +SWIALPD+R V+TP+ LELT L+YLVNFTSL K++Q G Y++EDIEEA+RNLLFPSKKERVI EM+DTILP+G  +    + +T   Y++  
Sbjct:  912 MVTEMKNRLLDVGQRFGENDNFCDKKLIGNLTKNGNDKEVMLTSLTYTVLEIGPHAIAETDNLENLIDVAARILNEYFIEWVKKNGG-------------------------------------------MTAYDCSQTEMGKIYSVVDMAECPDAYPKKLKVENDVKYYVYQESDLRRAKVRECIVKRTTFVFFCGKWSHTSLIKMHAISRQLEVMPENCLAAFQTEELKINPEIKLKAKINHRIRETVVVKGVITQDGTCEGEPYMVI----------EEYLTELREFEGVFDDETGKLQTHPFCNMRQSNCQTGESILVFDVKTNVCNLAHLKTMTFKELSGEQFRESPDNFNINYKSNGTIRSTPVWTRKTTPVLMSTLPTDSMRFIKKEATNKCGQMVYATNYRGVYVSKMMGHEAKTKIHTNDIKLTHYFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRSRMAMAITNPNLVAPMLISENGVFARIFGEAFYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKQKILQCNRLLAPLYRLAQDSWIALPDYRGVRTPDKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR----FFITHHQYRETA 1514          

HSP 3 Score: 591.652 bits (1524), Expect = 1.161e-170
Identity = 346/776 (44.59%), Postives = 474/776 (61.08%), Query Frame = -2
Query: 10989 DFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYGWTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDIKRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKELLEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAK-RSDAFGVNVERRERSITPVRAPWDEKKINQISSPILRPNTRFQAGRSAMSVQSNGQVNNP-QCEHCKKSGHYSNQCWFK--YGKNPSP------------------------------------------NKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNSERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKLVAKFESDEETESHMIIGTVSEGEGKPAPK--VRKIASDENPTALLARVEKLLEKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGN-RD-DEILKQMQKFGKALRSTRDLDDIIVETT--GLDNVKCQFRVKAYGQIKDLKERILRQYSGWQ-VQLKFENRCLEDEEYLVDCGLIPGWXXXXXXXXXXNTLNSDRQNWEKILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTSYQAKLKEVIRKLGHDYEAADDSAKSLIIALNIAD-QRIEYYQEHWSVKAKKIRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNP 13154
            D+ASCQKLPV QYGGDPV+F DFM DYYMYA+AYGW+Q+IMVQR  L LKGAAREAWQQ+DKR + NDWTKLKDA+A KL+GGDIKRIMRQKFYNRVQ PDESVSEFAYHLTTLA KAFE+KP+Q D+AKQ+KELL+DQF+TGV  EIKKALCYVDF+NFDEL+KK MKIELNLK+ + ++++F    E R+RS++P++    +K     +SP  +   +F+  +S  S   N +   P QC HC+K GH  NQCWFK   G++PSP                                          NK  T ++RI+ +++CY CGK+GH+SRNCF RSRS S SPSPQRD                                    + IRFQ D     N+ + Q + F +++E E ++M + L++L+ KFESDEET++HM+  + SE       K  ++     E    +++R+ KL+E   T+ S++   + ELS +SL+   LK  I LCA  ++ N +D DEI   M+ FGKA R  + LD I ++      ++V C    +    +KDLKER L++ +G Q +++KF+NR LED+E+L+DCG IPG KNK++V   +    +++ + +KI+ DL++ L   +  KI   +  I  IE+D + K  +   I PY    + Y  KLK ++R+ G +        K  IIA++  D  + EY +EHW  K +K+R++AA  +G DGIIVL FK  ELDDDEYL + G  P
Sbjct:   34 DYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKS----TSPSPKFRVKFEPRKSTCS--PNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGHSNSQCWFKNEEQRSPNRMWPDWLKSNGGKSFNKMSTNSQRINDNIQCYNCGKRGHVSRNCFARSRSPSTSPSPQRD------------------------------------RKIRFQSDKSQADNVAFVQPDNFNNRIEDEVKQMSRHLDRLICKFESDEETDNHMMYESQSEASDTEFKKIMIKDDLQSEKAIMIMSRINKLIESRATETSKIMTSLLELSQISLSVQRLKSVIELCADYYEVNLKDRDEISNMMKIFGKAFRENKWLDFIFIDVVDESRNSVIC-ILCEIGDYVKDLKER-LKENNGRQIIKVKFKNRYLEDDEFLIDCGFIPGNKNKLQVACMIREEVAEKSDSQKIIGDLREALNEWDGVKITEKLKLIDKIELDENAKLEIVNIIRPYLYDKSRYGEKLKCLMRRFGRELRETRMELKPFIIAIDYEDWGKTEYIEEHWCTKVQKLRKRAANQIGKDGIIVLMFKDEELDDDEYLYDCGFKP 765          

HSP 4 Score: 162.54 bits (410), Expect = 6.406e-39
Identity = 80/153 (52.29%), Postives = 102/153 (66.67%), Query Frame = -2
Query: 4185 YLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLVPEEDESRYPLRSKQNKVTGQTKLKQKFTKNPTPVSYINKILYVAIMLMLVTVASGKKIDLP-YAVSKIRGMEKIHIYSTLTNIVWSCKCEIADQIEI 4640
            Y+   EP KGLSPKLQRPFKGPY VCDTTETNLKL P  +KK   +IVHANRCK VP  ++++Y LRS    V   T LKQK  KNP P+ YINK L+V  ++++  + S      P YA+ +I  MEK+ IY+T T +VW  +C   ++IEI
Sbjct: 2354 YIIHDEPAKGLSPKLQRPFKGPYIVCDTTETNLKLRPQNNKKPGTIIVHANRCKKVPVAEDTKYQLRSNDKNVERHTTLKQKTAKNPAPLGYINKTLFVTTLMIINVLGSNATPSFPIYAIKRIPLMEKVDIYATCTQMVWIYRCTPTEEIEI 2506          
BLAST of SMED30010523 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 1076.23 bits (2782), Expect = 0.000e+0
Identity = 569/1087 (52.35%), Postives = 712/1087 (65.50%), Query Frame = -2
Query: 6621 HSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKKATYNTMKKIWGKFMFIGQACAGLXXXXXXXXXXXXXXXXVLSTHRLYAITGWSWKLVIGCIPLLARFFITHHQYQELEILKARIL--KKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQELSGMNKEALRTYQILKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEGMVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRG 9875
             + MVKM S     E     CL A+   +LK+  D+K        +R+   +  +I                        EEY++ELREF+G FDD+TGKLQTHPFCNM+Q + QTGESILV+DV T  CNL  LK+M+FKE++G+Q RE P+   ++  ++ T R T +  + T  VLMST   D MRF +KE   KCGQ VY TNY G+YVS+ M+ EA+T IH  DIKLT+YFNNKIDY +HF QN +EN+YRE+I+NDC LNKEILRNRMAMAITN NLVAPMLI+ENGVFARIFG+ALY+YKCKAV VK+ KY+ CTNEL +                                  +  L+ +SWIALPD+R V+TP+ LELT L+YLVNFTSL K++Q G Y++EDIEEA+RNLLFPSKKERVI EMVDTILP+G     Y                    W   M IG                                          C PLLARFFITHHQY+E+  ++A++   +K +VS  + +   ++NND+         Y     +    K  L   Q L EP+   S + T +K   P +F+  AP Y   +L+EMKPVE+I  + +      IEP+SAEIERKNMLGLPC+Y+MMTL  +GKQPRI+I     KVEAL+DSGSS+TI+S+++L +KEK +IK T +++RS+  N L+IIG+      IGD  + H   +M+ SPV CLIGMD++EQL G+SLDLKTG L+  +T +  H+  EVF+NQTL +P +SE   C           IFE N+ L+EKY++P+CDE+VKV++Q +P  I N + K +Q+ PKTKLGKL K  +E   K+PRN+K+YKEP+V+             KLL+KY+ +FAKHEY LGLT VIEHEIPLLDETPIK+KPYRIPY+HQ+ESDRQI AMKEF IIRD +S FSSSIV+VKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQ GE ++FTVIDLNKGYNQF+VKEEDR KTAFSDGKGLYEFNVLPFGLTGAPATFQRG
Sbjct:  900 QTEMVKMYSFVNMAE-----CLDAY-PKKLKVENDVKYYVYQESDLRQAKVIELVI------------------------EEYLTELREFEGVFDDETGKLQTHPFCNMRQRNSQTGESILVFDVKTNVCNLAHLKTMTFKELSGQQFRESPDNFNINYKSNGTIRSTSVWTRKTTPVLMSTLPTDSMRFTKKEATNKCGQMVYATNYSGVYVSKMMVQEAKTKIHTNDIKLTHYFNNKIDYYYHFSQNIMENIYREMILNDCKLNKEILRNRMAMAITNSNLVAPMLISENGVFARIFGDALYTYKCKAVTVKIMKYEMCTNELQIT-------------------------------CSVVSLSQDSWIALPDYRGVRTPDKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMVDTILPNGEAHRIYAI----------------SGWSWEMIIG------------------------------------------CFPLLARFFITHHQYREMASVRAQLKTDQKSEVSLCAASDHNNDNNDDIGHNKKEQKYFQKGIMKSEKKPEL---QFLLEPMPKLSGIQTLSKWSKP-TFLSTAPTYLTKKLKEMKPVEHIQFELDN-----IEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRIYILFTGRKVEALLDSGSSNTIVSDDLLTIKEKSKIKSTSKVIRSMLHNVLSIIGKFKAEIIIGDHELMHYVSVMRNSPVGCLIGMDVMEQLQGISLDLKTGRLVKRQTDEKGHKVREVFLNQTLELPARSE---C-----------IFETNEKLIEKYEIPMCDEMVKVKDQTMPARIVNQNTKSIQMKPKTKLGKLMKFEIEKIPKLPRNIKIYKEPQVI-------------KLLKKYKMVFAKHEYALGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFNIIRDCSSLFSSSIVVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQTGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRG 1831          

HSP 2 Score: 453.751 bits (1166), Expect = 2.178e-127
Identity = 287/750 (38.27%), Postives = 405/750 (54.00%), Query Frame = -2
Query: 10956 DFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYGWTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDIKRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKELLEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAK-RSDAFGVNVERRERSITPVRAPWDEKKINQISSPILRPNTRFQAGRSAMSVQSNGQVNNP-QCEHCKKSGHYSNQCWFKYGKN---------PSPNKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNSERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKLVAKFESDEETESHMIIGTVSEGEGKPAPK--VRKIASDENPTALLARVEKLLEKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGNRDDEILKQMQKFGKALRSTRDLDDIIVETT--GLDNVKCQFRVKAYGQIKDLKERILRQYSGWQ-VQLKFENRCLEDEEYLVDCGLIPGWXXXXXXXXXXNTLNSDRQNWEKILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTSYQAKLKEVIRKLGHDYEAADDSAKSLIIALNIAD-QRIEYYQEHWSVKAKKIRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNPNCINNVYATKQ 13154
            D+ASCQKLPV QYGGDPVEF DFM DYYMYA+AYGW+Q+IMVQR PLYLKG A EA QQ+DKR + NDWTKLKDA+A KL+GGDI+RIMRQKFYNRVQ PDES                              ELL+DQF+T V  EIKKALCYVDF+NFDEL+KKAMKIELNLK+ + ++++F   VE R+RSI P++    +K     +SP  +   +F+  +S  S   N +   P QC HC+K GH  N  WFK              +     ++   +   ++C+ C   GH++R                                       SCPRN+ERF +PILKK IRFQ D     N+ + Q +   +++E E ++M ++L++L+ KFESDEE ++HM+    SE          ++     E    +++R+ KL+E    + S++   + ELS MSL+   LK            NR DEI   M+ FGKA R  + LD I ++      ++V C  R +    +KDLKER L++ +G Q +++KF+NR LED+E+L+DCG IPG KNK++V   +     ++ + ++I  DL+D L   +  KI   ++ +  IE++   K  +   I PY    + Y  KLK ++R+ G +        K  IIA++  D  + EY +EHW  K +K                  F  +ELD++ YL   G     +N V A K+
Sbjct:   19 DYASCQKLPVQQYGGDPVEFVDFMADYYMYATAYGWSQSIMVQRLPLYLKGGAIEALQQIDKRLIANDWTKLKDALASKLIGGDIERIMRQKFYNRVQRPDES------------------------------ELLQDQFLTEVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIVESRDRSICPIKNNLFQKS----TSPSPKFRVKFEPKKSTNS--PNKERERPVQCSHCQKLGHNINPFWFKNNSRRSPSPVQSPSTSPSPQSDRVNLQGGIQCHSCRGYGHMAR---------------------------------------SCPRNNERFQKPILKK-IRFQSDKSQVDNVAFVQPDNSNNRIEDEVKQMSRRLDRLICKFESDEEKDNHMMYELQSEASDTELKNMMIKDDQQSEKEIMIMSRINKLIESRAAETSKIMTSLLELSQMSLSVQRLK------------NR-DEITNMMKIFGKAFRENKWLDFIFIDVVDESRNSVIC-IRCEIGDYVKDLKER-LKENNGRQIIKVKFKNRYLEDDEFLIDCGFIPGNKNKLQVACMIREEVMEKSDSQEITRDLRDALSEWDGVKITEKLELLDKIELEEKTKLEIVNIIRPYLYDKSRYGEKLKCLMRRFGRELRETGMELKPFIIAIDYEDWGKAEYIEEHWCTKVQK------------------FNPQELDENGYLDADGRVGYLVNCVVALKE 659          

HSP 3 Score: 435.261 bits (1118), Expect = 1.101e-121
Identity = 199/286 (69.58%), Postives = 230/286 (80.42%), Query Frame = -2
Query: 5247 GQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENN-SEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNK 6101
            GQ+ EGEKDHVIAYASR+L+PHEKNYSTIEK+TLALVYGI TFRQYL+GRKF V+TDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGK+  NAD +SRIP NN S+        TIF AIK  NN+ ELQ DQEND EL Q  + AV I+ E DWK + +   KY+IH+ +LK  KN   LI++P KHR  L++ YHDGALGGHL  RKTLS LK KY+W T+E DV+ WC++C+VC+TRRNTGKKIK+PLKPMPVP APME+T MDI+GPLPET  G K
Sbjct: 1831 GQQVEGEKDHVIAYASRTLKPHEKNYSTIEKKTLALVYGIATFRQYLVGRKFVVFTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKSKGNADTLSRIPVNNESKNNETNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKMESDWKHVVEEKHKYIIHDILLKCVKNENLLIVVPTKHRTTLMLIYHDGALGGHLCARKTLSLLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKLPLKPMPVPGAPMEITTMDIVGPLPETINGKK 2116          

HSP 4 Score: 367.081 bits (941), Expect = 5.990e-101
Identity = 211/496 (42.54%), Postives = 296/496 (59.68%), Query Frame = -2
Query: 3501 RKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLVPEEDESRYPLRSKQNKVTGQTKLKQKFTKNPTPVSYINKILYVAIMLMLVTVASGKKIDLP-YAVSKIRGMEKIHIYSTLTNIVWSCKCEIADQIEIIDLLDNTAPVVELNYDKDIFAVRKLKPNFKYQWLLRQ-----NMSKWYTQIPIEVHTKEMRXXXXXXXXXXXXXIYWKPVDLVKVRITFQGLNVDTLNSRKSVIRYEKLKMNQNYSVNANYYENICLENGTVVRNQWSRFKSETQSIYLRDESNRITLSVGNGPVTIYRKSGNDERVVIIYKQKTLTILDAGNHFFTLY------TSDLETAWELTVKYQRWITEPGGWQTVFVEVKTI 4952
            +KQKDWD FIKPCLFAYRNAVN+STGETPFYLMYLR+NN P+DLKFQ PISQYM+I DYK +MQE++QSVWT+AGL I+H QE YKE YDK+AHAH I                                   E N       +KKA  +IVHANRCK VP  ++++Y LRSK   V     LKQK  KNP+ + YINK L+VA ++++  + S      P Y + KI   EK+ IY+T T +VW  +C   ++IEI +LL+   P V+L+++K+ +  R+L  N++Y WL++Q     N +K    I IE+ TK + N + IEP +NGINIYW+  +  +V+I FQ   +DTLN RKS + Y  LK++  Y +  +YYE +  + GT   ++W +     +SI L++E+NR+ L + N  + I R+SG +E+VVI Y  K L  L A N  F +       +  +     + +KY + ++    W+  FVE + I
Sbjct: 2116 KKQKDWDLFIKPCLFAYRNAVNESTGETPFYLMYLRRNNKPVDLKFQAPISQYMDISDYKVIMQERLQSVWTQAGLKIRHRQEAYKECYDKRAHAHNI-----------------------------------EKN-------NKKAGKIIVHANRCKKVPVAEDTKYQLRSKDKNVERHPALKQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVRKSFVHYANLKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATL-ASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFNPWEISFVETRFI 2568          

HSP 5 Score: 127.102 bits (318), Expect = 3.417e-28
Identity = 67/166 (40.36%), Postives = 99/166 (59.64%), Query Frame = -2
Query: 9912 LDRDVILTVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEEL-----IQKAESPKTETVRKKGK--------LAFPWXXXXXXXXXXXINTTNSLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVK 10370
            +D++V+LT L YI+LEIG +   E+D  + LI  A  + N+Y ++W+   GGW+EL     + +++  K       GK        + FPW ++ + +L  I      + AYDC QTEM ++YS VN+AEC DAYP K KV N VKY+VYQES  R++KV E  ++
Sbjct:  785 IDKEVMLTSLTYIVLEIGAHAIAETDKLEYLIDVAARILNEYFIEWVKKKGGWKELNNDLTVNESDERKLSCKPLNGKDSPGLRKKMIFPWAIVMLFILCSITTQATGMTAYDCFQTEMVKMYSFVNMAECLDAYPKKLKVENDVKYYVYQESDLRQAKVIELVIE 950          
BLAST of SMED30010523 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 569/1087 (52.35%), Postives = 713/1087 (65.59%), Query Frame = -2
Query: 6621 HSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKLNHKIRETVTVRGIIKSNGDCQGEPYXXXXXXXXXXXXVEEYMSELREFDGSFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKEITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLRKETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDYLFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAENGVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRILLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQYLVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGSGKVNYEYLLTPDHYKKATYNTMKKIWGKFMFIGQACAGLXXXXXXXXXXXXXXXXVLSTHRLYAITGWSWKLVIGCIPLLARFFITHHQYQELEILKARIL--KKKKVSYASTTPSRXXXXXXXXXXDSAPLYVDNQELSGMNKEALRTYQILKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEGMVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEALVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFHIGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKIIHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLPICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRNVKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEIPLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNKGYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRG 9875
             + MVKM S     E     CL A+   +LK+  D+K        +R+   +  +I                        EEY++ELREF+G FDD+TGKLQTHPFCNM+Q + QTGESILV+DV T  CNL  LK+M+FKE++G+Q RE P+   ++  ++ T R T +  + T  VLMST   D MRF +KE   KCGQ VY TNY G+YVS+ M+ EA+T IH  DIKLT+YFNNKIDY +HF QN +EN+YRE+I+NDC LNKEILRNRMAMAITN NLVAPMLI+ENGVFARIFG+ALY+YKCKAV VK+ KY+ CTNEL                               ++   +  L+ +SWIALPD+R V+TP+ LELT L+YLVNFTSL K++Q G Y++EDIEEA+RNLLFPSKKERVI EMVDTILP+G     Y                    W   M IG                                          C PLLARFFITHHQY+E+  ++A++   +K +VS  + +   ++NND+         Y     +    K  L   Q L EP+   S + T +K   P +F+  AP Y   +L+EMKPVE+I  + +      IEP+SAEIERKNMLGLPC+Y+MMTL  +GKQPRI+I     KVEAL+DSGSS+TI+S+++L +KEK +IK T +++RS+  N L+IIG+      IGD  + H   +M+ SPV CLIGMD++EQL G+SLDLKTG L+  +T +  H+  EVF+NQTL +P +SE   C           IFE N+ L+EKY++P+CDE+VKV++Q +P  I N + K +Q+ PKTKLGKL K  +E   K+PRN+K+YKEP+V+             KLL+KY+ +FAKHEY LGLT VIEHEIPLLDETPIK+KPYRIPY+HQ+ESDRQI AMKEF IIRD +S FSSSIV+VKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQ GE ++FTVIDLNKGYNQF+VKEEDR KTAFSDGKGLYEFNVLPFGLTGAPATFQRG
Sbjct:  942 QTEMVKMYSFVNMAE-----CLDAY-PKKLKVENDVKYYVYQESDLRQAKVIELVI------------------------EEYLTELREFEGVFDDETGKLQTHPFCNMRQRNSQTGESILVFDVKTNVCNLAHLKTMTFKELSGQQFRESPDNFNINYKSNGTIRSTSVWTRKTTPVLMSTLPTDSMRFTKKEATNKCGQMVYATNYSGVYVSKMMVQEAKTKIHTNDIKLTHYFNNKIDYYYHFSQNIMENIYREMILNDCKLNKEILRNRMAMAITNSNLVAPMLISENGVFARIFGDALYTYKCKAVTVKIMKYEMCTNEL-------------------------------QITCSVVSLSQDSWIALPDYRGVRTPDKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMVDTILPNGEAHRIYAI----------------SGWSWEMIIG------------------------------------------CFPLLARFFITHHQYREMASVRAQLKTDQKSEVSLCAASDHNNDNNDDIGHNKKEQKYFQKGIMKSEKKPEL---QFLLEPMPKLSGIQTLSKWSKP-TFLSTAPTYLTKKLKEMKPVEHIQFELDN-----IEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRIYILFTGRKVEALLDSGSSNTIVSDDLLTIKEKSKIKSTSKVIRSMLHNVLSIIGKFKAEIIIGDHELMHYVSVMRNSPVGCLIGMDVMEQLQGISLDLKTGRLVKRQTDEKGHKVREVFLNQTLELPARSE---C-----------IFETNEKLIEKYEIPMCDEMVKVKDQTMPARIVNQNTKSIQMKPKTKLGKLMKFEIEKIPKLPRNIKIYKEPQVI-------------KLLKKYKMVFAKHEYALGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFNIIRDCSSLFSSSIVVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQTGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRG 1873          

HSP 2 Score: 543.888 bits (1400), Expect = 3.981e-155
Identity = 325/741 (43.86%), Postives = 445/741 (60.05%), Query Frame = -2
Query: 10956 DFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYGWTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDIKRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKELLEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAK-RSDAFGVNVERRERSITPVRAPWDEKKINQISSPILRPNTRFQAGRSAMSVQSNGQVNNP-QCEHCKKSGHYSNQCWFKYGKNPSPNKRFTENKRISSDVECYRCGKKGHISRNCFTXXXXXXXXXXPQRDKVNTNGQIQCHSCKGYGHMARSCPRNSERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKLVAKFESDEETESHMIIGTVSEGEGKPAPK--VRKIASDENPTALLARVEKLLEKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGNRDDEILKQMQKFGKALRSTRDLDDIIVETT--GLDNVKCQFRVKAYGQIKDLKERILRQYSGWQ-VQLKFENRCLEDEEYLVDCGLIPGWXXXXXXXXXXNTLNSDRQNWEKILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTSYQAKLKEVIRKLGHDYEAADDSAKSLIIALNIAD-QRIEYYQEHWSVKAKKIRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNPNCINNVYATKQ 13154
            D+ASCQKLPV QYGGDPVEF DFM DYYMYA+AYGW+Q+IMVQR PLYLKG A EA QQ+DKR + NDWTKLKDA+A KL+GGDI+RIMRQKFYNRVQ PDES                              ELL+DQF+T V  EIKKALCYVDF+NFDEL+KKAMKIELNLK+ + ++++F   VE R+RSI P++    +K     +SP  +   +F+  +S  S   N +   P QC HC+K GH  N  WFK     SP+     ++RI+ +++CY CGK+GH+SRNCF RSRS S SPSPQ D+VN  G IQCHSC+GYGHMARSCPRN+ERF +PILKK IRFQ D     N+ + Q +   +++E E ++M ++L++L+ KFESDEE ++HM+    SE          ++     E    +++R+ KL+E    + S++   + ELS MSL+   LK            NR DEI   M+ FGKA R  + LD I ++      ++V C  R +    +KDLKER L++ +G Q +++KF+NR LED+E+L+DCG IPG KNK++V   +     ++ + ++I  DL+D L   +  KI   ++ +  IE++   K  +   I PY    + Y  KLK ++R+ G +        K  IIA++  D  + EY +EHW  K +K                  F  +ELD++ YL   G     +N V A K+
Sbjct:   34 DYASCQKLPVQQYGGDPVEFVDFMADYYMYATAYGWSQSIMVQRLPLYLKGGAIEALQQIDKRLIANDWTKLKDALASKLIGGDIERIMRQKFYNRVQRPDES------------------------------ELLQDQFLTEVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIVESRDRSICPIKNNLFQKS----TSPSPKFRVKFEPKKSTNS--PNKERERPVQCSHCQKLGHNINPFWFKNNSRRSPS---PVHQRINDNIQCYNCGKRGHVSRNCFARSRSPSTSPSPQSDRVNLQGGIQCHSCRGYGHMARSCPRNNERFQKPILKK-IRFQSDKSQVDNVAFVQPDNSNNRIEDEVKQMSRRLDRLICKFESDEEKDNHMMYELQSEASDTELKNMMIKDDQQSEKEIMIMSRINKLIESRAAETSKIMTSLLELSQMSLSVQRLK------------NR-DEITNMMKIFGKAFRENKWLDFIFIDVVDESRNSVIC-IRCEIGDYVKDLKER-LKENNGRQIIKVKFKNRYLEDDEFLIDCGFIPGNKNKLQVACMIREEVMEKSDSQEITRDLRDALSEWDGVKITEKLELLDKIELEEKTKLEIVNIIRPYLYDKSRYGEKLKCLMRRFGRELRETGMELKPFIIAIDYEDWGKAEYIEEHWCTKVQK------------------FNPQELDENGYLDADGRVGYLVNCVVALKE 701          

HSP 3 Score: 435.261 bits (1118), Expect = 1.268e-121
Identity = 199/286 (69.58%), Postives = 230/286 (80.42%), Query Frame = -2
Query: 5247 GQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETLALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKANANADAMSRIPENN-SEGTPEKVEGTIFAAIKAVNNMSELQNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGEALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKNWCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGNK 6101
            GQ+ EGEKDHVIAYASR+L+PHEKNYSTIEK+TLALVYGI TFRQYL+GRKF V+TDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGK+  NAD +SRIP NN S+        TIF AIK  NN+ ELQ DQEND EL Q  + AV I+ E DWK + +   KY+IH+ +LK  KN   LI++P KHR  L++ YHDGALGGHL  RKTLS LK KY+W T+E DV+ WC++C+VC+TRRNTGKKIK+PLKPMPVP APME+T MDI+GPLPET  G K
Sbjct: 1873 GQQVEGEKDHVIAYASRTLKPHEKNYSTIEKKTLALVYGIATFRQYLVGRKFVVFTDHNPLQWLMKHRDSASKLIRWSIALQEYDFEIKYRTGKSKGNADTLSRIPVNNESKNNETNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKMESDWKHVVEEKHKYIIHDILLKCVKNENLLIVVPTKHRTTLMLIYHDGALGGHLCARKTLSLLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKLPLKPMPVPGAPMEITTMDIVGPLPETINGKK 2158          

HSP 4 Score: 305.449 bits (781), Expect = 3.151e-82
Identity = 192/496 (38.71%), Postives = 278/496 (56.05%), Query Frame = -2
Query: 3501 RKQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPISQYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIGDLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMIVHANRCKLVPEEDESRYPLRSKQNKVTGQTKLKQKFTKNPTPVSYINKILYVAIMLMLVTVASGKKIDLP-YAVSKIRGMEKIHIYSTLTNIVWSCKCEIADQIEIIDLLDNTAPVVELNYDKDIFAVRKLKPNFKYQWLLRQ-----NMSKWYTQIPIEVHTKEMRXXXXXXXXXXXXXIYWKPVDLVKVRITFQGLNVDTLNSRKSVIRYEKLKMNQNYSVNANYYENICLENGTVVRNQWSRFKSETQSIYLRDESNRITLSVGNGPVTIYRKSGNDERVVIIYKQKTLTILDAGNHFFTLY------TSDLETAWELTVKYQRWITEPGGWQTVFVEVKTI 4952
            +KQKDWD FIKPCLFAYRNAVN+STGETPFYLMYLR+NN P+DLKFQ PISQYM+I DYK +MQE++QSVWT+A                      G+KI                    R  +  YK C              K+A     HA+  + VP  ++++Y LRSK   V     LKQK  KNP+ + YINK L+VA ++++  + S      P Y + KI   EK+ IY+T T +VW  +C   ++IEI +LL+   P V+L+++K+ +  R+L  N++Y WL++Q     N +K    I IE+ TK + N + IEP +NGINIYW+  +  +V+I FQ   +DTLN RKS + Y  LK++  Y +  +YYE +  + GT   ++W +     +SI L++E+NR+ L + N  + I R+SG +E+VVI Y  K L  L A N  F +       +  +     + +KY + ++    W+  FVE + I
Sbjct: 2158 KKQKDWDLFIKPCLFAYRNAVNESTGETPFYLMYLRRNNKPVDLKFQAPISQYMDISDYKVIMQERLQSVWTQA----------------------GLKI--------------------RHRQEAYKEC------------YDKRA-----HAHNIE-VPVAEDTKYQLRSKDKNVERHPALKQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVRKSFVHYANLKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATL-ASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFNPWEISFVETRFI 2592          

HSP 5 Score: 127.102 bits (318), Expect = 3.542e-28
Identity = 67/166 (40.36%), Postives = 99/166 (59.64%), Query Frame = -2
Query: 9912 LDRDVILTVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEEL-----IQKAESPKTETVRKKGK--------LAFPWXXXXXXXXXXXINTTNSLVAYDCSQTEMGRVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVK 10370
            +D++V+LT L YI+LEIG +   E+D  + LI  A  + N+Y ++W+   GGW+EL     + +++  K       GK        + FPW ++ + +L  I      + AYDC QTEM ++YS VN+AEC DAYP K KV N VKY+VYQES  R++KV E  ++
Sbjct:  827 IDKEVMLTSLTYIVLEIGAHAIAETDKLEYLIDVAARILNEYFIEWVKKKGGWKELNNDLTVNESDERKLSCKPLNGKDSPGLRKKMIFPWAIVMLFILCSITTQATGMTAYDCFQTEMVKMYSFVNMAECLDAYPKKLKVENDVKYYVYQESDLRQAKVIELVIE 992          
The following BLAST results are available for this feature:
BLAST of SMED30010523 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTL11.928e-2528.95retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL11.928e-2528.95retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
GIN11.947e-2526.86gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
NYNRIN9.387e-2027.93NYN domain and retroviral integrase containing [So... [more]
GIN12.884e-1928.13gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010523 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010523 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX546500.11.064e-12130.11pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
BX511082.12.624e-12130.63pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX571665.11.029e-11931.06pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
BX890543.14.347e-11930.94pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
CR855320.16.070e-11929.68pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006041.16.147e-15531.26pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000035398.11.019e-12533.38pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
ENSXETT00000034712.17.199e-12531.02pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
ENSXETT00000042189.11.246e-12431.09pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
anxa63.892e-12343.01annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
back to top
BLAST of SMED30010523 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gin12.788e-2325.32gypsy retrotransposon integrase 1 [Source:MGI Symb... [more]
Nynrin2.343e-1827.07NYN domain and retroviral integrase containing [So... [more]
Nynrin2.343e-1827.07NYN domain and retroviral integrase containing [So... [more]
Rtl12.466e-1825.22retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl12.466e-1825.22retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30010523 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME2.596e-12333.45Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME3.042e-12235.48Retrovirus-related Pol polyprotein from transposon... [more]
sp|P0CT40|TF29_SCHPO1.112e-11030.43Transposon Tf2-9 polyprotein OS=Schizosaccharomyce... [more]
sp|P0CT37|TF24_SCHPO1.112e-11030.43Transposon Tf2-4 polyprotein OS=Schizosaccharomyce... [more]
sp|P0CT35|TF22_SCHPO1.112e-11030.43Transposon Tf2-2 polyprotein OS=Schizosaccharomyce... [more]
back to top
BLAST of SMED30010523 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF23.878e-12345.81Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
A0A1Y1KUJ80.000e+036.41Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A4Y2ICH80.000e+036.46Transposon Ty3-I Gag-Pol polyprotein (Fragment) OS... [more]
A0A4Y2IQ810.000e+035.29Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A4Y2I3720.000e+036.28Transposon Ty3-G Gag-Pol polyprotein OS=Araneus ve... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048272.10.000e+036.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034038.10.000e+035.17pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000042253.10.000e+035.95pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052546.12.343e-17433.07pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
ENSAMXT00000045469.12.370e-17334.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004121.11.124e-3328.62pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
ENSPMAT00000004123.11.497e-3027.17pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000009777.16.693e-2625.51pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-... [more]
ENSPMAT00000010393.11.906e-628.26pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 g... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010523 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO361766.707e-1028.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338751.896e-926.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010523 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040305.10.000e+032.82pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000036827.10.000e+037.82pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000039099.11.370e-17231.78pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.11.449e-17231.78pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
ENSORLT00000044989.12.567e-16733.36pep primary_assembly:ASM223467v1:1:17572028:175760... [more]
back to top
BLAST of SMED30010523 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080881.18.048e-13863.21SMESG000080881.1[more]
SMESG000057446.11.272e-17060.74SMESG000057446.1[more]
SMESG000057446.11.161e-17060.79SMESG000057446.1[more]
SMESG000056661.12.178e-12752.35SMESG000056661.1[more]
SMESG000056661.13.981e-15552.35SMESG000056661.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010523 ID=SMED30010523|Name=SMED30010523|organism=Schmidtea mediterranea sexual|type=transcript|length=14718bp
ATTTTTTGATGACAGTGTAAATTTGGTTTAAAGACATTTTGGATTTTGAT
GAATCTCTGAATTTACTTTAATATACGTTGTTCTCGTGGTTATTTTTGAA
TGATTTGGGAATTATACAGAATCCATAATTAATTACATGGTTATTAAATT
TTAAATTATATTTAATTATATTAAATATTAATTCAACAGCAAAAACAACA
ATTATTTAAATAATTATAATATGAATGTATAAATTGAATATCATTTAGAG
CAGTGTATATCAACAGCAGACCAAAACAAACTTTAATTATGACTAAAATA
TAACTTCATAATGAACTCTAGACAATTGGATAACAAATTTACGATATTCA
ATATTAAATAATTATTGTAACACTCTGGGAGGAATTGCGCGCCTTCAAAA
AACTTATAATTTACCACTTCTAATTTATTTCTAAGCTTGGATTTGATTGA
ATTCAATATTCGCTATAAATAACTTTTGAGCGAATACCCCAGGAGAATAA
TAATTGTCCAATTAACCACCATCAAGTTTTAATGAACATGGATAATCATT
TAAGAATACGCTGCAACATTTGTTGCAGATATTTTACAAAACGTGGGTTT
AGGAGCCACTATAATCGTTCACGGATTCCAAATATTTATTTTTCATCCTT
GCTTAATGATAATTTTTTGGATCTACATTTTTGTTTCAATAGTAAAATAT
AACCTTAATTCATTTTAAAATAAAATATGAATTTTTTTAATGAGTTTTCA
AATGCTGTCGACCATGGATGTATTGTGCCATTCAATCAAATCCCGATTGA
GAACAACATTTGTCCAACCAATCATTACTAACTTTTGGTTAATATGGACA
ATTGGTTAAGAATTCGATGCAACAATTTTCCATCTCAACATTATCTATTA
AATTAACGTTATGAAAATCGAACTAGGAGAATTTGCTGCTGTTTATCAGC
GTTTTTTCGTTGAACTTCATGCGAAAACGAAGCAGGAATTAAGAGAATTC
CCAGAGTGAAACTGTTAGTATTTTTTTTGAACTCAAATTTCTAAAAGTTC
CACTTGTTGATTAATCGATATTTTAATTCTATGCGAATTTAATTCTTTTT
TTAATTTTTAACTAATTTATATTTGGAAACACGTTGAAATATTTTATTTT
GCTTTAAAAATCAAAAATAATTTAAACATTAATAACTTATTGGTTTATTT
CGCTCGCAGCATGGTAAAAAGTTAATCTCCCCCGCACCGACCGACTCATG
ATATCACTTTGTTTACTCAGCCTGATAAGGTATCTGCGATGAACATTAAT
ATTCCGAATGAATTTTTACTTATCCTGCGGTTTTTGACGTAGCCGATACT
GATAGGCTCTATAATTAATTACCCTGTGGTTTCTTAACGTAGCCCGTGCT
GATAAGCTTTCTAATTAATTACCCTTTGGTTTGTTAACGTAGCCTGTACT
GATAAGCGTTCTATATAAGTGTCTGCTTTACCACTTTTCGTTAGTTTTGT
CTTGCCAATCTTGAAGTAAGCATTTTATATTTTATTTCTCTTTTTCATAT
ATTTTTTTTTTTTGAATTTTAGCAACGCCATCCCTCAATTACTATGGACG
TAAGTGATTACTTGTCTTTTGTTATTTTTTGTTTTTGTGATTCTTTTTAC
CATGCTGTCCTCAACTACCTTCATAGTAACCGAACACTTGCAATCGCTGT
CCAGGGTAACCAAACCCCGGTGATTGCAAGTGCTCGTGTTGCTTATTAAA
TTAACTTATTGATGCTTATTAAATTAACTTATTTACTGTTTAATTTTAGT
TCGTTTATTTGTTTATGCAACTACCTATACCACACTCATGTGTTGGGTCA
TATATTTTTGATTTTCTGATTTTGTATTTATACTAAAAGCAAACCTCTAA
TTACAGCTACTCGTATTTTTCTGACAATTTTAGCCGTATTTATACTTATT
AATTTATTACGTAATTCTTAAAATCAATTACTTCCCTGCACTAATTATTT
GTCGAGGGCGCCATGGTACGGAGTTTTACACAGTATTTATTTCATTTTTC
TTTTCAACCCTCACTATTTTAGGCTGTCCCAGAACCTAAGTTTGAGCATC
TCGATGTTATGCAATGGGTCCCTTTGCCACCGCGCCGAAAGGGATTGAAA
CGTACCTTTGCCTGTGTGGATACAGGCAGTAGGTTTGAAAGACGCCCGCC
TTGCAATGTACGCAGGGAATGGGACTGTGGCATCCAAAGTCCCGTTCTGT
TGGACTCTGATGATGAATAAAAACGAATAAAACTTTGAATAAATGTTCAG
CATACCTTTGTTTTTAATTTATGCTAGAAAGTGTGGGGTAATTGTGTCCC
TCTTCGCGATTAGTCTTTGTTACTACTAATGTGAAATTATTCCTTACTTA
TTTATAATTTTGTTCTCTCGCCCCAGTAGGTTACCCATTGTTATTCATTA
CTACTCAGCCCTTTAGTATTATTTATTTCTAATGTTCATTTAAGGTATCA
TTTCATTATTTGCAACATTTATTTGAGTTATTCTATTTGCTTTTGTTCAT
TTTTTTATCTATTATTCATTTATTTAATTTATCACTTTTTTAATTATTTA
TTTATATCAATTTGTCTATTCATTTGATTATTTACTTGGTAATTTACTTA
TTTTTTTATTTAAACTATTATTTATCACTGCCAATTATTTCTTTATATCA
ATTTGTTTATTTATTTGATTATTTGTTAATTTACTTATATTTATTTACTA
TTATTTTTTTTTCTCGAGGACGAAAAAACACTAACTGGGTCCGTTTAAAT
ACTTTATAGTCTAATTGATTTATCTCACCATCGTCTTCCGATTCCTCTAT
TTCTTCTACTCTCATTCGAAACATCGCGAAATCGGCCTCGTGTTGAAACA
ATAAGATTTCCAAACGGTCCAACCGCCTTTTCAGACGGAAGTTTTCTTCC
TCCAAATCTGTTATTCTGCCCTGCATGCTACGAAACTTTTGCTTTAGTTC
TTGCGTACTTGTTTTACACTCTTTGCATGACATCTCCGAGGCTTCTTGCA
TTCTCTGAAATTAAATGATAGTAATTTTTTTTTTTTTTTGTATCACTCTC
TATTCGCAAAGCATCAACACCTCGCTTCGAATCTCAAACAAATTACACCG
TTCATCCTATGGTACTTATAAAACATGCACATTGTTAATATAAATGTAAT
ATATTTTTATACTCTATTCATGCAGATCACAATTTATAGTCTTGTCTCAT
AATATGAATATGATGGTGGTTGAAGGATAGTTAGTTGTCTCTCCTTTACA
CATATCAAAATGGTGATGATTATGAATGTTATTGATAAGATGAGAAAACC
TGTTATTAAAATGTAAATGAGATATTCACAATAGTTGACTGTCAAATCCG
AATTTATCATCATTAGTTTATTTGAGTTAGGTTTTGTCGTCTCTTGGGTC
GGTAATTGGAAAGGTGATGTGGTTGTATCTGATTTTCGTTTCGATTCATT
GATTGTCTTGACTTCCACGAAAACTGTTTGCCATCCGCCTGGTTCGGTTA
TCCATCGCTGATATTTAACTGTTAATTCCCATGCCGTCTCTAAATCAGAA
GTGTAAAGTGTAAAAAAATGATTACCGGCATCTAATATAGTCAGGGTTTT
TTGTTTGTAGATAATAACAACTCTTTCATCATTTCCTGATTTTCTATATA
TCGTTACCGGTCCATTTCCAACACTCAGGGTTATACGATTTGACTCGTCT
CTGAGATAGATAGACTGGGTCTCACTCTTAAATCGTGACCATTGGTTTCT
CACTACCGTTCCATTTTCGAGGCATATGTTCTCGTAGTAGTTTGCATTAA
CTGAATAATTTTGATTCATTTTCAATTTCTCGTAGCGGATAACTGATTTT
CGCGAGTTAAGGGTGTCGACATTTAACCCTTGAAATGTGATTCGCACTTT
CACCAAGTCCACTGGCTTCCAATATATATTGATTCCATTTATCTCTGGTT
CTATTTCGATCAAGTTTCGCATCTCTTTTGTGTGCACTTCTATCGGAATT
TGCGTGTACCACTTTGACATGTTCTGTCTCAACAGCCATTGGTATTTGAA
ATTTGGCTTTAACTTTCGTACCGCAAATATATCTTTATCATAATTCAGTT
CTACCACTGGTGCCGTATTGTCTAGTAAATCAATAATTTCTATTTGGTCT
GCGATCTCGCATTTACAGCTCCATACTATATTTGTTAGAGTGGAATATAT
ATGTATTTTCTCCATTCCTCGGATTTTGCTTACCGCATATGGTAAGTCAA
TCTTTTTGCCGCTCGCAACTGTTACTAACATCAGCATTATTGCTACATAT
AATATCTTATTGATGTAGCTGACTGGTGTTGGATTTTTCGTGAATTTCTG
TTTCAATTTTGTTTGACCCGTTACTTTATTCTGCTTGGACCTTAAGGGGT
ATCTAGATTCATCTTCCTCTGGCACTAGTTTACATCGATTTGCATGCACA
ATCATCGGGTTAGCCTTTTTACTCCTGAATGGTAATAACTTCAAATTGGT
TTCGGTGGTGTCGCACACTTTGTAGGGTCCTTTAAATGGTCTTTGCAATT
TAGGCGATAAACCTTTGAGAGGTTCCGGCCTGTTCAGATACACTAGATCT
CCAATCTTTATGCCATGCGCATGTGCTTTTTTATCGTAGGTTTCTTTATA
TTTCTCTTGGTTATGCTTTATTGTCAAACCGGCTTTAGTCCATACTGACT
GCATTTTTTCTTGCATCAATGCTTTATAATCGGGTATCTCCATATATTGA
GAAATTGGTGGTTGGAATTTGAGATCAATCGGCATATTATTTTTCCTTAA
ATACATCAAGTAAAAAGGGGTCTCTCCTGTACTTTGATTTACTGCATTTC
TGTAGGCAAATAGACACGGCTTTATGAAGTCGTCCCAATCTTTCTGTTTT
CGATTCACATATGACGAGATCATATTTATCAGTGTCCCATTAAATCGTTC
CACTAATCCATCAGTTTGTGGATGATATGGTGACGTATTCAATTTCCAAA
TTCCAAATAGGTCTGTGATTGATTTGAACATTTCGCTTTGAAAGTTCTTT
CCTTGATCAGTTAACAATTTCTTTGGAGTACCATAGCGAAATATTATGTT
TTCCACAAATATTCTAGCAATCGTGTCTGCTTTTTGGTTTGGAATAGCGT
ATGCTTCTGGCCATTTGGTAAAATAGTCACAAAAAACAACAATGTATTTG
TTTCCTTTTGTTGTTTCCGGTAATGGCCCCAGAATATCCATTGCCGTCAT
CTCCATTGGTGCTGCGGGTACTGGCATCGGTTTTAATGGTACTTTAATCT
TTTTACCAGTATTTCTGCGGGTGATGCATACTTTGCAACTGTTACACCAA
TTTTTCACGTCTTGTTCCATTGTTGGCCAAAAGTATTTCGATTTTAATCT
CGATAGCGTCTTGCGCGTTGACAAATGACCTCCCAACGCTCCATCATGAT
ACTGCATCAGTAATGCGTCTCTGTGCTTGGCTGGTATAATAATTAATGCT
TCCCCATTTTTCCAAAATTTAAGTATTCCATTATGAATTACATATTTGCT
GTTTGCATCTGTAAGTCGTTTCCAGTCTTGTTCTTTTCTTATTTTGACCG
CTTGTTCCATAAATTGTTTTAATTCACTATCGTTTTCCTGATCATTTTGA
AGTTCAGACATATTATTAACAGCTTTGATTGCAGCGAATATAGTACCTTC
CACTTTTTCAGGTGTCCCCTCACTATTATTTTCTGGGATTCTTGACATTG
CATCTGCGTTCGCGTTAGCTTTACCTGTCCGATATTTAATCTCAAAGTCG
TATTCTTGGAGGGCAATCGACCATCGTATTAATTTACTGGCTGAATCTCT
GTGTTTCATTAACCACTGTAATGGATTATGATCTGTATAAACAGTAAATT
TTCTGCCCAATAAATATTGTCTAAAAGTAGTAATTCCATACACTAACGCT
AACGTTTCCTTTTCAATCGTTGAGTAGTTTTTCTCGTGAGGCCTCAGTGA
TCGGCTTGCATAGGCTATTACGTGGTCCTTTTCACCTTCAAATTTTTGTC
CTAACACCGCACCCAATGCAACGTTGCTTGCATCCGTCATCAAGATAAAT
TGTTTTGTAAAATCTGGACATCTTAATATAGGAGTTGTTACTAATTTCTC
TTTTAATGTATTGAAAGCGTTTTGTTGCATTTGTCCCCAAATAAATTTAT
TGTTTTTCTTTAGTAACGTATTCAATGGTTGTGCGATGTGAGAGAAATCT
TTTATAAATTTTCTGTAATAGCTCGCCAAACCTAAAAATTGTCTAACCTC
ATCGGCATCTTTTGGTACTGGGTACTCTTCCACTTTTTTGATGTTATCTG
GATTAGTTTGTAACCCTCGCCGTGATATTATATGTCCTACATAAATCACT
TCTGCTTTGCCCCATTCACATTTCGATGGTTTGATTTTTAATTTTGCACT
TTTGAGCCGTTTAAATACAGTTTCTACATCTTTCAAGTGTTCTTCGAAAT
CATTTGAAAATATTATTATATCGTCGATATATACCAATGCATGTCGAATA
CCTCGTAACACATAATTCATTCCTCGTTGGAATGTAGCTGGGGCTCCTGT
TAATCCAAATGGTAACACATTGAACTCATACAGTCCTTTGCCATCCGAGA
ACGCCGTCTTTCCTCTATCTTCCTCTTTTACCCTAAATTGATTGTACCCT
TTGTTTAAATCAATAACTGTGAAATATCGTGCCTCTCCCATTTGATCGAA
CATTTCTTGGGGTACTGGAATTGGATAAGTGTCTTTCCTCGTAACTTGAT
TTAGCTTCCGATAATCTACGCAAAATCGTAAGTCTCCATCTTTTTTCTTA
ACTATCACTATTGATGAGGAGAATGGTGACGCACTATCTCGAATTATTCC
AAATTCCTTCATTGCTGTAATCTGTCTATCACTTTCATCTTGATGAACGT
AGGGGATTCTGTATGGCTTTATTTTTATTGGAGTTTCGTCTAATAACGGT
ATTTCATGCTCAATTACATTGGTTAGACCTAAATCATATTCGTGTTTGGC
AAAGATATCTCGGTATTTTCTCAGCAGTTTTGTGAATTCCTTTTTCTGCA
TCTCATTTAAATCATTGCTTACCACTTCAGGCTCCTTGTACACCTTGACG
TTTCTTGGTATTTTACAATTTGTTTCAACAGACATTTTCGATAATTTTCC
CAATTTTGTTTTTGGGTGTAGCTGAACCGGTTTCTTACTGCTATTCGTTA
TATGGACTGGTACTATCTGATTTTCCACTTTGACAACTTCGTCACATATC
GGTAAATCATATTTTTCGACTAGCGTTTGATTTGGTTCGAATATAAAATC
ACCATTATCCACACTCATGGTATTTGCACAATATACCATCTCCGATTGTG
GTGGTATTGTCAATGTCTGATTCACAAACACTTCACCTGCCCTGTGAATT
ATTTTTCCTGTTTCTCCTGCTATCAAATTACCTGTCTTTAAATCAAGTGA
GACTCCGTCCAGCTGCTCTAATATATCCATACCGATCAGACATCGTACTG
GGCTTCCCTTCATTATGAGCGCATTGTGCGCTATTATTCGGTCTCCAATA
TGGAATATGACGTTAAGTTGTCCAATTATGTTTAATTCATTTTTTGATAA
TGACCTCACTATTTCGTCGGTAGGCTTTATTTGCATTTTCTCCTTCACGT
TTAATACATTTTCCGATATTATTGTGTGACTAGATCCCGAATCAACCAAA
GCTTCTACTTTATGTTTGTTCATTTGTATAAATATTCGGGGTTGCTTTCC
TCTTTTTGTTAATGTCATCATTGAGTAGTTGCATGGTAAGCCTAACATAT
TCTTTCTCTCGATCTCTGCGCTAGAAGGCTCGATTCTCTCTCCTACCATT
CCTTCACATTGTAATGCGATATTTTCTACTGGTTTCATCTCTCGTAATCG
ATCAACTGGATATACTGGTGCTGGTTGCATAAACGATTTTGGTATACACA
ATTTTGTAAACGTGTCTACGCTACTCGCATTTAACAGTGGCTCTTTTAAG
ATTTGATAGGTTCTCAACGCTTCTTTATTCATTCCACTTAGTTCTTGATT
GTCAACATATAACGGTGCACTATCACCCTCGTTGTCATTGTCATTATTCT
CGTCCCTTGAAGGGGTTGTACTAGCGTAGCTCACCTTTTTCTTCTTTAAT
ATTCGCGCTTTGAGTATCTCCAACTCCTGATATTGATGATGAGTAATGAA
GAATCTAGCCAATAATGGTATGCAACCAATTACTAATTTCCACGACCAAC
CTGTGATCGCGTATAATCTGTGTGTTGATAGGACCTGCGATATTATTACT
TTGATTACAACACATATTACATAAATTCCAATCAATCCGGCACACGCTTG
TCCAATGAACATAAACTTTCCCCAGATCTTTTTCATTGTATTATACGTCG
CTTTCTTGTAATGATCTGGAGTTAACAAATACTCGTAATTTACCTTCCCA
CTTCCGCTTGGGAGAATTGTATCTACCATCTCCATTATTACTCTTTCTTT
CTTTGATGGAAATAACAAGTTTCTGCGGGCTTCCTCAATGTCTTCGTTCG
AGTAAATTCCACTTTGCGATAATTTCTCTAATGACGTAAAATTTACCAGA
TATTGTAATTCTGTCAATTCTAAGTTTTCCGGTGTCTTTACTTCTCGATG
ATCTGGTAATGCAATCCAAGATTCTGGTGTTAGTCTGTATAGTGGTGCCA
ACAATCTATTACACTGTAATACTTTCGGTTTCACGTCCTCTTCCAGTAAG
ATTCGTGTTACAGGCTCCATAAATCGCAACTTTCCATTTAAATTCACTGG
TAACTCGTTGGTGCATTGGTCATACTTTGTCAGTTTAACTGGTACCGCTT
TACATTTATAGCTATATAGTGCTTCACCGAAAATTCTGGCAAACACCCCA
TTTTCTGCAATTAACATTGGTGCTACCAAATTAGGATTGGTTATAGCCAT
TGCCATCCGATTTCGGAGTATTTCTTTGTTGAGATTGCAATCATTTATAA
TAACTTCTCGGTACACATTTTCAACAGTATTTTGACCAAAGTGAAATAAA
TAATCTATTTTGTTATTAAAGTAATTTGTCAACTTGATATCTCCGGCATG
TATGTTTGTTTGGGCCTCTATAATCATTTTCTGAGATACATATATACCTT
TATAATTTGTCTCATAGACATTTTGTCCACACTTTGTTTTAGTTTCTTTT
CTCAGGAATCGCATCCCGTCTTCCTCTGAGGTTGACATTAACACTGTTGG
AGTATCTTTCATCCGTAGAGGTGTGATTCTTGTTGTTGTACTCGTTGCTG
GATCCATTCTTATTTTCTCGGGTTTTTCCCTGATCTGTTCTCCCGTTATT
TCTTTAAAACTCATTGACTTCAATTGCACTAAATTGCACTTTTTGGTATC
GACATCGTACACCAAAATTGATTCTCCTGTCTGACAGCTAGATTGTTTCA
TGTTGCAGAATGGATGTGTTTGTAGTTTACCAGTATCATCATCAAATGAT
CCATCAAATTCTCTTAATTCTGACATGTACTCTTCTACAACCACGGCTTT
GTCAATTATAGCATCGTCTACTTTGTATGGCTCTCCTTGGCAATCACCAT
TCGACTTTATTATCCCTCGCACGGTTACAGTCTCACGGATTTTGTGGTTA
AGCTTTGCTTGTAGCTTGATATCTGCATTAATTTTCAACTGTCCTGTTTG
AAAGGCTGCCAAACAATTCTCCGGAATTATTTCTATCGGTCTAGGTATCG
ATTGCATTTTCACCATCGATGAGTGGCTCCATTTTCCACAATAAAATACA
AAAGTAGTTCGTTTCACTGTACACTCTCTCACCTTTGATCTTCGAAACCC
CGATTCTTGATATACATGATATTTTACTGGATTTGTCACTTTAAATTTTA
CTGGATATGCATCCGAACACTCTGCTACGTTTACCAACGAGTATACTCTT
CCCATTTCGGTTTGGGAGCAGTCATATGCCACCAATGAATTCGTCGTATT
TATTATTCCCAATAACATAATAATAGAAATCATCAACCATGGAAATGCAA
GTTTTCCCTTTTTCCTCACTGTCTCTGTTTTTGGGCTCTCAGCCTTTTGT
ATTAACTCTTCCCATCCGCCATTGTTTGCGATCCACTTCATCAAATATTT
ATTCGTCATTTCAGTAGCTTTCTTTATCAATGATTTTGAATTGTCACTTT
CCAGATAACCATAAGTACCAATCTCCAATATTATATAGGCTAGCACTGTC
AATATTACATCTCGATCTAACTCAGTTCGTGTTAAGTCCTCAATTACTGC
TTCCTCACAAAATTCCTTTTCTTCATAATTTCTTTTAATTATCGACGGTA
ATCTCCTCTTTAATTCCGTTGCCAATCTTTTTACAACTCTTTTCTCCCCC
TCCGAAATATCATCTTCTGTTTCAGTTTCATCTAACAAATACAATTCCGT
TACTAAACTTTTTAATATTCGCTCAGTTTCGCTTGATTCATCTAAACGCT
CAGTTTCGCTTGATTCCTCTAAACTCAAAGATTCAATTTCCGCATCATTC
TGTTTTATCCCACATATCGCAATGTCATTTTTCGTCTCAACAAAGTTCTC
TTCACTTTTCATCTCATCTATGCTCGGTAGTATCCTATTATCGGTGCTCC
TTTCCTCAACATCCCTTGTAACTTCATTTTCTGATCTCATTTCCTCATTT
TCCATTGTTTCTAATCTCTGCAATTCATTAATTTCTTGATCAATTTCTCC
TGGGTCATCTACAACTTCAGTTTTAATCTCTACATTATCATTGTCCACTT
CCTCATACAGAGGCCAAAACGGTACTATTACTGCATCTTCTTCCATTTCA
CCACTTTGTTTTGTTGCGTACACATTATTAATACAATTTGGGTTACATCC
GTAGTTTAACAAATATTCGTCATCATCCAATTCTCGTCCTTTGAACGTCA
ACACGATAATTCCGTCATTACCTAATATCTCCGCTGCTTTTTGTCGTATT
TTCTTTGCTTTTACACTCCAATGTTCCTGATAATATTCAATCCTTTGATC
CGCAATATTTAACGCTATTATCAAAGACTTCGCACTATCGTCTGCCGCCT
CATAATCATGTCCTAGTTTTCGAATTACCTCTTTTAACTTTGCCTGATAA
CTCGTCGGTTTATTCGTATACGGTACGATGCATTCAAACAACCCTTCTTT
CATGTCTCGATCCATTTCGATGCTCATTATGAAGTCGATACTCGCATTAA
TTTTATCTCTATTCCCTGCATACAGGGTATCCTGTAAATCTGCTAGAATC
TTTTCCCAATTTTGTCTGTCTGAATTCAAAGTATTAACAGCATTAACAAC
TTTTACTTTATTTTTCCAGCCTGGTATCAGACCGCAATCTACTAAGTACT
CCTCGTCTTCCAGACATCGATTCTCAAATTTTAGTTGCACTTGCCATCCA
CTGTATTGACGCAGTATTCGCTCCTTTAGGTCTTTGATTTGTCCGTAGGC
CTTTACACGGAATTGGCACTTCACATTATCAAGTCCCGTCGTTTCCACTA
TGATATCATCTAAATCCCTTGTTGACCGCAAAGCCTTGCCAAACTTTTGC
ATTTGCTTAAGTATCTCATCATCTCTGTTTCCTTTGAATAACTTTGCACA
TAAATTTATGGCTCTCTTTAGTTCGCTTTGGGTTAGTGACATCACACTGA
GTTCTGCGATCCATCGTTTCAACTGGGAGTTGTCAGTTTCCATTTTCTCA
AGCAATTTTTCAACTCGGGCTAACAGTGCAGTCGGATTCTCATCTGATGC
GATCTTTCGCACTTTCGGGGCAGGTTTTCCCTCACCTTCTGACACGGTTC
CAATTATCATATGAGATTCAGTTTCTTCATCTGATTCGAATTTAGCCACT
AGTTTGTTCAGCTTCTGTCGCATTTCTCGAAATTCCTTTTCCATTTTGTC
TTGAAATTCCTCTCTCTGAGCATATGTCATGTTACTGGTGTTTGGCATAT
CTTCTTGGAATCTGATTGATTTCTTTAAAATAGGTCTGCTGAATCTCTCT
GAGTTCCTTGGGCATGATCGCGCCATGTGGCCGTATCCCTTGCACGAATG
ACATTGTATCTGTCCATTTGTATTCACTTTGTCCCTTTGTGGTGAAGGTG
ACGCTGACGATGATCTTGATCTGGTAAAACAGTTTCTGCTAATATGCCCT
TTCTTTCCGCATCGATAGCATTCGACATCACTGCTGATCCTTTTGTTTTC
TGTGAATCTCTTGTTAGGGCTGGGATTTTTCCCATATTTGAACCAACATT
GATTTGAGTAGTGTCCAGACTTTTTGCAATGTTCGCATTGAGGATTATTT
ACCTGTCCATTTGATTGTACACTCATCGCTGATCTACCGGCTTGAAATCT
AGTATTTGGTCTTAAAATTGGACTACTGATTTGATTTATTTTCTTTTCAT
CCCATGGTGCTCTCACAGGCGTAATTGACCGCTCACGTCTCTCCACATTA
ACTCCAAAAGCATCTGATCTTTTTGCACTTTTTAAATTCAGCTCTATCTT
CATGGCTTTCTTCACGAGCTCATCGAAATTGGAAAAATCCACATAACATA
GGGCCTTTTTGATTTCGGAGTGGACTCCGGTTATAAACTGATCTTCTAAC
AGCTCTTTAACCTGCTTGGCCATATCTGCTTGATCGGGTTTGACTTCGAA
GGCTTTATCTGCTAAAGTGGTCAGATGATAAGCAAACTCACTGACCGATT
CATCTGGACCTTGAACTCGATTATAAAATTTCTGTCGCATGATTCTTTTG
ATATCTCCACCAACCAGTTTCAGTGCCATTGCATCCTTCAATTTTGTCCA
ATCATTGCCAACATTTCGTTTGTCGACTTGCTGCCAGGCTTCTCTTGCCG
CACCCTTCAGATAGAGTGGGAATCTCTGAACCATAATGGCTTGTGTCCAT
CCGTATGCTGAGGCGTACATATAATAATCTCCCATGAAATCTGCAAATTC
AACAGGGTCTCCCCCATATTGATTGACGGGTAATTTCTGACAACTTGCGA
AATCAATCATCTCTCTATTGAGAGGCATAACAGCATTATCATTTGCCATT
TGGACTTGTTTCTGACTTCTGAGGTTGTATCGGTTCACTTTGAGCTAAAC
TTCAAGCGTTAAACAATAATTTAAAATTACTTTTCAACTTCTTTTAAATC
TCCCAATAATAGCCTTTTATAATCTCGTTAACACTATTTTCAAACTTCTA
AGCCGACTTTCACTCACGTCAGTACTAATTCTTTTTATAATTCCTTTTTC
ACTAGCTTCCAATAATTTCCCTCCGACTTTCAATCACGTCGGTACTATTT
TTTTTTCAATAATTATTTTTTCACTAACTTTCAATAATTTTCCGCCGACT
TTCAATCACGTCGGGCTCACCAGAATATATGTTGGGTTTTGGATTATTTC
AAGTCGGTTCTCTCTGACTCCTGGTGTTCTTTAAATTAAAACAATGAACG
ACCCAACGTATATTGAAACAACAGGTTCACAATTTATTATCACGCTACAA
TGACCAATCAAAGTTTATACGATTCTCTGCTCGGCGTTGATGCTTTGCAA
ACAAACAATATTCACCTTTTGATCCTTTAGTTCTGTTGACTCTCGTTTTC
CTCGGTTTCTGTTTGGTTTGATCCCTTTTCGCCTTTCCGTATTCTTAATT
CTATTTCTTCTTTTCCCTACTTCCCTAATTCGTTTACCACTTTTCCTACA
GTCTGATTCTTCGAACCCTAGCTGAGGCAGAATGCCGATTTTCTCTGATT
TTCCCTTTGCTTATATACTCCTCGAAATCAGGATGACAAATGGTTATTGC
CGAGCCAATCTTTCGTTTGACATTTTCTCCTACGTGTTTGCTTCGGCTGT
CATCCATAATGGTCCAACGAATCCAGATAATTAATGGCCCTACCGGTCTT
CCTACGCGCGCTATCTTCTCCTTACTCTTTTCCCATTAATCATTGTGTCA
AGCTAATGGGCCCAAATCTTCCTTTTGTTTGCCTTTCTTCTTGTTTACCC
AGCTCGGGTTTCCTTCATCTCTCGGGTTCTCCATTGGCTCGGGTTTCCCA
TTAGCTCGGGTTTTCCATTAGCCAATTAATTAATTAATTAACGTTTTCTG
TTTTCATACATTTGAATGTTTTTCAACCCTTTCTAACCCTTTTCTGATAA
ATCCCTAACCGTCATCTTGTTGACCATTAGCTAATCTATAACTGTCCCGT
TTTTCCCATTCGATTTCGATGATTTTTCCATTTATTGATTTTTCTCGGAT
TTCCGGATTCTCGCCTTTCGTAATTGCTTTTTGCATTTTCTAATACTGTT
TCCATCGCACTTTCCTTTACTATTAATTCTGTGCACGATCCCGCTTTTAT
TTGCCTTTTTTCTTCGCTTACTTTCCATTTGAATTATTATCCTAAATTTT
ATTTAAATTTTTAATTTTAATTTACAGACCTCAACATATCTCCCCCCTTA
AAAAATTTTTTCGTCCTCGAAATCTATGTTTTGCTGTGATTATGTATTAT
TATTATTATTAATATTACATGTGTCACATGATAAAGATTAAATATATTGT
TTTGTTGGTTGTCAAAAA
back to top

protein sequence of SMED30010523-orf-1

>SMED30010523-orf-1 ID=SMED30010523-orf-1|Name=SMED30010523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MQEASEMSCKECKTSTQELKQKFRSMQGRITDLEEENFRLKRRLDRLEIL
LFQHEADFAMFRMRVEEIEESEDDGEINQLDYKVFKRTQLVFFRPREKKI
IVNKYK*
back to top

protein sequence of SMED30010523-orf-2

>SMED30010523-orf-2 ID=SMED30010523-orf-2|Name=SMED30010523-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3322bp
MANDNAVMPLNREMIDFASCQKLPVNQYGGDPVEFADFMGDYYMYASAYG
WTQAIMVQRFPLYLKGAAREAWQQVDKRNVGNDWTKLKDAMALKLVGGDI
KRIMRQKFYNRVQGPDESVSEFAYHLTTLADKAFEVKPDQADMAKQVKEL
LEDQFITGVHSEIKKALCYVDFSNFDELVKKAMKIELNLKSAKRSDAFGV
NVERRERSITPVRAPWDEKKINQISSPILRPNTRFQAGRSAMSVQSNGQV
NNPQCEHCKKSGHYSNQCWFKYGKNPSPNKRFTENKRISSDVECYRCGKK
GHISRNCFTRSRSSSASPSPQRDKVNTNGQIQCHSCKGYGHMARSCPRNS
ERFSRPILKKSIRFQEDMPNTSNMTYAQREEFQDKMEKEFREMRQKLNKL
VAKFESDEETESHMIIGTVSEGEGKPAPKVRKIASDENPTALLARVEKLL
EKMETDNSQLKRWIAELSVMSLTQSELKRAINLCAKLFKGNRDDEILKQM
QKFGKALRSTRDLDDIIVETTGLDNVKCQFRVKAYGQIKDLKERILRQYS
GWQVQLKFENRCLEDEEYLVDCGLIPGWKNKVKVVNAVNTLNSDRQNWEK
ILADLQDTLYAGNRDKINASIDFIMSIEMDRDMKEGLFECIVPYTNKPTS
YQAKLKEVIRKLGHDYEAADDSAKSLIIALNIADQRIEYYQEHWSVKAKK
IRQKAAEILGNDGIIVLTFKGRELDDDEYLLNYGCNPNCINNVYATKQSG
EMEEDAVIVPFWPLYEEVDNDNVEIKTEVVDDPGEIDQEINELQRLETME
NEEMRSENEVTRDVEERSTDNRILPSIDEMKSEENFVETKNDIAICGIKQ
NDAEIESLSLEESSETERLDESSETERILKSLVTELYLLDETETEDDISE
GEKRVVKRLATELKRRLPSIIKRNYEEKEFCEEAVIEDLTRTELDRDVIL
TVLAYIILEIGTYGYLESDNSKSLIKKATEMTNKYLMKWIANNGGWEELI
QKAESPKTETVRKKGKLAFPWLMISIIMLLGIINTTNSLVAYDCSQTEMG
RVYSLVNVAECSDAYPVKFKVTNPVKYHVYQESGFRRSKVRECTVKRTTF
VFYCGKWSHSSMVKMQSIPRPIEIIPENCLAAFQTGQLKINADIKLQAKL
NHKIRETVTVRGIIKSNGDCQGEPYKVDDAIIDKAVVVEEYMSELREFDG
SFDDDTGKLQTHPFCNMKQSSCQTGESILVYDVDTKKCNLVQLKSMSFKE
ITGEQIREKPEKIRMDPATSTTTRITPLRMKDTPTVLMSTSEEDGMRFLR
KETKTKCGQNVYETNYKGIYVSQKMIIEAQTNIHAGDIKLTNYFNNKIDY
LFHFGQNTVENVYREVIINDCNLNKEILRNRMAMAITNPNLVAPMLIAEN
GVFARIFGEALYSYKCKAVPVKLTKYDQCTNELPVNLNGKLRFMEPVTRI
LLEEDVKPKVLQCNRLLAPLYRLTPESWIALPDHREVKTPENLELTELQY
LVNFTSLEKLSQSGIYSNEDIEEARRNLLFPSKKERVIMEMVDTILPSGS
GKVNYEYLLTPDHYKKATYNTMKKIWGKFMFIGQACAGLIGIYVICVVIK
VIISQVLSTHRLYAITGWSWKLVIGCIPLLARFFITHHQYQELEILKARI
LKKKKVSYASTTPSRDENNDNDNEGDSAPLYVDNQELSGMNKEALRTYQI
LKEPLLNASSVDTFTKLCIPKSFMQPAPVYPVDRLREMKPVENIALQCEG
MVGERIEPSSAEIERKNMLGLPCNYSMMTLTKRGKQPRIFIQMNKHKVEA
LVDSGSSHTIISENVLNVKEKMQIKPTDEIVRSLSKNELNIIGQLNVIFH
IGDRIIAHNALIMKGSPVRCLIGMDILEQLDGVSLDLKTGNLIAGETGKI
IHRAGEVFVNQTLTIPPQSEMVYCANTMSVDNGDFIFEPNQTLVEKYDLP
ICDEVVKVENQIVPVHITNSSKKPVQLHPKTKLGKLSKMSVETNCKIPRN
VKVYKEPEVVSNDLNEMQKKEFTKLLRKYRDIFAKHEYDLGLTNVIEHEI
PLLDETPIKIKPYRIPYVHQDESDRQITAMKEFGIIRDSASPFSSSIVIV
KKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEARYFTVIDLNK
GYNQFRVKEEDRGKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNYVLRG
IRHALVYIDDIIIFSNDFEEHLKDVETVFKRLKSAKLKIKPSKCEWGKAE
VIYVGHIISRRGLQTNPDNIKKVEEYPVPKDADEVRQFLGLASYYRKFIK
DFSHIAQPLNTLLKKNNKFIWGQMQQNAFNTLKEKLVTTPILRCPDFTKQ
FILMTDASNVALGAVLGQKFEGEKDHVIAYASRSLRPHEKNYSTIEKETL
ALVYGITTFRQYLLGRKFTVYTDHNPLQWLMKHRDSASKLIRWSIALQEY
DFEIKYRTGKANANADAMSRIPENNSEGTPEKVEGTIFAAIKAVNNMSEL
QNDQENDSELKQFMEQAVKIRKEQDWKRLTDANSKYVIHNGILKFWKNGE
ALIIIPAKHRDALLMQYHDGALGGHLSTRKTLSRLKSKYFWPTMEQDVKN
WCNSCKVCITRRNTGKKIKVPLKPMPVPAAPMEMTAMDILGPLPETTKGN
KYIVVFCDYFTKWPEAYAIPNQKADTIARIFVENIIFRYGTPKKLLTDQG
KNFQSEMFKSITDLFGIWKLNTSPYHPQTDGLVERFNGTLINMISSYVNR
KQKDWDDFIKPCLFAYRNAVNQSTGETPFYLMYLRKNNMPIDLKFQPPIS
QYMEIPDYKALMQEKMQSVWTKAGLTIKHNQEKYKETYDKKAHAHGIKIG
DLVYLNRPEPLKGLSPKLQRPFKGPYKVCDTTETNLKLLPFRSKKANPMI
VHANRCKLVPEEDESRYPLRSKQNKVTGQTKLKQKFTKNPTPVSYINKIL
YVAIMLMLVTVASGKKIDLPYAVSKIRGMEKIHIYSTLTNIVWSCKCEIA
DQIEIIDLLDNTAPVVELNYDKDIFAVRKLKPNFKYQWLLRQNMSKWYTQ
IPIEVHTKEMRNLIEIEPEINGINIYWKPVDLVKVRITFQGLNVDTLNSR
KSVIRYEKLKMNQNYSVNANYYENICLENGTVVRNQWSRFKSETQSIYLR
DESNRITLSVGNGPVTIYRKSGNDERVVIIYKQKTLTILDAGNHFFTLYT
SDLETAWELTVKYQRWITEPGGWQTVFVEVKTINESKRKSDTTTSPFQLP
TQETTKPNSNKLMMINSDLTVNYCEYLIYILITGFLILSITFIIITILIC
VKERQLTILQPPSYSYYETRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
IPR000477RT_dom
IPR021109Peptidase_aspartic_dom_sf
IPR020726Bcl2_BH2_motif_CS
IPR001969Aspartic_peptidase_AS
IPR000299FERM_domain
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0042981regulation of apoptotic process
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton