Ribonucleoside diphosphate reductase subunit M2-2

Overview
NameRibonucleoside diphosphate reductase subunit M2-2
Smed IDSMED30010517
Length (bp)712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonucleoside diphosphate reductase subunit M2-2 (SMED30010517) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonucleoside diphosphate reductase subunit M2-2 (SMED30010517) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonucleoside diphosphate reductase subunit M2-2 (SMED30010517) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonucleoside diphosphate reductase subunit M2-2 (SMED30010517) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010517

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 46

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010517 SmedASXL_009993SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010517 SmedASXL_009993SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010517 Contig37597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010517 Contig37597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30010517 SMED30010115smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
neoblastSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30010517 AFJ24744.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
neoblastSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30010517 JX010501.1smed_ncbi_20240424PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
X1 cellSMED30010517 CUFF.307465.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30010517 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010517 SmWIOct06_034731GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010517 SmWIOct06_040692GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010517 SMED_00510_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010517 SMED_00510_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 81.2629 bits (199), Expect = 1.304e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:  130 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 196          

HSP 2 Score: 60.8474 bits (146), Expect = 1.304e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  214 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 273          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 81.2629 bits (199), Expect = 1.304e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:  130 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 196          

HSP 2 Score: 60.8474 bits (146), Expect = 1.304e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  214 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 273          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 81.2629 bits (199), Expect = 1.775e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 136          

HSP 2 Score: 60.4622 bits (145), Expect = 1.775e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  154 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 213          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 80.8777 bits (198), Expect = 2.466e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 136          

HSP 2 Score: 60.4622 bits (145), Expect = 2.466e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  154 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 213          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 80.8777 bits (198), Expect = 2.466e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 136          

HSP 2 Score: 60.4622 bits (145), Expect = 2.466e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  154 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 213          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Match: rnr-2 (Ribonucleoside-diphosphate reductase small chain [Source:UniProtKB/Swiss-Prot;Acc:P42170])

HSP 1 Score: 66.2402 bits (160), Expect = 6.541e-20
Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E +L +  +R     +++ DIW  + KA +SFWTV EV+L KD   W+KMN DE+YF + +LAFF A
Sbjct:   62 EPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRILAFFAA 128          

HSP 2 Score: 48.9062 bits (115), Expect = 6.541e-20
Identity = 23/60 (38.33%), Postives = 35/60 (58.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q SE+  FY FQI I+NIHSE+Y   I++Y+ +   ++ LF  +D    ++K    A  W
Sbjct:  146 QVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWALRW 205          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Match: RnrS (gene:FBgn0011704 transcript:FBtr0088046)

HSP 1 Score: 83.1889 bits (204), Expect = 4.480e-26
Identity = 37/68 (54.41%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  115 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            +E LL E+  R     IQY DIW+M+ KA +SFWTV EV+LSKD   W ++ DDER+F +H+LAFF A
Sbjct:   73 LEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWHRLKDDERHFISHVLAFFAA 140          

HSP 2 Score: 53.1434 bits (126), Expect = 4.480e-26
Identity = 22/60 (36.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++N+HSE+Y + ID+Y+ +   +  LF  I+++P V++    A +W
Sbjct:  158 QITEARCFYGFQIAMENVHSEMYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSW 217          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 83.1889 bits (204), Expect = 5.576e-29
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 104          

HSP 2 Score: 63.1586 bits (152), Expect = 5.576e-29
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:  122 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 181          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 83.1889 bits (204), Expect = 5.905e-29
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 104          

HSP 2 Score: 63.1586 bits (152), Expect = 5.905e-29
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:  122 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 181          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 83.1889 bits (204), Expect = 5.905e-29
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 104          

HSP 2 Score: 63.1586 bits (152), Expect = 5.905e-29
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:  122 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 181          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 83.1889 bits (204), Expect = 6.971e-29
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 81          

HSP 2 Score: 63.1586 bits (152), Expect = 6.971e-29
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:   99 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 158          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 83.1889 bits (204), Expect = 6.971e-29
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 81          

HSP 2 Score: 63.1586 bits (152), Expect = 6.971e-29
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:   99 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 158          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:NCBI gene;Acc:394645])

HSP 1 Score: 80.1073 bits (196), Expect = 2.391e-27
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +++LAFF A
Sbjct:   42 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAA 108          

HSP 2 Score: 61.2326 bits (147), Expect = 2.391e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K  + A  W
Sbjct:  126 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRW 185          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:NCBI gene;Acc:394645])

HSP 1 Score: 80.1073 bits (196), Expect = 2.409e-27
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +++LAFF A
Sbjct:   59 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAA 125          

HSP 2 Score: 61.2326 bits (147), Expect = 2.409e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K  + A  W
Sbjct:  143 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRW 202          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:NCBI gene;Acc:394645])

HSP 1 Score: 79.337 bits (194), Expect = 4.187e-27
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +++LAFF A
Sbjct:   59 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAA 125          

HSP 2 Score: 61.2326 bits (147), Expect = 4.187e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K  + A  W
Sbjct:  143 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRW 202          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:NCBI gene;Acc:394645])

HSP 1 Score: 79.337 bits (194), Expect = 4.482e-27
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +++LAFF A
Sbjct:   16 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAA 82          

HSP 2 Score: 61.2326 bits (147), Expect = 4.482e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K  + A  W
Sbjct:  100 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRW 159          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:NCBI gene;Acc:394645])

HSP 1 Score: 79.337 bits (194), Expect = 4.829e-27
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +++LAFF A
Sbjct:   10 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAA 76          

HSP 2 Score: 61.2326 bits (147), Expect = 4.829e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K  + A  W
Sbjct:   94 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRW 153          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 80.1073 bits (196), Expect = 2.377e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+F +H+LAFF A
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAA 137          

HSP 2 Score: 60.8474 bits (146), Expect = 2.377e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  155 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRW 214          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 79.7221 bits (195), Expect = 3.811e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+F +H+LAFF A
Sbjct:   40 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAA 106          

HSP 2 Score: 60.4622 bits (145), Expect = 3.811e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  124 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRW 183          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 79.7221 bits (195), Expect = 7.143e-26
Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL +   R     IQY DIW M+ +A++SFWT  EV+LSKD  HW K+  DE+YF +H+LAFF A
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAA 98          

HSP 2 Score: 56.225 bits (134), Expect = 7.143e-26
Identity = 25/60 (41.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQI+I+N+HSE+Y L ID+Y+ + + +  LF  I+++P V+K    A  W
Sbjct:  116 QVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRW 175          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 67.781 bits (164), Expect = 1.243e-23
Identity = 28/48 (58.33%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  175 DIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+F +H+LAFF A
Sbjct:    2 DIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAA 49          

HSP 2 Score: 60.4622 bits (145), Expect = 1.243e-23
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:   67 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRW 126          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 79.337 bits (194), Expect = 9.331e-19
Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL +   R     IQY DIW M+ +A++SFWT  EV+LSKD  HW K+  DE+YF +H+LAFF A
Sbjct:   18 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAA 84          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Match: sp|P79733|RIR2_DANRE (Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio OX=7955 GN=rrm2 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.150e-28
Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYF +H+LAFF A
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAA 133          

HSP 2 Score: 63.1586 bits (152), Expect = 4.150e-28
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:  151 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW 210          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Match: sp|Q4R7Q7|RIR2_MACFA (Ribonucleoside-diphosphate reductase subunit M2 OS=Macaca fascicularis OX=9541 GN=RRM2 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.470e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 136          

HSP 2 Score: 60.4622 bits (145), Expect = 8.470e-27
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  154 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVEKKADWALRW 213          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Match: sp|Q4KLN6|RIR2_RAT (Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus OX=10116 GN=Rrm2 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.121e-27
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+F +H+LAFF A
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAA 137          

HSP 2 Score: 61.2326 bits (147), Expect = 9.121e-27
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A  W
Sbjct:  155 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAIETMPCVKKKADWALRW 214          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Match: sp|P31350|RIR2_HUMAN (Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.032e-26
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYF +H+LAFF A
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAA 136          

HSP 2 Score: 60.4622 bits (145), Expect = 1.032e-26
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  154 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRW 213          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Match: sp|P11157|RIR2_MOUSE (Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus OX=10090 GN=Rrm2 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.366e-26
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+F +H+LAFF A
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAA 137          

HSP 2 Score: 60.8474 bits (146), Expect = 1.366e-26
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV+K    A  W
Sbjct:  155 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRW 214          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: I1ZI90 (Ribonucleoside diphosphate reductase subunit M2-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-47
Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
Query:  115 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYF TH+LAFF A
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAA 68          

HSP 2 Score: 80.1073 bits (196), Expect = 3.379e-47
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 3
Query:  378 ESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            E+E FYSFQI I+NIHSE+Y L IDSYVT+TETK+KLF  I+++PCVQK  Q A  W
Sbjct:   89 EAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRW 145          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: A0A498LFW5 (Ribonucleoside-diphosphate reductase subunit M2 OS=Labeo rohita OX=84645 GN=ROHU_012405 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.195e-28
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ + D+ERYF +H+LAFF A
Sbjct:  463 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAA 529          

HSP 2 Score: 63.5438 bits (153), Expect = 9.195e-28
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  I+++PCV+K    A NW
Sbjct:  547 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAIETMPCVKKKADWALNW 606          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: A0A1B1MRD5 (Ribonucleotide reductase OS=Pteropox virus OX=1873698 GN=PTPV-Aus-006 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.478e-27
Identity = 39/69 (56.52%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  112 IMEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            + E LLT + +R   L IQY DIW M+ KA +SFWTV EV+L+KD  HWKK+  DE+YF +H+LAFF A
Sbjct:   13 VQEPLLTPNDNRFVILPIQYPDIWSMYKKAEASFWTVEEVDLTKDLPHWKKLKPDEQYFISHVLAFFAA 81          

HSP 2 Score: 60.8474 bits (146), Expect = 6.478e-27
Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI I+NIHSE+Y L ID+Y+ +   K KLF  I ++PCV+K    A  W
Sbjct:   99 QVTEARCFYGFQIAIENIHSEMYSLLIDTYIQDPFEKSKLFNAIYTIPCVKKKANWALKW 158          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: A0A498J176 (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_031607 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.716e-27
Identity = 34/70 (48.57%), Postives = 46/70 (65.71%), Query Frame = 1
Query:  109 FIMEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            F  E LL  +  R     IQY +IWEM+ KA +SFWT  EV+L +D  HW+ ++D ER+F +H+LAFF A
Sbjct:    4 FPEEPLLAPNPDRFCMFPIQYPEIWEMYKKAEASFWTAEEVDLCQDVRHWEALSDGERHFVSHILAFFAA 73          

HSP 2 Score: 70.8626 bits (172), Expect = 7.716e-27
Identity = 29/60 (48.33%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI I+NIHSE+Y L +++Y+ +++ KH+LF  ID++PCV K  Q A  W
Sbjct:   91 QVAEARAFYGFQIAIENIHSEMYSLLLETYIKDSDEKHRLFHAIDTIPCVAKKAQWALRW 150          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: A0A150GKI0 (Uncharacterized protein OS=Gonium pectorale OX=33097 GN=GPECTOR_19g311 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.804e-27
Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  115 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFF 312
            +E LL E+  R     I+Y  IWEM+ KA +SFWT  EV+L  D  HW+K+ND ER+F +H+LAFF
Sbjct:   74 VEPLLDENPDRFCMFPIKYPKIWEMYKKAEASFWTAEEVDLGDDMKHWEKLNDGERHFISHVLAFF 139          

HSP 2 Score: 69.3218 bits (168), Expect = 7.804e-27
Identity = 29/60 (48.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQ+ I+NIHSE+Y L ++SY+ +   KHKLF +I++VPC++K  Q A  W
Sbjct:  159 QLPEARAFYGFQVAIENIHSEMYSLLLESYIKDPAEKHKLFHSIETVPCIKKKAQWAIRW 218          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 83.9593 bits (206), Expect = 3.010e-29
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ + D+ERYF +H+LAFF A
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAA 133          

HSP 2 Score: 63.1586 bits (152), Expect = 3.010e-29
Identity = 26/60 (43.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  ++++PCV+K    A NW
Sbjct:  151 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNW 210          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 83.9593 bits (206), Expect = 3.010e-29
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ + D+ERYF +H+LAFF A
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAA 133          

HSP 2 Score: 63.1586 bits (152), Expect = 3.010e-29
Identity = 26/60 (43.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +++ +  LF  ++++PCV+K    A NW
Sbjct:  151 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNW 210          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B-like [Source:NCBI gene;Acc:103028967])

HSP 1 Score: 82.8037 bits (203), Expect = 4.963e-26
Identity = 37/67 (55.22%), Postives = 49/67 (73.13%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+K R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW+K+   ER+F +H+LAFF A
Sbjct:   30 EPLLRENKRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWEKLKPGERHFISHVLAFFAA 96          

HSP 2 Score: 53.5286 bits (127), Expect = 4.963e-26
Identity = 22/60 (36.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQI+I+++HSE+Y + I++Y+ + + +  LF  I+++PCV++    A  W
Sbjct:  114 QLPEARSFYGFQILIESVHSEMYSMLINTYIRDLKERDYLFNAIETMPCVKRKADWALQW 173          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Sea Lamprey
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 75.0998 bits (183), Expect = 4.805e-26
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL ++  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+++  +E++F +H+LAFF A
Sbjct:   19 EPLLRDNPRRFVIFPIEYPDIWQMYKKAEASFWTAEEVDLSKDQQHWERLKPEEQHFISHVLAFFAA 85          

HSP 2 Score: 58.9214 bits (141), Expect = 4.805e-26
Identity = 26/60 (43.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ +   +  LF  I+++PCV+K    A  W
Sbjct:  103 QITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPTQREFLFNAIETLPCVKKKADWALRW 162          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Match: RNR2 (Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; RNR2 has a paralog, RNR4, that arose from the whole genome duplication [Source:SGD;Acc:S000003563])

HSP 1 Score: 68.9366 bits (167), Expect = 7.437e-22
Identity = 32/68 (47.06%), Postives = 46/68 (67.65%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHW-KKMNDDERYFNTHLLAFFDA 318
            E LL EDK R     I+Y +IW+ + +A +SFWT  E++LSKD   W  +MN++ER+F + +LAFF A
Sbjct:   76 EPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAA 143          

HSP 2 Score: 50.0618 bits (118), Expect = 7.437e-22
Identity = 24/60 (40.00%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E++ FY FQI+I+NIHSE Y L ID+Y+ + +    LF  I ++P + +  + A  W
Sbjct:  161 QIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRW 220          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Match: RNR4 (Ribonucleotide-diphosphate reductase (RNR) small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; relocalizes from nucleus to cytoplasm upon DNA replication stress; RNR4 has a paralog, RNR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003412])

HSP 1 Score: 55.4546 bits (132), Expect = 4.550e-15
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAF 309
            EILL E+  R     I+Y +IW  + K  +SFWT  E+ L+KD   ++K+ DD++ +  +LLA 
Sbjct:   25 EILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQKLTDDQKTYIGNLLAL 88          

HSP 2 Score: 40.817 bits (94), Expect = 4.550e-15
Identity = 19/51 (37.25%), Postives = 34/51 (66.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQ 521
            QN E + FY FQI+++NI+SE+Y + +D++  + +    LF  I ++P V+
Sbjct:  109 QNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDPKN-IPLFKEIANLPEVK 158          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.704e-26
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+NDDER F +H+LAFF A
Sbjct:   22 EPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAA 88          

HSP 2 Score: 57.7658 bits (138), Expect = 1.704e-26
Identity = 28/60 (46.67%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQI I+NIHSE+Y L I+S + +   K  LF  I+++PCV K    A NW
Sbjct:  106 QIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNW 165          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.124e-26
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+NDDER F +H+LAFF A
Sbjct:   65 EPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAA 131          

HSP 2 Score: 57.7658 bits (138), Expect = 2.124e-26
Identity = 28/60 (46.67%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQI I+NIHSE+Y L I+S + +   K  LF  I+++PCV K    A NW
Sbjct:  149 QIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNW 208          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C0])

HSP 1 Score: 74.7146 bits (182), Expect = 2.448e-25
Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+ND ER F +H+LAFF A
Sbjct:   65 EPLLRENPHRFVILPIQYTEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDHERMFVSHVLAFFAA 131          

HSP 2 Score: 57.7658 bits (138), Expect = 2.448e-25
Identity = 28/60 (46.67%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FY FQI I+NIHSE+Y L I+S + +   K  LF  I+++PCV K    A NW
Sbjct:  149 QIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNW 208          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO28315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T9])

HSP 1 Score: 68.1662 bits (165), Expect = 7.709e-23
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 1
Query:  112 IMEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWK-KMNDDERYFNTHLLAFFDA 318
            ++E +L E+K R     I++ DIWE + K  +SFWT  E++L +D   W  K+N+DE+YF  H+LAFF A
Sbjct:    3 VVEPILQENKDRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLHQDITDWNTKLNEDEKYFIKHILAFFAA 72          

HSP 2 Score: 55.8398 bits (133), Expect = 7.709e-23
Identity = 26/60 (43.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E++ FY FQI+++NIHSE Y L ID+YV +   K KLF  I+  P +++  + A  W
Sbjct:   90 QYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEVEKDKLFHAIEVFPAIKRKAEWALKW 149          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: RRM2 (ribonucleoside-diphosphate reductase subunit M2-like [Source:NCBI gene;Acc:101166844])

HSP 1 Score: 83.5741 bits (205), Expect = 7.910e-29
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     +QY DIW+M+ KA +SFWT  EV+LSKD  HW+ + DDER+F +H+LAFF A
Sbjct:   60 EPLLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAA 126          

HSP 2 Score: 62.003 bits (149), Expect = 7.910e-29
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV++    A NW
Sbjct:  144 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNW 203          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 78.1814 bits (191), Expect = 7.395e-25
Identity = 34/67 (50.75%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW ++  DE++F +++LAFF A
Sbjct:   33 EPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAA 99          

HSP 2 Score: 53.9138 bits (128), Expect = 7.395e-25
Identity = 24/60 (40.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FYSFQI+I+ +HSE+Y L I++Y+ + + +  LF  I ++PCV++    A  W
Sbjct:  117 QVPEARSFYSFQILIETVHSEMYSLLINTYIRDLKERDYLFNAIQTMPCVKRKADWALEW 176          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 78.1814 bits (191), Expect = 9.083e-25
Identity = 34/67 (50.75%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E LL E+  R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW ++  DE++F +++LAFF A
Sbjct:   35 EPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAA 101          

HSP 2 Score: 53.9138 bits (128), Expect = 9.083e-25
Identity = 24/60 (40.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q  E+  FYSFQI+I+ +HSE+Y L I++Y+ + + +  LF  I ++PCV++    A  W
Sbjct:  119 QVPEARSFYSFQILIETVHSEMYSLLINTYIRDLKERDYLFNAIQTMPCVKRKADWALEW 178          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: ENSORLT00000025443.2 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 62.7734 bits (151), Expect = 1.076e-22
Identity = 26/44 (59.09%), Postives = 34/44 (77.27%), Query Frame = 1
Query:  187 MFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            M+ KA +SFWT  EV+LSKD  HW+ + DDER+F +H+LAFF A
Sbjct:    1 MYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAA 44          

HSP 2 Score: 62.3882 bits (150), Expect = 1.076e-22
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  369 QNSESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            Q +E+  FY FQI ++NIHSE+Y L ID+Y+ + + +  LF  I+++PCV++    A NW
Sbjct:   62 QVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNW 121          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: ENSORLT00000045108.1 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 80.4925 bits (197), Expect = 4.043e-19
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  118 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            E  L E+  R     +QY DIW+M+ KA +SFWT  EV+LSKD  HW+ + DDER+F +H+LAFF A
Sbjct:   26 EPQLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAA 92          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000079368.1 (SMESG000079368.1)

HSP 1 Score: 137.502 bits (345), Expect = 2.213e-50
Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
Query:  115 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYF TH+LAFF A
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAA 68          

HSP 2 Score: 80.1073 bits (196), Expect = 2.213e-50
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 3
Query:  378 ESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            E+E FYSFQI I+NIHSE+Y L IDSYVT+TETK+KLF  I+++PCVQK  Q A  W
Sbjct:   89 EAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRW 145          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000044188.1 (SMESG000044188.1)

HSP 1 Score: 137.502 bits (345), Expect = 2.213e-50
Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
Query:  115 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFNTHLLAFFDA 318
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYF TH+LAFF A
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAA 68          

HSP 2 Score: 80.1073 bits (196), Expect = 2.213e-50
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 3
Query:  378 ESEVFYSFQIVIQNIHSEIYLL*IDSYVTNTETKHKLFITIDSVPCVQKMLQ*ASNW 548
            E+E FYSFQI I+NIHSE+Y L IDSYVT+TETK+KLF  I+++PCVQK  Q A  W
Sbjct:   89 EAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRW 145          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000069029.1 (SMESG000069029.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.622e-40
Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 2
Query:  512 MRSENASMSLELDFLLRYLNVFSELCRYHDTEVQKSYLEFVNILSGNFNNPDFILRNQVLEIASVIV 712
            MRSENASM LELDFLLRYLNVFSELCRYHDTEVQKSYLEFVNILSGNFNNPDFILRNQVLEIASVIV
Sbjct:    1 MRSENASMGLELDFLLRYLNVFSELCRYHDTEVQKSYLEFVNILSGNFNNPDFILRNQVLEIASVIV 67          
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000030567.1 (SMESG000030567.1)

HSP 1 Score: 73.559 bits (179), Expect = 7.243e-15
Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = 2
Query:  563 YLNVFSELCRYHDTEVQKSYLEFVNILSGNFNNPDFILRNQVLEIASVIV 712
            YLNVF+ELCR H  E  KSY EFVNIL+ NF+N D ILRNQVLEIASVIV
Sbjct:  274 YLNVFAELCRNHCVEALKSYREFVNILNENFDNSDIILRNQVLEIASVIV 323          
The following BLAST results are available for this feature:
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM21.304e-2752.24ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM21.304e-2752.24ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM21.775e-2752.24ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM22.466e-2752.24ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM22.466e-2752.24ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnr-26.541e-2046.27Ribonucleoside-diphosphate reductase small chain ... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RnrS4.480e-2654.41gene:FBgn0011704 transcript:FBtr0088046[more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrm25.576e-2955.22ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm25.905e-2955.22ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm25.905e-2955.22ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm26.971e-2955.22ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm26.971e-2955.22ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrm2.12.391e-2750.75ribonucleotide reductase M2, gene 1 [Source:NCBI g... [more]
rrm2.12.409e-2750.75ribonucleotide reductase M2, gene 1 [Source:NCBI g... [more]
rrm2.14.187e-2750.75ribonucleotide reductase M2, gene 1 [Source:NCBI g... [more]
rrm2.14.482e-2750.75ribonucleotide reductase M2, gene 1 [Source:NCBI g... [more]
rrm2.14.829e-2750.75ribonucleotide reductase M2, gene 1 [Source:NCBI g... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rrm22.377e-2752.24ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm23.811e-2752.24ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b7.143e-2652.24ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm21.243e-2358.33ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b9.331e-1952.24ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79733|RIR2_DANRE4.150e-2855.22Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|Q4R7Q7|RIR2_MACFA8.470e-2752.24Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|Q4KLN6|RIR2_RAT9.121e-2752.24Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|P31350|RIR2_HUMAN1.032e-2652.24Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|P11157|RIR2_MOUSE1.366e-2652.24Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI903.379e-4795.59Ribonucleoside diphosphate reductase subunit M2-2 ... [more]
A0A498LFW59.195e-2855.22Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
A0A1B1MRD56.478e-2756.52Ribonucleotide reductase OS=Pteropox virus OX=1873... [more]
A0A498J1767.716e-2748.57Uncharacterized protein OS=Malus domestica OX=3750... [more]
A0A150GKI07.804e-2751.52Uncharacterized protein OS=Gonium pectorale OX=330... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rrm23.010e-2955.22ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm23.010e-2955.22ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm2b4.963e-2655.22ribonucleoside-diphosphate reductase subunit M2 B-... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrm24.805e-2647.76ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RNR27.437e-2247.06Ribonucleotide-diphosphate reductase (RNR), small ... [more]
RNR44.550e-1539.06Ribonucleotide-diphosphate reductase (RNR) small s... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO421171.704e-2655.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420872.124e-2655.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421162.448e-2553.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283157.709e-2344.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM27.910e-2953.73ribonucleoside-diphosphate reductase subunit M2-li... [more]
rrm2b7.395e-2550.75ribonucleoside-diphosphate reductase subunit M2 B ... [more]
rrm2b9.083e-2550.75ribonucleoside-diphosphate reductase subunit M2 B ... [more]
ENSORLT00000025443.21.076e-2259.09ribonucleoside-diphosphate reductase subunit M2 [S... [more]
ENSORLT00000045108.14.043e-1952.24ribonucleoside-diphosphate reductase subunit M2 [S... [more]
back to top
BLAST of Ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000079368.12.213e-5095.59SMESG000079368.1[more]
SMESG000044188.12.213e-5095.59SMESG000044188.1[more]
SMESG000069029.11.622e-4098.51SMESG000069029.1[more]
SMESG000030567.17.243e-1576.00SMESG000030567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010517 ID=SMED30010517|Name=Ribonucleoside diphosphate reductase subunit M2-2|organism=Schmidtea mediterranea sexual|type=transcript|length=712bp
CATTAAAACTTCTATTATAGAAGTTTTTAATGAACTGAATCAGGTTTAAT
GCAAAATAGTCATTTTAATTTCTAGATAAATTAACAGTAATTCTTTCGAG
ATTAGATATTTATTATGGAGATTTTATTAACAGAAGATAAAAGTCGAATA
GGATTTCTTAATATACAATATGAAGATATATGGGAAATGTTTAATAAAGC
TCGATCTTCATTTTGGACTGTAAATGAAGTTAATTTATCAAAAGATTTTG
CTCACTGGAAAAAAATGAATGACGATGAACGATATTTCAATACTCACCTT
CTTGCTTTTTTTGATGCTATTGATGGGATTGTTATTGAAATTATAATCGA
GAGATTCATTCTAGAAATCAGAACTCTGAATCTGAGGTATTCTACAGTTT
TCAAATTGTCATTCAAAACATTCATTCAGAAATATATTTGCTATAAATCG
ATTCTTATGTTACTAATACAGAAACTAAGCATAAATTATTTATTACTATC
GATTCTGTACCATGCGTTCAGAAAATGCTTCAATGAGCCTCGAATTGGAC
TTTTTATTGCGCTATTTAAATGTGTTCTCGGAGTTGTGTCGATATCATGA
CACTGAAGTTCAAAAGAGTTATCTAGAATTCGTTAATATTTTGAGTGGAA
ATTTCAACAATCCTGACTTTATATTGAGAAATCAAGTCCTGGAAATTGCC
TCGGTTATCGTA
back to top

protein sequence of SMED30010517-orf-1

>SMED30010517-orf-1 ID=SMED30010517-orf-1|Name=SMED30010517-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKK
MNDDERYFNTHLLAFFDAIDGIVIEIIIERFILEIRTLNLRYSTVFKLSF
KTFIQKYICYKSILMLLIQKLSINYLLLSILYHAFRKCFNEPRIGLFIAL
FKCVLGVVSIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR012348RNR-like
IPR000358RNR_small_fam
IPR009078Ferritin-like_SF
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0009186deoxyribonucleoside diphosphate metabolic process
GO:0009263deoxyribonucleotide biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane