SMED30010509
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30010509 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Alignments
SMED30010509 aligns in the following genomic locations:
Homology
BLAST of SMED30010509 vs. Planmine SMEST
Match: SMESG000026049.1 (SMESG000026049.1) HSP 1 Score: 83.9593 bits (206), Expect = 3.189e-20 Identity = 43/60 (71.67%), Postives = 47/60 (78.33%), Query Frame = 1 Query: 145 NRYEKLYAMS-RFDDPALAEPTMPMDVVIPRRLLPKGRQDPDRSLAERQDHSYARGRSRF 321 +RY Y +S DDPA AEPTM MDVVIPRRLLPK QD DRS AERQ+HSYARGRSR+ Sbjct: 93 DRYAPAYGISFELDDPAFAEPTMLMDVVIPRRLLPKDMQDSDRSPAERQEHSYARGRSRY 152
BLAST of SMED30010509 vs. Planmine SMEST
Match: SMESG000053533.1 (SMESG000053533.1) HSP 1 Score: 64.3142 bits (155), Expect = 1.999e-14 Identity = 36/70 (51.43%), Postives = 46/70 (65.71%), Query Frame = 1 Query: 151 YEKLYAMSR-FDDPALAEPTMPMDVVIPRRLLPKGRQDPDRSLAERQDHSYARGRSRFDSDSCRRNQIRR 357 Y Y +S DD +L +PT+P+DVVIPRRLLP+ Q+ D S A Q++S A R R +SDS RNQ RR Sbjct: 24 YAPSYGVSYVLDDSSLTDPTIPIDVVIPRRLLPRNMQNSDSSPARWQENSNAWDRPRPNSDSSLRNQTRR 93
BLAST of SMED30010509 vs. Planmine SMEST
Match: SMESG000040398.1 (SMESG000040398.1) HSP 1 Score: 57.7658 bits (138), Expect = 1.225e-11 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 151 YEKLYAMS-RFDDPALAEPTMPMDVVIPRRLLPKGRQDPDRSLAERQDHSYA 303 Y Y +S DDPALAE T PM+VV+PR+LLP+ QD DRS + Q+HSYA Sbjct: 67 YTPNYGVSYELDDPALAEMTTPMNVVVPRQLLPRNMQDFDRSSPQLQEHSYA 118
BLAST of SMED30010509 vs. Planmine SMEST
Match: SMESG000024210.1 (SMESG000024210.1) HSP 1 Score: 56.225 bits (134), Expect = 1.877e-11 Identity = 33/66 (50.00%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 151 YEKLYAMS-RFDDPALAEPTMPMDVVIPRRLLPKGRQDPDRSLAERQDHSYARGRSRFDSDSCRRN 345 Y Y +S DDP LAE T M+VVIPR LLP+ + DR +Q+HSYAR + F+ DS RRN Sbjct: 14 YAPPYGVSYEMDDPRLAESTQSMNVVIPRTLLPRETRYADRRQTGKQEHSYARRQRGFNVDSYRRN 79
BLAST of SMED30010509 vs. Planmine SMEST
Match: SMESG000036108.1 (SMESG000036108.1) HSP 1 Score: 52.373 bits (124), Expect = 1.475e-9 Identity = 28/55 (50.91%), Postives = 35/55 (63.64%), Query Frame = 1 Query: 181 DDPALAEPTMPMDVVIPRRLLPKGRQDPDRSLAERQDHSYARGRSRFDSDSCRRN 345 D+ L E P++ VIPRRLLPK + DRS A RQ+HSYAR + + DS RN Sbjct: 56 DNSMLTESIRPINEVIPRRLLPKETRYADRSPAGRQEHSYARKQHEINLDSYHRN 110 The following BLAST results are available for this feature:
BLAST of SMED30010509 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30010509 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30010509 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30010509 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30010509 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30010509 ID=SMED30010509|Name=SMED30010509|organism=Schmidtea mediterranea sexual|type=transcript|length=388bpback to top protein sequence of SMED30010509-orf-1 >SMED30010509-orf-1 ID=SMED30010509-orf-1|Name=SMED30010509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp MKVPEDHLLMTPKMKEDSRAHRLGEVQREEPARERENRYEKLYAMSRFDDback to top |