Catalase

Overview
NameCatalase
Smed IDSMED30010507
Length (bp)1683
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Catalase (SMED30010507) t-SNE clustered cells

Violin plots show distribution of expression levels for Catalase (SMED30010507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010507h1SMcG0007674 SmedASXL_011574SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010507h1SMcG0007674 SmedASXL_011575SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30010507h1SMcG0007674 Contig43224newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010507h1SMcG0007674 Contig43224uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010507h1SMcG0007674 Contig49407uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010507h1SMcG0007674 Contig49407newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30010507h1SMcG0007674 dd_Smed_v6_32853_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010507h1SMcG0007674 dd_Smed_v6_20433_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30010507h1SMcG0007674 SMED30010507smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30010507h1SMcG0007674 OX_Smed_1.0.06145ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
testisSMED30010507h1SMcG0007674 Contig512GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30010507h1SMcG0007674 Contig512GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30010507h1SMcG0007674 Contig43224newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010507h1SMcG0007674 Contig43224uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010507h1SMcG0007674 Contig49407uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010507h1SMcG0007674 Contig49407newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30010507h1SMcG0007674 PL030005A10F12smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30010507h1SMcG0007674 PL030005A10F12smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Catalase vs. Ensembl Human
Match: CAT (catalase [Source:HGNC Symbol;Acc:HGNC:1516])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 323/519 (62.24%), Postives = 388/519 (74.76%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL*VGIGNFIFCR 1552
            P+ D +  +K     +K  +LT   G P+G+K N +TVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG +T I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  LS  D DY I+DLFNAI TG YPSWT YIQVM++ +AE  PFNPFD+TKVWPHKDYPLI VG++VLNRNP NYF EVEQIAF P NM PGIEASPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+G P+  P  LEH    +G++ R +++++DN +QV  FY  VL+ + + RL ENIAGHL      I+ + V+NF++VH      I   +++ +        H  V  G+ +  R
Sbjct:    7 PASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAR 522          
BLAST of Catalase vs. Ensembl Human
Match: CAT (catalase [Source:HGNC Symbol;Acc:HGNC:1516])

HSP 1 Score: 60.8474 bits (146), Expect = 1.106e-11
Identity = 27/29 (93.10%), Postives = 27/29 (93.10%), Query Frame = 2
Query:  146 QDSVFLDEMAHFDRERIPERVVHAKGAGA 232
            QD VF DEMAHFDRERIPERVVHAKGAGA
Sbjct:    2 QDVVFTDEMAHFDRERIPERVVHAKGAGA 30          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-2 (Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q27487])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/500 (59.20%), Postives = 371/500 (74.20%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLA---QDILYRMERDH 1489
            PSD+ L  YK  +   +++ T N GAPI +K   LT G RGP+L+QD V++DEMAHFDRERIPERVVHAKGAGA G+FE THDI+KY KA +FNK+G +T + +RFSTVG ESGSADT RDPRGFAIKFYTE G WDLVGNNTPIFFIRDP+ FP+FIHTQKRNP+THL+DPNM +DF   RPE  HQ  FL SDRG+PDGYRHM+G+GSHTFK+VN   +A+Y KF FK  QG+KNL+VEKA +L+ +D DY+I+DLFNAIE G++P W ++IQVM++ +AE+  FNPFDVTKVWPH DYPLI+VG++VLNRNPRNYF EVEQ AFCP +++PGIE SPDKMLQGR+FSY DT  HRLG N+  +PVN   CP+R    N + DG M   DN    PN+FPNS+   +  P   +     TGD+ R++S D++NY Q   F+ KVLD  A+ R+ +N AG L  C++ I    + +FSKVH       + ++ +  R H
Sbjct:    5 PSDNQLKTYKETYPKPQVITTSN-GAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADTARDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFDFWLHRPEALHQVMFLFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKNLTVEKAGQLASSDPDYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHFHRLGPNYIQLPVN---CPYRSRAHNTQRDGAMAY-DNQQHAPNFFPNSFNYGKTRPDVKDTTFPATGDVDRYESGDDNNYDQPRQFWEKVLDTGARERMCQNFAGPLGECHDFIIKGMIDHFSKVHPDFGARVKALIQKQARSH 499          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-2 (Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q27487])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/500 (59.20%), Postives = 371/500 (74.20%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLA---QDILYRMERDH 1489
            PSD+ L  YK  +   +++ T N GAPI +K   LT G RGP+L+QD V++DEMAHFDRERIPERVVHAKGAGA G+FE THDI+KY KA +FNK+G +T + +RFSTVG ESGSADT RDPRGFAIKFYTE G WDLVGNNTPIFFIRDP+ FP+FIHTQKRNP+THL+DPNM +DF   RPE  HQ  FL SDRG+PDGYRHM+G+GSHTFK+VN   +A+Y KF FK  QG+KNL+VEKA +L+ +D DY+I+DLFNAIE G++P W ++IQVM++ +AE+  FNPFDVTKVWPH DYPLI+VG++VLNRNPRNYF EVEQ AFCP +++PGIE SPDKMLQGR+FSY DT  HRLG N+  +PVN   CP+R    N + DG M   DN    PN+FPNS+   +  P   +     TGD+ R++S D++NY Q   F+ KVLD  A+ R+ +N AG L  C++ I    + +FSKVH       + ++ +  R H
Sbjct:    5 PSDNQLKTYKETYPKPQVITTSN-GAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADTARDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFDFWLHRPEALHQVMFLFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKNLTVEKAGQLASSDPDYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHFHRLGPNYIQLPVN---CPYRSRAHNTQRDGAMAY-DNQQHAPNFFPNSFNYGKTRPDVKDTTFPATGDVDRYESGDDNNYDQPRQFWEKVLDTGARERMCQNFAGPLGECHDFIIKGMIDHFSKVHPDFGARVKALIQKQARSH 499          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-1 (Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O61235])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 282/493 (57.20%), Postives = 358/493 (72.62%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRN----YEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRM 1477
            PSD+ L  YK  +   +++ T N GAPI +K   LT G RGP+L+QD V++DEMAHFDRERIPERVVHAKGAGA G+FE THDITKY KA +FNK+G +T + VRFSTV  ESGSADTVRDPRGF++KFYTE G WDLVGNNTPIFFIRD + FP+FIH  KRNP+TH+RDPN  +DF   RPE+ HQ  FL SDRGIPDG+R M+G+G+HTFK+VN +   +YCKF FK  QG KNL    A +L+ +D DYAI+DLFNAIE+ N+P W ++IQVM++ +AE+  FNPFDVTKVWPH DYPLI+VG++VLNRN +NYF EVEQ AFCP +++PGIE SPDKMLQGR+FSY DT  HRLG N+  +PVN   CP+R+     + DG M   ++ G+ PNYFPNS+ G +      E     TGD+ R+++ D+ NY Q   F+ KVL  + + RL  N+A  L  C E I+   V+ F+KVH      + +++
Sbjct:    5 PSDNQLKTYKETYPKPQVITTSN-GAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFGNALRHQL 492          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-1 (Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O61235])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 282/493 (57.20%), Postives = 358/493 (72.62%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRN----YEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRM 1477
            PSD+ L  YK  +   +++ T N GAPI +K   LT G RGP+L+QD V++DEMAHFDRERIPERVVHAKGAGA G+FE THDITKY KA +FNK+G +T + VRFSTV  ESGSADTVRDPRGF++KFYTE G WDLVGNNTPIFFIRD + FP+FIH  KRNP+TH+RDPN  +DF   RPE+ HQ  FL SDRGIPDG+R M+G+G+HTFK+VN +   +YCKF FK  QG KNL    A +L+ +D DYAI+DLFNAIE+ N+P W ++IQVM++ +AE+  FNPFDVTKVWPH DYPLI+VG++VLNRN +NYF EVEQ AFCP +++PGIE SPDKMLQGR+FSY DT  HRLG N+  +PVN   CP+R+     + DG M   ++ G+ PNYFPNS+ G +      E     TGD+ R+++ D+ NY Q   F+ KVL  + + RL  N+A  L  C E I+   V+ F+KVH      + +++
Sbjct:    5 PSDNQLKTYKETYPKPQVITTSN-GAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFGNALRHQL 492          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-3 (Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 281/492 (57.11%), Postives = 356/492 (72.36%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRN----YEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRM 1477
            ++D L  Y+ D   E  LLT + GAPI +K   LT G RGP+L+QD V++DEMAHFDRERIPERVVHAKG GA G+FE THDITKY KA +FNK+G +T + VRFSTV  ESGSADTVRDPRGF++KFYTE G WDLVGNNTPIFFIRD + FP+FIH  KRNP+TH+RDPN  +DF   RPE+ HQ  FL SDRGIPDG+R M+G+G+HTFK+VN +   +YCKF FK  QG KNL    A +L+ +D DYAI+DLFNAIE+ N+P W ++IQVM++ +AE+  FNPFDVTKVWPH DYPLI+VG++VLNRN +NYF EVEQ AFCP +++PGIE SPDKMLQGR+FSY DT  HRLG N+  +PVN   CP+R+     + DG M   ++ G+ PNYFPNS+ G +      E     TGD+ R+++ D+ NY Q   F+ KVL  + + RL  N+A  L  C E I+   V+ F+KVH      + +++
Sbjct:    2 AEDQLKAYR-DRNQEPHLLTTSNGAPIYSKTAVLTAGRRGPMLMQDIVYMDEMAHFDRERIPERVVHAKGGGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFGNALRHQL 488          
BLAST of Catalase vs. Ensembl Fly
Match: Cat (gene:FBgn0000261 transcript:FBtr0075058)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 301/482 (62.45%), Postives = 369/482 (76.56%), Query Frame = 2
Query:   35 YKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNP--KYLEHREHITGDIYRHDSSD-EDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQ 1459
            YK+        +T   GAPIG K  S TVG RGPILLQD  FLDEM+HFDRERIPERVVHAKGAGAFG+FE THDIT+Y  A +F+K+  RT + VRFSTVG ESGSADT RDPRGFA+KFYTE G+WDLVGNNTP+FFIRDP+ FPSFIHTQKRNP+THL+DP+MFWDF +LRPE+ HQ   L SDRG PDGY HM+G+GSHTFKL+N K E +Y KF FKT+QGIKNL V+ A +L+ TD DY+I+DL+N I+T  +PSWT+YIQVM+Y +A++  +NPFDVTKVW  K+YPLI VG++VL+RNP+NYF EVEQIAF P +++PG+E SPDKML GRLFSY DT RHRLG N+  IPVN   CP++    N++ DG M V DN    PNYFPNS+ GPQ  P  + L     +TGD+YR+ S D EDN+ QVT F+  VLD  AK RL +NIAGHL + ++ ++ R V+NF++VH    +
Sbjct:   14 YKNSQTVSPGAITTGNGAPIGIKDASQTVGPRGPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYFEVTHDITQYCAAKIFDKVKKRTPLAVRFSTVGGESGSADTARDPRGFAVKFYTEDGVWDLVGNNTPVFFIRDPILFPSFIHTQKRNPQTHLKDPDMFWDFLTLRPESAHQVCILFSDRGTPDGYCHMNGYGSHTFKLINAKGEPIYAKFHFKTDQGIKNLDVKTADQLASTDPDYSIRDLYNRIKTCKFPSWTMYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRNPKNYFAEVEQIAFSPAHLVPGVEPSPDKMLHGRLFSYSDTHRHRLGPNYLQIPVN---CPYKVKIENFQRDGAMNVTDNQDGAPNYFPNSFNGPQECPRARALSSCCPVTGDVYRYSSGDTEDNFGQVTDFWVHVLDKCAKKRLVQNIAGHLSNASQFLQERAVKNFTQVHADFGR 492          
BLAST of Catalase vs. Ensembl Fly
Match: CG9314 (gene:FBgn0032061 transcript:FBtr0339543)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 272/482 (56.43%), Postives = 352/482 (73.03%), Query Frame = 2
Query:   35 YKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPF----RNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREH--ITGDIYRHDSSD-EDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQ 1459
            YK++  + +  +T ++G P+G K    TVG RGP LLQD  FLDE+ HFD ERIPERV +AKGAGAFG+FECTHDI+K+  AS+F+K+  RT + +RFS    E GSADTVR+ RGFA+KFYT+ GIWD+VG N P+ ++RDPM FPS +H QKRNP+THL+DP+MFWDF +LRPET H      SDRG PDGYRH+HG+G HT++++N   E  Y +F FKT+QGIKNL   +  EL   D DYAI+DL+N+I+ GNYPSW++YIQVM   EA++C FNPFDVTKVWP KD+PL+ VG+IVL+RNP NYF EVEQ+AF P +M+PGIE SPDKMLQGRLF+Y D+QRHRLG N+  IPVN   CP+    RN++ DG M V DN    PNYFPNS+ GP+ +P+ L  +    ++GD+YR  S D EDN+SQVT F+T  LD   + RL  N++ HL   ++ ++ R V+ F+ VH    +
Sbjct:   14 YKNNDSEVQREITTSSGTPVGVKDAIQTVGPRGPALLQDFQFLDEVMHFDSERIPERVAYAKGAGAFGYFECTHDISKFCAASIFDKVRKRTAVAMRFSVACGEQGSADTVREQRGFAVKFYTDDGIWDIVGCNMPVHYVRDPMLFPSLVHAQKRNPQTHLKDPDMFWDFMTLRPETLHALLMYFSDRGTPDGYRHLHGYGVHTYRMINASGETQYVRFHFKTDQGIKNLDARRCEELMSHDPDYAIRDLYNSIKKGNYPSWSMYIQVMLNEEAKKCRFNPFDVTKVWPQKDFPLLPVGKIVLDRNPTNYFTEVEQLAFSPAHMVPGIEPSPDKMLQGRLFAYGDSQRHRLGVNYMQIPVN---CPYRVNVRNFQRDGAMTVTDNQNGAPNYFPNSFCGPRESPRALGLQTCCPLSGDVYRFMSGDTEDNFSQVTDFWTYTLDNCGRKRLVRNLSEHLTEASQFLQERAVKLFTMVHSDFGR 492          
BLAST of Catalase vs. Ensembl Fly
Match: CG9314 (gene:FBgn0032061 transcript:FBtr0079731)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 272/482 (56.43%), Postives = 352/482 (73.03%), Query Frame = 2
Query:   35 YKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPF----RNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREH--ITGDIYRHDSSD-EDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQ 1459
            YK++  + +  +T ++G P+G K    TVG RGP LLQD  FLDE+ HFD ERIPERV +AKGAGAFG+FECTHDI+K+  AS+F+K+  RT + +RFS    E GSADTVR+ RGFA+KFYT+ GIWD+VG N P+ ++RDPM FPS +H QKRNP+THL+DP+MFWDF +LRPET H      SDRG PDGYRH+HG+G HT++++N   E  Y +F FKT+QGIKNL   +  EL   D DYAI+DL+N+I+ GNYPSW++YIQVM   EA++C FNPFDVTKVWP KD+PL+ VG+IVL+RNP NYF EVEQ+AF P +M+PGIE SPDKMLQGRLF+Y D+QRHRLG N+  IPVN   CP+    RN++ DG M V DN    PNYFPNS+ GP+ +P+ L  +    ++GD+YR  S D EDN+SQVT F+T  LD   + RL  N++ HL   ++ ++ R V+ F+ VH    +
Sbjct:   14 YKNNDSEVQREITTSSGTPVGVKDAIQTVGPRGPALLQDFQFLDEVMHFDSERIPERVAYAKGAGAFGYFECTHDISKFCAASIFDKVRKRTAVAMRFSVACGEQGSADTVREQRGFAVKFYTDDGIWDIVGCNMPVHYVRDPMLFPSLVHAQKRNPQTHLKDPDMFWDFMTLRPETLHALLMYFSDRGTPDGYRHLHGYGVHTYRMINASGETQYVRFHFKTDQGIKNLDARRCEELMSHDPDYAIRDLYNSIKKGNYPSWSMYIQVMLNEEAKKCRFNPFDVTKVWPQKDFPLLPVGKIVLDRNPTNYFTEVEQLAFSPAHMVPGIEPSPDKMLQGRLFAYGDSQRHRLGVNYMQIPVN---CPYRVNVRNFQRDGAMTVTDNQNGAPNYFPNSFCGPRESPRALGLQTCCPLSGDVYRFMSGDTEDNFSQVTDFWTYTLDNCGRKRLVRNLSEHLTEASQFLQERAVKLFTMVHSDFGR 492          
BLAST of Catalase vs. Ensembl Zebrafish
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 300/495 (60.61%), Postives = 376/495 (75.96%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            S D + ++K     ++  +LT   G PIG+K N++T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y+KA +F  IG  T I VRFSTV  E+GS+DTVRDPRGFA+KFYT+ G WDL GNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDGYRHM+G+GSHTFKLVN + + VYCKF +KTNQGIKN+ VE+A  L+ TD DY+I+DL+NAI  GN+PSWT YIQVM++ +AE   +NPFD+TKVW HK++PLI VGR VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLGAN+  +PVN   CP+R    NY+ DGPM + DN G  PNY+PNS+  P   P++LE +  ++ D+ R++S+D+DN +QV  F+T+VL+   + RL +N+AGHL      I+ R V+N   VH      +   +++
Sbjct:    8 STDQMKLWKEGRGSQRPDVLTTGAGVPIGDKLNAMTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKTTPIAVRFSTVAGEAGSSDTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDTLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGYRHMNGYGSHTFKLVNAQGQPVYCKFHYKTNQGIKNIPVEEADRLAATDPDYSIRDLYNAIANGNFPSWTFYIQVMTFEQAENWKWNPFDLTKVWSHKEFPLIPVGRFVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSFSAPDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKGAQLFIQKRMVQNLMAVHSDYGNRVQALLDK 499          
BLAST of Catalase vs. Ensembl Zebrafish
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 297/477 (62.26%), Postives = 368/477 (77.15%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            +LT   G PIG+K N++T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y+KA +F  IG  T I VRFSTV  E+GS+DTVRDPRGFA+KFYT+ G WDL GNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDGYRHM+G+GSHTFKLVN + + VYCKF +KTNQGIKN+ VE+A  L+ TD DY+I+DL+NAI  GN+PSWT YIQVM++ +AE   +NPFD+TKVW HK++PLI VGR VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLGAN+  +PVN   CP+R    NY+ DGPM + DN G  PNY+PNS+  P   P++LE +  ++ D+ R++S+D+DN +QV  F+T+VL+   + RL +N+AGHL      I+ R V+N   VH      +   +++
Sbjct:    4 VLTTGAGVPIGDKLNAMTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKTTPIAVRFSTVAGEAGSSDTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDTLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGYRHMNGYGSHTFKLVNAQGQPVYCKFHYKTNQGIKNIPVEEADRLAATDPDYSIRDLYNAIANGNFPSWTFYIQVMTFEQAENWKWNPFDLTKVWSHKEFPLIPVGRFVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSFSAPDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKGAQLFIQKRMVQNLMAVHSDYGNRVQALLDK 477          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 312/493 (63.29%), Postives = 380/493 (77.08%), Query Frame = 2
Query:   20 DPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            D + ++K     +K  +LT   G PI +K N LTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I +RFSTV  ESGSADTVRDPRGFA+K YTE G WDL GNNTP+FFIRD M FPSFIH+QKRNP+THL+DP+M WDF +LRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN KDEAVYCKF +KT+QGI+NL+VE+A  LS +D DY I DL+ +I  GNYPSW+ YIQVM++++AE+  FNPFD+TK+WPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLG N+  +PVN   CP+R    NY+ DGPM   DN G  PNY+PNS+  P++ P+  EHR H++ D+ R++S+DEDN SQV  FY KVL  + ++RL ENIAGHL      I+ R V+NF+ VH +    I   +++
Sbjct:   10 DQMKLWKESRGSQKPDVLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 499          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 314/491 (63.95%), Postives = 378/491 (76.99%), Query Frame = 2
Query:   23 PLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            PL V K D      +LT   G PI +K N LTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I +RFSTV  ESGSADTVRDPRGFA+K YTE G WDL GNNTP+FFIRD M FPSFIH+QKRNP+THL+DP+M WDF +LRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN KDEAVYCKF +KT+QGI+NL+VE+A  LS +D DY I DL+ +I  GNYPSW+ YIQVM++++AE+  FNPFD+TK+WPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLG N+  +PVN   CP+R    NY+ DGPM   DN G  PNY+PNS+  P++ P+  EHR H++ D+ R++S+DEDN SQV  FY KVL  + ++RL ENIAGHL      I+ R V+NF+ VH +    I   +++
Sbjct:    8 PLLVTKPD------VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 489          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 317/516 (61.43%), Postives = 385/516 (74.61%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL*VGIGNFIFCRLTFSTFSKRLCNFIDF 1600
            +LT   G PI +K N LTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I +RFSTV  ESGSADTVRDPRGFA+K YTE G WDL GNNTP+FFIRD M FPSFIH+QKRNP+THL+DP+M WDF +LRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN KDEAVYCKF +KT+QGI+NL+VE+A  LS +D DY I DL+ +I  GNYPSW+ YIQVM++++AE+  FNPFD+TK+WPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLG N+  +PVN   CP+R    NY+ DGPM   DN G  PNY+PNS+  P++ P+  EHR H++ D+ R++S+DEDN SQV  FY KVL  + ++RL ENIAGHL      I+ R V+NF+ VH +    I   +++ +     +  H         F R   S  + RL + I F
Sbjct:   15 VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDKYNAEGYGMTIH---------FVRSPDSHINSRLSHNITF 518          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 309/477 (64.78%), Postives = 373/477 (78.20%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            +LT   G PI +K N LTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I +RFSTV  ESGSADTVRDPRGFA+K YTE G WDL GNNTP+FFIRD M FPSFIH+QKRNP+THL+DP+M WDF +LRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN KDEAVYCKF +KT+QGI+NL+VE+A  LS +D DY I DL+ +I  GNYPSW+ YIQVM++++AE+  FNPFD+TK+WPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLG N+  +PVN   CP+R    NY+ DGPM   DN G  PNY+PNS+  P++ P+  EHR H++ D+ R++S+DEDN SQV  FY KVL  + ++RL ENIAGHL      I+ R V+NF+ VH +    I   +++
Sbjct:   15 VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 488          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 309/477 (64.78%), Postives = 373/477 (78.20%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            +LT   G PI +K N LTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I +RFSTV  ESGSADTVRDPRGFA+K YTE G WDL GNNTP+FFIRD M FPSFIH+QKRNP+THL+DP+M WDF +LRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN KDEAVYCKF +KT+QGI+NL+VE+A  LS +D DY I DL+ +I  GNYPSW+ YIQVM++++AE+  FNPFD+TK+WPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLG N+  +PVN   CP+R    NY+ DGPM   DN G  PNY+PNS+  P++ P+  EHR H++ D+ R++S+DEDN SQV  FY KVL  + ++RL ENIAGHL      I+ R V+NF+ VH +    I   +++
Sbjct:   15 VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 488          
BLAST of Catalase vs. Ensembl Mouse
Match: Cat (catalase [Source:MGI Symbol;Acc:MGI:88271])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 313/496 (63.10%), Postives = 375/496 (75.60%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            P+ D +  +K     ++  +LT   G PIG+K N +T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y+KA +F  IG RT I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNL V +A  L+  D DY ++DLFNAI  GNYPSWT YIQVM+++EAE  PFNPFD+TKVWPHKDYPLI VG++VLN+NP NYF EVEQ+AF P NM PGIE SPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+  P+     LEH      D+ R +S++EDN +QV  FYTKVL+ + + RL ENIAGHL      I+ + V+NF+ VH      I   +++
Sbjct:    7 PASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNADGEAVYCKFHYKTDQGIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFYIQVMTFKEAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQRSALEHSVQCAVDVKRFNSANEDNVTQVRTFYTKVLNEEERKRLCENIAGHLKDAQLFIQKKAVKNFTDVHPDYGARIQALLDK 499          
BLAST of Catalase vs. Ensembl Mouse
Match: Cat (catalase [Source:MGI Symbol;Acc:MGI:88271])

HSP 1 Score: 124.405 bits (311), Expect = 9.971e-33
Identity = 57/96 (59.38%), Postives = 72/96 (75.00%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNK 295
            P+ D +  +K     ++  +LT   G PIG+K N +T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y+KA + N+
Sbjct:    7 PASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVLNE 102          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|P00432|CATA_BOVIN (Catalase OS=Bos taurus OX=9913 GN=CAT PE=1 SV=3)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 324/496 (65.32%), Postives = 384/496 (77.42%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            P+ D +  +K     +K  +LT   G P+G+K NSLTVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y+KA +F  IG RT I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  L+  D DY ++DLFNAI TGNYPSWTLYIQVM++ EAE  PFNPFD+TKVWPH DYPLI VG++VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+  P+H P  LEHR H +GD+ R +S+++DN +QV  FY KVL+ + + RL ENIAGHL      I+ + V+NFS VH +    I   +++
Sbjct:    7 PASDQMKHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLAHEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFSEAEIFPFNPFDLTKVWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMMDNQGGAPNYYPNSFSAPEHQPSALEHRTHFSGDVQRFNSANDDNVTQVRTFYLKVLNEEQRKRLCENIAGHLKDAQLFIQKKAVKNFSDVHPEYGSRIQALLDK 499          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q2I6W4|CATA_CALJA (Catalase OS=Callithrix jacchus OX=9483 GN=CAT PE=2 SV=3)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 323/519 (62.24%), Postives = 386/519 (74.37%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL*VGIGNFIFCR 1552
            P+ D +  +K     +K  +LT   G P+G+K N +T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG RT I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+ P+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  LS  D DY ++DLFNAI TGNYPSWT YIQVM++ +AE  PFNPFDVTK+WPHKDYPLI VG++VLNRNP NYF EVEQIAF P NM PGIEASPDKMLQGRLFSY DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+G P+H P  LEH    + ++ R +++++DN +QV  FY  VL+ + + RL ENIAGHL      I+ + V+NF +VH      I   +++ +        H  V  G+ +  R
Sbjct:    7 PASDQMKHWKEQRAAQKADVLTTGAGNPVGDKLNVITAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPLLFPSFIHSQKRNPQTHLKHPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTFYIQVMTFSQAETFPFNPFDVTKIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFSYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEHQPSALEHSTRCSAEVQRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQLFIQKKAVKNFREVHNDYGTRIQALLDKYNAEKPKNAIHTFVQSGSHLAAR 522          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|P04040|CATA_HUMAN (Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 323/519 (62.24%), Postives = 388/519 (74.76%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL*VGIGNFIFCR 1552
            P+ D +  +K     +K  +LT   G P+G+K N +TVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG +T I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  LS  D DY I+DLFNAI TG YPSWT YIQVM++ +AE  PFNPFD+TKVWPHKDYPLI VG++VLNRNP NYF EVEQIAF P NM PGIEASPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+G P+  P  LEH    +G++ R +++++DN +QV  FY  VL+ + + RL ENIAGHL      I+ + V+NF++VH      I   +++ +        H  V  G+ +  R
Sbjct:    7 PASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAR 522          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q5RF10|CATA_PONAB (Catalase OS=Pongo abelii OX=9601 GN=CAT PE=2 SV=3)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 322/519 (62.04%), Postives = 386/519 (74.37%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL*VGIGNFIFCR 1552
            P+ D +  +K     +K  +LT   G P+G+K N +TVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDITKY+KA +F  IG +T I VRFSTV  ESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  LS  D DY I+DLFNAI T  YPSWT YIQVM++ +AE  PFNPFD+TKVWPHKDYPLI VG++VLNRNP NYF EVEQIAF P NM PGIEASPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM + DN G  PNY+PNS+G P+  P  LEH    +G++ R +++ +DN +QV  FY  VL+ + + RL ENIAGHL      I+ + V+NF++VH      I   +++ +        H  V  G+ +  R
Sbjct:    7 PASDQMKHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATEKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSTQCSGEVQRFNTASDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSRIQALLDKYNAEKPKNAIHTFVQSGSHLAAR 522          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q64405|CATA_CAVPO (Catalase OS=Cavia porcellus OX=10141 GN=CAT PE=2 SV=4)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 319/496 (64.31%), Postives = 381/496 (76.81%), Query Frame = 2
Query:   11 PSDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            P+ D +  +K +   +K  +LT   G P+G+K N +TVG RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAF +FE THDITKY KA +F  IG +T I VRFSTV  ESGSADTVRDPRGFA+KFYTE GIWDLVGNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE+ HQ +FL SDRGIPDG+RHM+G+GSHTFKLVN   EAVYCKF +KT+QGIKNLSVE A  LS  D DY ++DLFNAI TGNYPSWTLYIQVM++++A+  PFNPFD+TK+WPHKDYPLI VG++VLNRNP NYF EVEQIAF P NM PGIE SPDKMLQGRLF+Y DT RHRLG N+  IPVN   CP+R    NY+ DGPM V DN G  PNY+PNS+  P    + LEH    +GD+ R++S+D+DN +QV  FYT+VL+ + + RL ENIAGHL      I+ + V+NF  VH      I   +++
Sbjct:    7 PASDQMKHWKEERAAQKPDVLTTAGGNPVGDKLNIMTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFAYFEVTHDITKYCKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEEGIWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDMMWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNGSGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFQQAQSFPFNPFDLTKIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRTRVANYQRDGPMCVTDNQGGAPNYYPNSFSAPVEQRQALEHTSRCSGDVGRYNSTDDDNVTQVRAFYTQVLNEEQRRRLCENIAGHLKDAQLFIQKKAVKNFMDVHPDYGNRIQTLLDK 499          
BLAST of Catalase vs. TrEMBL
Match: A0A385G1K5 (Catalase OS=Dugesia japonica OX=6161 GN=CAT PE=2 SV=1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 392/501 (78.24%), Postives = 443/501 (88.42%), Query Frame = 2
Query:   17 DDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 1519
            ++ LS  K  ++ EKILLTR+TGAPIG+KFNS+TVG RGPILLQD+VF+DEMAHFDRERIPERVVHAKG GA G+FECTHDITKYTKA  F+KIG +TD+ VRFSTV  E GSADTVR+PRGFA+KFYTE G WDLVGNNTPIFFIRDP+FFPSFIH+QKRNPKT LRDPNM WDFQSLRPET+HQFAFL +DRGIPDG+RHMHGFGSHTFKLVN+ DE VYCKFIF+TNQGIKNL+VE A  LSG + DYAI DLFNAIET N+PSWT  IQVM+Y +A+ C FNPFDVTKVWPHKD+PLI+VG++VLN+NP NYFME+EQ+AFCP N IPGIEASPD+MLQGRLFSYRDTQRHRLGANF LIPVNKP+CPFRNYEVDGPMRVDDNN  MPNY+PNSYGGP+HNPKYLE RE  TGDIYR D++DEDN+SQVTIFYTKVLD +AK+RLA+NIA  L  C E+IRAR V NFSKVH++L++DIL  ME+D GV TNL CHL
Sbjct:    6 NNSLSDCKCMNKGEKILLTRSTGAPIGDKFNSITVGPRGPILLQDTVFIDEMAHFDRERIPERVVHAKGGGASGYFECTHDITKYTKAIPFSKIGKKTDVIVRFSTVSPELGSADTVRNPRGFAVKFYTEHGNWDLVGNNTPIFFIRDPIFFPSFIHSQKRNPKTFLRDPNMMWDFQSLRPETSHQFAFLFADRGIPDGFRHMHGFGSHTFKLVNENDEPVYCKFIFQTNQGIKNLTVENALLLSGKNPDYAIMDLFNAIETRNFPSWTFCIQVMTYEQAKNCSFNPFDVTKVWPHKDFPLIEVGQMVLNKNPMNYFMEIEQLAFCPSNFIPGIEASPDRMLQGRLFSYRDTQRHRLGANFDLIPVNKPRCPFRNYEVDGPMRVDDNNANMPNYYPNSYGGPEHNPKYLERREPSTGDIYRFDNADEDNHSQVTIFYTKVLDNEAKLRLAKNIAESLGQCKEVIRARAVNNFSKVHQQLSRDILMYMEQDLGVKTNLTCHL 506          
BLAST of Catalase vs. TrEMBL
Match: B9ZZQ2 (Catalase OS=Brachionus plicatilis OX=10195 GN=Ctl PE=2 SV=1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 337/504 (66.87%), Postives = 393/504 (77.98%), Query Frame = 2
Query:   20 DPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPF--RNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHE------KLAQDILYRMERDHGVITNL 1507
            D L  Y    R++  LLT   G P+G+K NSLTVG RGPILLQD V LDEMAHFDRERIPERVVHAKGAGAFG+FE THDI+KYTKA +F+KIG RT I +RFSTVG ESGSADT RDPRGFA+KFYTE GIWDLVGNNTPIFFIRDP+ FPSFIHTQKRNP THL+D NMFWDF SLRPET+HQ +FL SDRG PDGYRHM+G+GSHTFKLVN +   VYCKF FKT+QGIKNLS ++A+ELSG + DY+ +DL+NAI  GN+PSWTLYIQVMS+ EAE+C FNPFD+TK+WPH +YPLI VGR+VLNRNP NYF EVEQIAF P ++IPGIE SPDKMLQGRLFSY DT RHRLGAN+  IPVN   CPF  RNY+ DGP  ++DN    PNY+PNS+ GP+HN  ++E    ++GDI R+DS +EDN+SQV +F+ KVL+   K RL ENI+GHL +  E I+ R V NF K H       K A D+L   E      +NL
Sbjct:    8 DQLCEYAKKMRNQSELLTTGHGQPVGDKLNSLTVGPRGPILLQDVVLLDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDISKYTKAVVFDKIGKRTPIAIRFSTVGGESGSADTARDPRGFAVKFYTEHGIWDLVGNNTPIFFIRDPILFPSFIHTQKRNPVTHLKDANMFWDFISLRPETSHQVSFLFSDRGTPDGYRHMNGYGSHTFKLVNAQGNPVYCKFHFKTDQGIKNLSAQRASELSGENPDYSTQDLYNAIGCGNFPSWTLYIQVMSFEEAEKCKFNPFDLTKIWPHGEYPLIPVGRLVLNRNPTNYFAEVEQIAFAPSHLIPGIEPSPDKMLQGRLFSYADTHRHRLGANYLQIPVN---CPFKVRNYQRDGPQCINDNQDGAPNYYPNSFSGPEHNSVHIESICPVSGDIRRYDSGNEDNFSQVGLFWEKVLNDQEKQRLIENISGHLINAAEFIQERAVTNFGKCHPDYGRRLKEALDLLKNKEASAIKKSNL 508          
BLAST of Catalase vs. TrEMBL
Match: A0A131XP47 (Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 326/504 (64.68%), Postives = 391/504 (77.58%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNC 1513
            + D L  +K  H++   LLT + G P+G+K N  TVG RGP+LLQD VFLDEMAHFDRERIPERVVHAKGAGAFG+ E THDITKY KA++FN++G +T + +RFSTVG ESGSADTVRDPRGFAIKFYTE G WDLVGNNTPIFFIRDP  FPSFIHTQKRNP THL+DP+MFWDF SLRPETTHQ  FL SDRGIPDGYRHM+G+GSHTFKLVNDK+EAVYCKF FKT+Q IKNL V+KA +LSG D DY+I+DL+N+I    YP+W++YIQVM++ +A +  +NPFD+TKVWPHK++PLI VGR+VL+RNP+NYF+EVEQ+AFCP N++PG+E SPDKMLQGRLFSY DT RHRLG NF  IPVN   CP++     Y+ DG M V +N    PNYFPNS+ GP  NPKY EH    +GD+ R +S+DEDN+SQ   FY K+L  D + RL  NIA HL    E IRAR V+NFSK H +    I  ++++   V  N  C
Sbjct:    7 ATDQLKEFKEGHKNAS-LLTTSIGCPVGDKTNVQTVGPRGPVLLQDVVFLDEMAHFDRERIPERVVHAKGAGAFGYLEITHDITKYCKAAIFNQVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFLFPSFIHTQKRNPATHLKDPDMFWDFISLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGDLSGADPDYSIRDLYNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQLAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVATYQRDGFMTVTNNEEGAPNYFPNSFSGPVDNPKYKEHVTQASGDVERWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPECGASIAKKLDKLVQVSPNGMC 505          
BLAST of Catalase vs. TrEMBL
Match: E9NS22 (Catalase OS=Pinctada fucata OX=50426 PE=2 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 319/477 (66.88%), Postives = 386/477 (80.92%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPF----RNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            +LT  TGAP+G K  +LTVG RGP+LLQD VF DEMAHF+RERIPERVVHAKGAGAFG+FECTHDITKY KA  F  +G +T +GVRFSTVG ESGSADT RDPRGFA+K YTE G WDLVGNNTPIFFIRDPM FPSFIHTQKRNP+THL+DP+MFWDF SLRPETTHQ +FL SDRG PDGYRHM+G+GSHTFK+VN++ EA YCKF +K +QGIKNL  +KA +L+  D DYAI+DL+NAI  GN+P+WTL +QVMS++EAE+  +NPFD+TK+WP  ++PLI VGR+VLNRNP+NYF EVEQIAF PV+MIPGIEASPDKMLQGRLFSY DT RHRLG+N+  IPVN   CPF    +NY+ DGP  VD+N G  PNYFPNS+ GPQ N  ++E    +TGD+ R++++D+DNYSQV++F+ KVL  + + RL ENIAGHL + +E I+ RTV NFS+V  +    I   M++
Sbjct:   23 VLTTGTGAPVGTKTATLTVGPRGPVLLQDFVFTDEMAHFNRERIPERVVHAKGAGAFGYFECTHDITKYCKAKPFEFVGKKTPLGVRFSTVGGESGSADTARDPRGFAVKMYTEDGNWDLVGNNTPIFFIRDPMLFPSFIHTQKRNPQTHLKDPDMFWDFISLRPETTHQVSFLFSDRGTPDGYRHMNGYGSHTFKMVNNQGEAFYCKFHWKVDQGIKNLMADKAAQLATDDPDYAIRDLYNAISEGNFPTWTLKVQVMSFQEAEKFRYNPFDLTKIWPQGEFPLIPVGRMVLNRNPKNYFAEVEQIAFSPVHMIPGIEASPDKMLQGRLFSYSDTHRHRLGSNYLQIPVN---CPFNSRVKNYQRDGPQCVDENQGGAPNYFPNSFVGPQDNTNHMESAFTLTGDVKRYNTADDDNYSQVSVFFRKVLKPEERRRLIENIAGHLVNASEFIQKRTVSNFSQVDPEYGGGIQKLMDK 496          
BLAST of Catalase vs. TrEMBL
Match: A0A0K8RIX4 (Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 323/494 (65.38%), Postives = 388/494 (78.54%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRN----YEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            + D L  +K  H++   LLT + G P+G+K N  TVG RGP+LLQD VFLDEMAHFDRERIPERVVHAKGAGAFG+ E THDITKY KA++FN++G +T + +RFSTVG ESGSADTVRDPRGFAIKFYTE G WDLVGNNTPIFFIRDP  FPSFIHTQKRNP THL+DP+MFWDF SLRPETTHQ  FL SDRGIPDGYRHM+G+GSHTFKLVNDK+EAVYCKF FKT+Q IKNL V+KA +LSG D DY+I+DL+N+I    YP+W++YIQVM++ +A +  +NPFD+TKVWPHK++PLI VGR+VL+RNP+NYF+EVEQ+AFCP N++PG+E SPDKMLQGRLFSY DT RHRLG NF  IPVN   CP++     Y+ DG M V +N    PNYFPNS+ GP  NPKY EH    +GD+ R +S+DEDN+SQ   FY K+L  D + RL  NIA HL    E IRAR V+NFSK H +    I  ++++
Sbjct:    7 ATDQLKEFKEGHKNAS-LLTTSIGCPVGDKTNVQTVGPRGPVLLQDVVFLDEMAHFDRERIPERVVHAKGAGAFGYLEITHDITKYCKAAIFNQVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFLFPSFIHTQKRNPATHLKDPDMFWDFISLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGDLSGADPDYSIRDLYNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQLAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVAPYQRDGFMTVTNNEEGAPNYFPNSFSGPVDNPKYKEHVTQASGDVDRWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPECGASIAKKLDK 495          
BLAST of Catalase vs. Ensembl Cavefish
Match: cat (catalase [Source:NCBI gene;Acc:103032916])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 298/507 (58.78%), Postives = 378/507 (74.56%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 1519
            + D + ++K +   ++   LT   G P+G+K N  T G +GP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THD+T+Y KA +F  +G  T I VRFSTV  E+GSADTVRDPRGFA+KFYTE G WDL GNNTPIFFIRD M FPSFIH+QKRNP+THL+D +M WDF SLRPE  HQ +FL SDRG+PDG+RHM+G+GSHTFKL+N +   VYCKF +KT+QGIKNL VE+A  L+ TD DYAI+DLF+AI  GN+PSWT YIQVM++ +AE  P+NPFD+TKVW HKD+PLI VGR+VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLGAN+  +PVN   CP+R    NY+ DGPM + DN G  PNY+PNS+  P++ P+ +E +  ++ D+ R++S+D+DN +QV  F+T+VL+   + RL +N+AGHL      I+ R V+    VH+     +   +++ H   +  N H+
Sbjct:    8 ATDQMKLWKENRGSQRPDALTTGAGVPVGDKLNVQTAGPQGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDVTRYCKAKVFEHVGKTTPIAVRFSTVAGEAGSADTVRDPRGFAVKFYTEDGNWDLTGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDADMVWDFWSLRPECLHQVSFLFSDRGLPDGFRHMNGYGSHTFKLINAQGNPVYCKFHYKTDQGIKNLPVEEADRLASTDPDYAIRDLFSAIANGNFPSWTFYIQVMTFEQAENFPWNPFDLTKVWSHKDFPLIPVGRLVLNRNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRARVANYQRDGPMCMTDNQGGAPNYYPNSFSAPKNQPQCMESKFRVSADVGRYNSADDDNVTQVRTFFTEVLNDAERERLCQNMAGHLKGAQLFIQKRMVQRLMAVHKNYGTRVQALLDK-HNAESKKNLHV 510          
BLAST of Catalase vs. Ensembl Sea Lamprey
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 298/471 (63.27%), Postives = 358/471 (76.01%), Query Frame = 2
Query:   65 LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPF----RNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDI 1465
            +LT   G PI +K N  T G RGP+L+QD+VF DEMAHFDRERIPERVVHAKGAGAFGFFE THDIT Y KA +F  +G RT I VRFSTVG ESGSADTVRDPRGF +KFYTE G WDLVGNN PIFFIRDP+ FPSFIHTQKRNP+THL+DP+MFWDF SLRPE+ H    L SDRGIPDGYRHM+G+GSHTFK+VN   EAVYCKF +KT+QGI+N+ VE A  LSGTD DY+I+DL+  I  GN+P+WTLY+Q+M++ +AE   +NPFD+TKVWPH ++PLI VGR+ LNRNP +YF EVEQIAF P NM PGIE SPDKMLQGRLFSY DT RHRLGAN+  +PVN   CPF    RNY+ DGPM + DN    PNY+PNS+  P+  P   EH+  ++ D+ R++S+D+DNYSQV  FY  VL    + RL +NIAG+L    + I+ R V+  +  H +L   +
Sbjct:    4 VLTTGAGNPISDKLNVQTAGPRGPLLVQDTVFTDEMAHFDRERIPERVVHAKGAGAFGFFEVTHDITNYCKAKVFEHVGKRTPIAVRFSTVGGESGSADTVRDPRGFPVKFYTEEGNWDLVGNNVPIFFIRDPILFPSFIHTQKRNPQTHLKDPDMFWDFFSLRPESLHHMCILFSDRGIPDGYRHMNGYGSHTFKMVNAAGEAVYCKFHYKTDQGIRNIPVEVAERLSGTDPDYSIRDLYRTIADGNFPTWTLYVQIMTFAQAEVHRWNPFDLTKVWPHGEFPLIPVGRLELNRNPTDYFAEVEQIAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLHLPVN---CPFRARVRNYQRDGPMCMFDNQAGAPNYYPNSFSAPEQQPHLREHKFAVSADVQRYNSADDDNYSQVNTFYGSVLSEAERTRLVQNIAGNLKEAQKFIQERMVKQLTLAHSELGARV 471          
BLAST of Catalase vs. Ensembl Yeast
Match: CTA1 (Catalase A; breaks down hydrogen peroxide in the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p) during fatty acid beta-oxidation [Source:SGD;Acc:S000002664])

HSP 1 Score: 440.269 bits (1131), Expect = 2.275e-150
Identity = 240/495 (48.48%), Postives = 313/495 (63.23%), Query Frame = 2
Query:   41 SDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPE---TTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKP-QCPFRNYEV-DGPMRVDDNNGEMPNYFPN--SYGGPQHNPKYLEHREHITGDI--YRHDSSDED-NYSQVTIFYTKVLDADAKMR-LAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHG 1492
            SD R+++++ T +TG PI   F +  +G  GP+LLQD   +D +AHF+RE IP+R  HA G+GAFG+FE T DIT    +++F+KIG RT    RFSTVG + GSADTVRDPRGFA KFYTE G  D V NNTP+FFIRDP  FP FIHTQKRNP+T+LRD +MFWDF +  PE     HQ   L SDRG P  YR MHG+  HT+K  N   +  Y +   KT+QGIKNL++E+AT+++G++ DY  +DLF AI+ GNYPSWT+YIQ M+ R+A++ PF+ FD+TKVWP   +PL +VG+IVLN NP N+F +VEQ AF P   +P  EAS D +LQ RLFSY D  R+RLG NF  IPVN P    F N  + DGPM V+ N G  P Y  N  SY   Q +    +H+E   G    Y   +S  D ++ Q    Y  +     + + LA NI  H+      I+ R    F++V + L++ I    E  H 
Sbjct:   14 SDVREDRVV-TNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADTVRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDFLTT-PENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHRYRLGPNFHQIPVNCPYASKFFNPAIRDGPMNVNGNFGSEPTYLANDKSYTYIQQDRPIQQHQEVWNGPAIPYHWATSPGDVDFVQARNLYRVLGKQPGQQKNLAYNIGIHVEGACPQIQQRVYDMFARVDKGLSEAIKKVAEAKHA 506          
BLAST of Catalase vs. Ensembl Yeast
Match: CTT1 (Cytosolic catalase T; has a role in protection from oxidative damage by hydrogen peroxide [Source:SGD;Acc:S000003320])

HSP 1 Score: 346.28 bits (887), Expect = 3.638e-113
Identity = 181/410 (44.15%), Postives = 251/410 (61.22%), Query Frame = 2
Query:   38 KSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHL---RDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNM-IPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKP-----------------QCPFR--NYEVDGPMRVDDNNGEMPNY 1198
            K + + EK+   +N      + + S      GPILLQD   L+ +A FDRER+PERVVHAKG G    FE T  ++  T A+ +  +G +    VRFSTVG ESG+ DT RDPRG + KFYTE G  D V NNTP+FF+RD + FP FIH+QKR+P++HL   +D  ++WD+ +L PE+ HQ  ++  DRG P  +  M+ +  H+F +VN + +  Y +F   ++ G + L+ +KA ELSG+  DY    LF  ++ G  P +  Y+Q M+  +A +  ++  D+TK+WPHK++PL + G I L  N  NYF E+EQ+AF P N  IPGI+ S D +LQ RLFSY DTQRHRLGAN+Q +PVN+P                 QCPF+  N++ DGPM    N G  PNY
Sbjct:    6 KKEEKQEKVYSLQNGFPYSHHPYASQYSRPDGPILLQDFHLLENIASFDRERVPERVVHAKGGGCRLEFELTDSLSDITYAAPYQNVGYKCPGLVRFSTVGGESGTPDTARDPRGVSFKFYTEWGNHDWVFNNTPVFFLRDAIKFPVFIHSQKRDPQSHLNQFQDTTIYWDYLTLNPESIHQITYMFGDRGTPASWASMNAYSGHSFIMVNKEGKDTYVQFHVLSDTGFETLTGDKAAELSGSHPDYNQAKLFTQLQNGEKPKFNCYVQTMTPEQATKFRYSVNDLTKIWPHKEFPLRKFGTITLTENVDNYFQEIEQVAFSPTNTCIPGIKPSNDSVLQARLFSYPDTQRHRLGANYQQLPVNRPRNLGCPYSKGDSQYTAEQCPFKAVNFQRDGPMSY-YNFGPEPNY 414          
BLAST of Catalase vs. Ensembl Nematostella
Match: EDO41684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3R1])

HSP 1 Score: 154.836 bits (390), Expect = 2.279e-45
Identity = 70/98 (71.43%), Postives = 84/98 (85.71%), Query Frame = 2
Query:  518 RDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNY 811
            +D NMFWDF +LRPETTHQ +FL SDRGIPDG+RHM+G+GSHTFK+VN K +AVYCKF  KT+QGIKN  VE+ATEL+GTD DY+ +DL+NAI  GNY
Sbjct:    1 QDANMFWDFITLRPETTHQTSFLFSDRGIPDGFRHMNGYGSHTFKMVNSKGKAVYCKFHVKTDQGIKNCPVERATELAGTDPDYSTRDLYNAIAEGNY 98          
BLAST of Catalase vs. Ensembl Nematostella
Match: EDO41682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Q8])

HSP 1 Score: 92.4337 bits (228), Expect = 9.931e-23
Identity = 42/99 (42.42%), Postives = 66/99 (66.67%), Query Frame = 2
Query: 1190 PNYFPNSYGGPQHN-PKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMER 1483
            PNYFPNS+ GP  +  KY   +  ++GD  R++S+D+DN++QVT F+TKVL+ + +MRL +NIAGH+    + I+ R V+ F+KVH      I   +++
Sbjct:    3 PNYFPNSFSGPMDDVAKYSPSQFTVSGDCARYNSADDDNFTQVTTFWTKVLNDEERMRLVKNIAGHVKDAKDFIQKRCVQQFTKVHPDFGNGIARELQK 101          
BLAST of Catalase vs. Ensembl Medaka
Match: cat (catalase [Source:NCBI gene;Acc:101158017])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 306/482 (63.49%), Postives = 368/482 (76.35%), Query Frame = 2
Query:   14 SDDPLSVYKSDHRDEKI-LLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFR----NYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVH 1444
            + D +  +K +    K  +LT   G PIG+K N  T G RGP+L+QD VF DEMAHFDRERIPERVVHAKGAGAFG+FE THDIT+Y KA +F  IG  T I VRFSTV  ESGSADTVRDPRGFA+KFYT+ G WDL GNNTP+FFIRD + FPSF+HTQKRNP+TH++DP+M WDF SLRPE  HQ +FL SDRG+PDGYRHM+G+GSHTFKLVN   + VYCKF +KT+QGIKNLSVE+A  L+ T+ DYAI DLFNAI  GNYPSWT YIQVM++ +AE+  FNPFD+TKVW HK++PLI VGR+VLNRNP NYF EVEQ+AF P NM PGIE SPDKMLQGRLFSY DT RHRLGAN+  IPVN   CPFR    NY+ DGPM + DN G  PNY+PNS+  P+  P+++E +  ++ D+ R++S+DEDN +QV  F+TKVL+ D + RL +N+AG L      I+ R V N   VH
Sbjct:    8 TTDQMKTWKENRGSRKPDVLTTGAGHPIGDKLNLQTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYCKAKVFEHIGKTTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTDEGNWDLTGNNTPVFFIRDALLFPSFVHTQKRNPQTHMKDPDMVWDFWSLRPECLHQVSFLFSDRGLPDGYRHMNGYGSHTFKLVNADGDRVYCKFHYKTDQGIKNLSVEEAEHLASTNPDYAIGDLFNAIANGNYPSWTFYIQVMTFEQAEKFQFNPFDLTKVWSHKEFPLIPVGRMVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQIPVN---CPFRTRVANYQRDGPMCMFDNQGGAPNYYPNSFSAPETQPQFVESKFQVSPDVARYNSADEDNVTQVCTFFTKVLNEDERQRLCQNMAGSLKEAQLFIQKRMVENLKAVH 486          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055550.1 (SMESG000055550.1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 486/506 (96.05%), Postives = 489/506 (96.64%), Query Frame = 2
Query:    2 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 1519
            MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKAS+FNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDP+FFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFL SDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWP KDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPN               +HITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL
Sbjct:    1 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASIFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLFSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPRKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPN---------------KHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 491          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055550.1 (SMESG000055550.1)

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 470/506 (92.89%), Postives = 472/506 (93.28%), Query Frame = 2
Query:    2 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 1519
            MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKAS+FNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDP+FFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFL SDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWP KDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYG                                VTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL
Sbjct:    1 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASIFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLFSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPRKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYG--------------------------------VTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 474          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055572.1 (SMESG000055572.1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 398/506 (78.66%), Postives = 446/506 (88.14%), Query Frame = 2
Query:    2 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPHKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 1519
            M  P  DPL+VY+ +H+DEK++L R TGAPIGNKF+SLT+G RGP+LLQDSVF+DEMAHFDRERIPERVVHAKG GA G+FECTHDITKY KA++FNKIG +TD+ VRFSTVGQESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDP+FFPSFIHTQKRNP+THLRDPNM WDFQSLRPET HQ  FL SDRGIPDG+RHMHGFGSHTFKLVNDK+EA YCKFIF TNQGIKNL V+KATEL+GT+ DYAIKDL+ AI   NYPSWT+ IQVM+Y +A +CPFNPFD+TKVWPHKDYPLIQVG++VLN+NPRNYFMEVEQ AFCP NM+PGIEASPD+MLQGR+FSY DT RHRLG NF LIPVNKP+CPFRNYEVDGPMRVDDNNG+MPNY+PNSY GPQHNP+YLEHR+ +TGD+ R D+ DEDN+SQ  IFYTKVLD  AK RLAENIA +L H NE+IRARTV NFSKVHE L +DIL  ME  +GV TNL  HL
Sbjct:    1 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 506          
The following BLAST results are available for this feature:
BLAST of Catalase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CAT0.000e+062.24catalase [Source:HGNC Symbol;Acc:HGNC:1516][more]
CAT1.106e-1193.10catalase [Source:HGNC Symbol;Acc:HGNC:1516][more]
back to top
BLAST of Catalase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctl-20.000e+059.20Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Pr... [more]
ctl-20.000e+059.20Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Pr... [more]
ctl-10.000e+057.20Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O6123... [more]
ctl-10.000e+057.20Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O6123... [more]
ctl-30.000e+057.11Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7][more]
back to top
BLAST of Catalase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cat0.000e+062.45gene:FBgn0000261 transcript:FBtr0075058[more]
CG93140.000e+056.43gene:FBgn0032061 transcript:FBtr0339543[more]
CG93140.000e+056.43gene:FBgn0032061 transcript:FBtr0079731[more]
back to top
BLAST of Catalase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cat0.000e+060.61catalase [Source:NCBI gene;Acc:30068][more]
cat0.000e+062.26catalase [Source:NCBI gene;Acc:30068][more]
back to top
BLAST of Catalase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncmap0.000e+063.29non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+063.95non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+061.43non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+064.78non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+064.78non-compact myelin associated protein [Source:Xenb... [more]
back to top
BLAST of Catalase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cat0.000e+063.10catalase [Source:MGI Symbol;Acc:MGI:88271][more]
Cat9.971e-3359.38catalase [Source:MGI Symbol;Acc:MGI:88271][more]
back to top
BLAST of Catalase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00432|CATA_BOVIN0.000e+065.32Catalase OS=Bos taurus OX=9913 GN=CAT PE=1 SV=3[more]
sp|Q2I6W4|CATA_CALJA0.000e+062.24Catalase OS=Callithrix jacchus OX=9483 GN=CAT PE=2... [more]
sp|P04040|CATA_HUMAN0.000e+062.24Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3[more]
sp|Q5RF10|CATA_PONAB0.000e+062.04Catalase OS=Pongo abelii OX=9601 GN=CAT PE=2 SV=3[more]
sp|Q64405|CATA_CAVPO0.000e+064.31Catalase OS=Cavia porcellus OX=10141 GN=CAT PE=2 S... [more]
back to top
BLAST of Catalase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A385G1K50.000e+078.24Catalase OS=Dugesia japonica OX=6161 GN=CAT PE=2 S... [more]
B9ZZQ20.000e+066.87Catalase OS=Brachionus plicatilis OX=10195 GN=Ctl ... [more]
A0A131XP470.000e+064.68Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1[more]
E9NS220.000e+066.88Catalase OS=Pinctada fucata OX=50426 PE=2 SV=1[more]
A0A0K8RIX40.000e+065.38Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1[more]
back to top
BLAST of Catalase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+058.78catalase [Source:NCBI gene;Acc:103032916][more]
back to top
BLAST of Catalase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+063.27catalase [Source:NCBI gene;Acc:30068][more]
back to top
BLAST of Catalase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CTA12.275e-15048.48Catalase A; breaks down hydrogen peroxide in the p... [more]
CTT13.638e-11344.15Cytosolic catalase T; has a role in protection fro... [more]
back to top
BLAST of Catalase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416842.279e-4571.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416829.931e-2342.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Catalase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+063.49catalase [Source:NCBI gene;Acc:101158017][more]
back to top
BLAST of Catalase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055550.10.000e+096.05SMESG000055550.1[more]
SMESG000055550.10.000e+092.89SMESG000055550.1[more]
SMESG000055572.10.000e+078.66SMESG000055572.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010507 ID=SMED30010507|Name=Catalase|organism=Schmidtea mediterranea sexual|type=transcript|length=1683bp
AATGCCACTTCCATCTGATGATCCATTATCGGTTTACAAATCTGATCATC
GAGATGAAAAAATATTATTGACCCGAAACACAGGGGCTCCGATTGGAAAT
AAGTTTAATTCTTTAACCGTCGGTCACAGGGGACCGATATTGCTCCAAGA
TAGTGTTTTCCTAGATGAAATGGCTCATTTTGACCGAGAAAGAATCCCTG
AACGAGTGGTACATGCAAAAGGAGCTGGAGCTTTCGGTTTCTTTGAGTGC
ACTCATGATATAACCAAGTACACAAAAGCTTCTCTGTTCAACAAGATAGG
CTGTCGGACAGATATAGGTGTTCGATTTTCAACAGTCGGACAAGAAAGTG
GTAGTGCTGACACAGTAAGAGATCCTCGTGGATTTGCAATAAAGTTTTAC
ACAGAAACTGGTATTTGGGACCTCGTTGGGAATAATACTCCAATCTTCTT
CATTCGAGATCCAATGTTCTTTCCAAGTTTTATTCATACACAAAAGAGAA
ATCCTAAAACTCATCTGAGAGATCCCAACATGTTTTGGGATTTTCAATCG
CTTCGACCAGAAACAACTCATCAATTTGCATTTTTAGTCTCTGATCGAGG
AATTCCAGATGGGTATCGGCACATGCATGGCTTCGGCTCACATACGTTTA
AATTAGTGAATGACAAAGATGAGGCGGTTTATTGTAAATTCATATTCAAG
ACAAATCAAGGGATAAAGAATTTGAGTGTTGAGAAAGCAACTGAATTGAG
TGGCACTGATCAAGACTATGCTATTAAAGACTTATTCAATGCTATAGAAA
CTGGCAATTATCCCTCTTGGACTCTTTACATTCAGGTCATGAGTTATCGA
GAAGCGGAACAATGTCCTTTCAATCCGTTTGATGTTACTAAAGTATGGCC
TCATAAGGATTATCCTTTGATACAAGTCGGTCGAATCGTTCTCAATCGCA
ATCCTCGCAATTACTTCATGGAAGTTGAACAAATAGCATTTTGTCCCGTA
AATATGATACCGGGAATTGAGGCCAGTCCCGACAAAATGTTACAAGGACG
ACTGTTTTCCTACCGTGACACGCAGCGACATAGATTAGGAGCTAATTTTC
AACTGATTCCAGTGAACAAACCGCAATGTCCATTTAGAAACTATGAGGTT
GATGGGCCGATGCGAGTCGATGATAACAATGGTGAGATGCCTAATTACTT
TCCGAATAGTTACGGAGGTCCACAGCACAATCCTAAATATCTGGAGCATA
GAGAACACATAACTGGGGACATTTACAGACATGATAGTTCTGATGAGGAT
AACTACAGTCAAGTTACAATTTTCTATACCAAGGTACTGGATGCTGACGC
TAAAATGAGACTTGCAGAAAATATAGCTGGTCATTTGTGCCATTGTAATG
AAATTATTAGAGCGAGAACTGTGAGAAATTTCTCCAAAGTTCACGAGAAG
TTGGCGCAAGATATCCTGTACCGGATGGAAAGGGATCACGGAGTGATCAC
TAATTTGAATTGCCATTTGTGAGTTGGGATCGGAAATTTTATTTTTTGTC
GGCTGACATTTTCGACTTTTTCAAAACGTTTATGCAATTTTATTGATTTT
CTATAATAAATGAACTGATTGGTCAATTTGAATTGTTTTGTCATTTTTAT
ATTGGTTATTAATAAATTTGTGGTTGATCTTTT
back to top

protein sequence of SMED30010507-orf-1

>SMED30010507-orf-1 ID=SMED30010507-orf-1|Name=SMED30010507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQD
SVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASLFNKIG
CRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFF
IRDPMFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLVSDRG
IPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELS
GTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWP
HKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGR
LFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYF
PNSYGGPQHNPKYLEHREHITGDIYRHDSSDEDNYSQVTIFYTKVLDADA
KMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVIT
NLNCHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000232copulatory apparatus
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR018028Catalase
IPR011614Catalase_core
IPR024711Catalase_clade1/3
IPR010582Catalase_immune_responsive
IPR002226Catalase_haem_BS
IPR024708Catalase_AS
IPR020835Catalase_sf
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0004096catalase activity
GO:0016209antioxidant activity
GO:0016491oxidoreductase activity
GO:0016684oxidoreductase activity, acting on peroxide as acceptor
GO:0019899enzyme binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0050661NADP binding
GO:0004046aminoacylase activity
GO:0004601peroxidase activity
GO:0005102signaling receptor binding
Vocabulary: biological process
TermDefinition
GO:0006979response to oxidative stress
GO:0055114oxidation-reduction process
GO:0009060aerobic respiration
GO:0009650UV protection
GO:0014068positive regulation of phosphatidylinositol 3-kinase signaling
GO:0020027hemoglobin metabolic process
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0042542response to hydrogen peroxide
GO:0042744hydrogen peroxide catabolic process
GO:0043066negative regulation of apoptotic process
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0051262protein tetramerization
GO:0051289protein homotetramerization
GO:0051781positive regulation of cell division
GO:0098869cellular oxidant detoxification
GO:0000302response to reactive oxygen species
GO:0001649osteoblast differentiation
GO:0006641triglyceride metabolic process
GO:0008203cholesterol metabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
GO:0005739mitochondrion
GO:0005777peroxisome
GO:0005778peroxisomal membrane
GO:0005925focal adhesion