J domain-containing protein

Overview
NameJ domain-containing protein
Smed IDSMED30010506
Length (bp)1752
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of J domain-containing protein (SMED30010506) t-SNE clustered cells

Violin plots show distribution of expression levels for J domain-containing protein (SMED30010506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of J domain-containing protein (SMED30010506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for J domain-containing protein (SMED30010506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30010506SMESG000009124.1 dd_Smed_v4_4016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010506SMESG000009124.1 dd_Smed_v4_4016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30010506SMESG000009124.1 Contig35167newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30010506SMESG000009124.1 Contig35167uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010506SMESG000009124.1 Contig35167newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010506SMESG000009124.1 Contig35167uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30010506SMESG000009124.1 Contig49066newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30010506SMESG000009124.1 Contig49066uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010506SMESG000038402.1 SMESG000009124.1 SMESG000026407.1 OX_Smed_1.0.01868ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJC3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:HGNC Symbol;Acc:HGNC:9439])

HSP 1 Score: 361.303 bits (926), Expect = 3.106e-118
Identity = 213/471 (45.22%), Postives = 306/471 (64.97%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDR-NRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D   +L+  P   E+ EAQ  L+   E+      A   + +  +  AI +L+K++E       LRE+RA  ++K G+ +KAI+D + A KL ND+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI VC      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD     + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJC3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:HGNC Symbol;Acc:HGNC:9439])

HSP 1 Score: 320.472 bits (820), Expect = 3.747e-103
Identity = 203/468 (43.38%), Postives = 288/468 (61.54%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D               K +V + + AE                                 LRE+RA  ++K G+ +KAI+D + A KL ND+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI VC      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDF--------------KKVVCVWD-AE---------------------------------LRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 420          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 109.383 bits (272), Expect = 1.071e-24
Identity = 106/416 (25.48%), Postives = 195/416 (46.88%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYN---DCITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            Y KA++  P N   Y  RA   + +G+ + A+ D   S+ L  +F+    +    +L  G    A       L+   ++ +AQ+   N   + E  ++A+T +E   F   +  +++ +E        + ++A      G   +A +     +++ + + D +      LY     ++++    + L++ PDH+      +  K L         A K+  Y    +  T+A      N+K +   Y        CN    +SK+ +   AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K+ +K AQ  LK SK+++YYKIL V + A++ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  +L+D +K+ +YD+G+D LD E
Sbjct:   51 YTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLY--------CNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQD-LDEE 456          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 105.145 bits (261), Expect = 1.456e-23
Identity = 103/408 (25.25%), Postives = 190/408 (46.57%), Query Frame = 2
Query:  275 PNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYN---DCITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            P N   Y  RA   + +G+ + A+ D   S+ L  +F+    +    +L  G    A       L+   ++ +AQ+   N   + E  ++A+T +E   F   +  +++ +E        + ++A      G   +A +     +++ + + D +      LY     ++++    + L++ PDH+      +  K L         A K+  Y    +  T+A      N+K +   Y        CN    +SK+ +   AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K+ +K AQ  LK SK+++YYKIL V + A++ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  +L+D +K+ +YD+G+D LD E
Sbjct:    3 PKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLY--------CNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQD-LDEE 400          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 105.145 bits (261), Expect = 1.456e-23
Identity = 103/408 (25.25%), Postives = 190/408 (46.57%), Query Frame = 2
Query:  275 PNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYN---DCITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            P N   Y  RA   + +G+ + A+ D   S+ L  +F+    +    +L  G    A       L+   ++ +AQ+   N   + E  ++A+T +E   F   +  +++ +E        + ++A      G   +A +     +++ + + D +      LY     ++++    + L++ PDH+      +  K L         A K+  Y    +  T+A      N+K +   Y        CN    +SK+ +   AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K+ +K AQ  LK SK+++YYKIL V + A++ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  +L+D +K+ +YD+G+D LD E
Sbjct:    3 PKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLY--------CNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQD-LDEE 400          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-7 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:P91189])

HSP 1 Score: 305.064 bits (780), Expect = 3.911e-97
Identity = 184/451 (40.80%), Postives = 267/451 (59.20%), Query Frame = 2
Query:  128 ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF--YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGD--NKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ 1468
            ++L++     +      +V K+L+ G++ LA  Q  DAL QY  A+E DP +Y   YRRAT +LAMG+ K+AI DL   L LKP+F  AR QR N+ LKQG+L  A+ D N++L H   + + Q+    I +  +     K+ Y          Y+N ++E       L  MRA    + G+ +KAI+D R   KLS D  D +   SKLLY  G+ ++SL  IRECLKL+PDHK C+  YK ++K+VK + S++   ++  +  C+ + +   K +P    Q   ++    C  +      AI  C     ++P + D++C+ AEA I DE+YDSAI  YQK  E + +++ AKEG++ A++L   + KR+YYKIL V R A+K+EI KAYRKLA ++HPD N  D   KK AE+KFIDI+ AK+VL D EKR+++D G DPLDPE Q Q
Sbjct:    8 LILWSSLFASTFAGTAEEVAKHLELGSQFLARAQFADALTQYHAAIELDPKSYQAIYRRATTYLAMGRGKAAIVDLERVLELKPDFYGARIQRGNILLKQGELEAAEADFNIVLNHDSSNNDVQEKTALIEQHRQLRHQIKSAYAGGDCATVEEYINHIIEIQVWDASLYRMRAKCLEERGELKKAIHDMRIVSKLSTDSTDTMFETSKLLYTVGDLEESLNVIRECLKLNPDHKSCYPFYKKLRKVVKSLESMKKKVENSDWMACLEEGQKTMKFDPTPSVQLNVFRITNRCQREAGHISEAIAECNEILNDDPSDADILCERAEAHILDEDYDSAIEDYQKATEVNPDHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPD-NFSDEEEKKKAEKKFIDIAAAKEVLQDEEKRRQFDQGVDPLDPEAQRQ 457          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-28 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q9N3E0])

HSP 1 Score: 260.766 bits (665), Expect = 5.586e-80
Identity = 155/408 (37.99%), Postives = 237/408 (58.09%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQH---KPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENL--KKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            Y KA+E +P  Y   +RRAT +LA G++K  + DL   L  KP+F  AR QRA++ LK G+L  A  D   L+ H   +    EAQ+ L  I E    +EM K++  N    + I     ++ET      L   RA  Y+     + AI+D ++A KLS+D+ + +  +S+L Y+  +   SL  IRECLKL+PDHK C+  YK +KK+VK ++S++ + + + +  C+   E L  K  E   +   ++ +C C+ +      AI+ C      +  + + +   AEA++ADE YD AI+ Y+K  E D++N   + G  +A++  +   KR+YYKIL V R A K+EI KAYRK+A ++HPD  +    KK AE+KFIDI+ AK+VL++ EKR+ +DNG+DPLD E
Sbjct:   47 YHKAIELNPTMYQAIFRRATTYLAFGRSKPGLADLDTVLSQKPDFAGARQQRASVLLKMGQLERAAADFRYLIDHSASQETSQEAQEKLELISEHINQVEMLKSWITNGDCNNVIESTTHLLETQPWDASLYIYRAKCYVAEDKVKSAIHDMKHAAKLSSDNTELLFEMSELEYKVADVRDSLGSIRECLKLNPDHKKCYTSYKSLKKIVKSLDSMKASIEQQEWTKCLETGEKLLEKNEEIPIRMNIFRLMCQCNREDGNLGEAIQQCTRVLEFDDSDVETLIQRAEAYMADEEYDMAIADYEKAEEWDSSNDAVRTGKDQAKRAKELVGKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRAFDNGQDPLDSE 454          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-22 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O17002])

HSP 1 Score: 69.707 bits (169), Expect = 6.876e-13
Identity = 38/77 (49.35%), Postives = 53/77 (68.83%), Query Frame = 2
Query: 1235 NYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            N YKIL++ +  T KEI KAYR    ++HPD+N  DNK+ AER+FI+  +A D L D EKR++YDN E+ +   Q+H
Sbjct:    8 NPYKILHLEKGCTDKEIQKAYRAQCLKWHPDKNL-DNKEEAERRFIEAKEAFDFLYDKEKREEYDNREERIRMAQEH 83          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-20 (DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;Acc:Q8MPX3])

HSP 1 Score: 67.3958 bits (163), Expect = 8.032e-12
Identity = 38/73 (52.05%), Postives = 50/73 (68.49%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD-NGEDPL 1447
            R++YKIL V + A   +I KAYRKLA E HPDRN+ D  + A  KF D+S A +VL+D EKR  YD +GE+ +
Sbjct:   23 RDFYKILGVAKNANANQIKKAYRKLAKELHPDRNQDD--EMANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGV 93          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 66.2402 bits (160), Expect = 1.387e-11
Identity = 35/73 (47.95%), Postives = 53/73 (72.60%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPL 1447
            ++YYK+L + + AT  EI KAYRK+A +YHPD+N+   +  AE KF +I++A DVL+D +K++ YD  GE+ L
Sbjct:    3 KDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNK---EAGAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGL 72          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: P58IPK (gene:FBgn0037718 transcript:FBtr0082074)

HSP 1 Score: 327.02 bits (837), Expect = 2.001e-105
Identity = 176/434 (40.55%), Postives = 277/434 (63.82%), Query Frame = 2
Query:  164 TSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQ---YLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            T+ P D++ +L+ G   LA GQL DAL  Y  AVEGD NNYL  ++R TV+LA+GKT+ A++D S  L LKP+F+ AR QR  +++K G+  +A +D + +LQ +P +    +    +    E   + +   + +  ++AI  + +++E +  +   R+ R+++Y+   D   AI D R   +L+ D  +G  ++++LLY  G+A  +L EIRECLK DP+HK CF  YK ++K+ K + + + A ++K + +CI   E + ++EP      Y+    LC C++   +   A++ C+ A  +  ++  V CD A+A +  E YD AI  +Q  L+ + +N RAKEG++RA+KL K S++R+YYKIL V R+A+K+EI+KAYRK A ++HPD  R + KK AE+KFIDI+ AK+VLTD EKR+++DNGEDPLDPE
Sbjct:   37 TASPADIENHLELGKEFLARGQLSDALTHYHAAVEGDANNYLTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYSDHQNAIPMITQLLEISPWAVPFRQARSDAYIAINDPLLAIADLRQVNRLTQDSTEGHYKIAQLLYTIGHATNALKEIRECLKFDPEHKLCFPFYKKLRKVEKQLVNAEQAREEKHFAECIAAGEAVLRNEPEETMIRYEGHKVLCTCYTGDEQFGKALQQCKEA-LDIMKDAQVYCDRADALLGTEMYDDAIHSFQAALDLEESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDNGEDPLDPE 469          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080867)

HSP 1 Score: 104.76 bits (260), Expect = 1.151e-23
Identity = 98/411 (23.84%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLL--LQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRN---RGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQ 1459
            Y  A+   P++   Y  RA  ++ +    SA+ D  +++ + P F  A  + A   L  G +   ++ + ++  L      V A++         EA   A   Y+   + + + YL+  ++        R ++A      G   +A++     +KL     D I      LY T N D+ ++     L LDPDH    +     K+L ++  +     K  RY +      +  K +   +    + L N    ++++   + A+  C        Q    +   A  +   E ++ +++ Y+  L+ +   +  K  ++ A+  LK SK+++YYKIL + R A+  EI KAYRK A  +HPDR+     + +K  E KF ++ +A  +L+DA K+ +YD+G+D  + EQ
Sbjct:   28 YTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQAN--YDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPE-IKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQ 435          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333488)

HSP 1 Score: 104.76 bits (260), Expect = 1.151e-23
Identity = 98/411 (23.84%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLL--LQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRN---RGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQ 1459
            Y  A+   P++   Y  RA  ++ +    SA+ D  +++ + P F  A  + A   L  G +   ++ + ++  L      V A++         EA   A   Y+   + + + YL+  ++        R ++A      G   +A++     +KL     D I      LY T N D+ ++     L LDPDH    +     K+L ++  +     K  RY +      +  K +   +    + L N    ++++   + A+  C        Q    +   A  +   E ++ +++ Y+  L+ +   +  K  ++ A+  LK SK+++YYKIL + R A+  EI KAYRK A  +HPDR+     + +K  E KF ++ +A  +L+DA K+ +YD+G+D  + EQ
Sbjct:   28 YTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQAN--YDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPE-IKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQ 435          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333486)

HSP 1 Score: 104.76 bits (260), Expect = 1.503e-23
Identity = 98/411 (23.84%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLL--LQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRN---RGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQ 1459
            Y  A+   P++   Y  RA  ++ +    SA+ D  +++ + P F  A  + A   L  G +   ++ + ++  L      V A++         EA   A   Y+   + + + YL+  ++        R ++A      G   +A++     +KL     D I      LY T N D+ ++     L LDPDH    +     K+L ++  +     K  RY +      +  K +   +    + L N    ++++   + A+  C        Q    +   A  +   E ++ +++ Y+  L+ +   +  K  ++ A+  LK SK+++YYKIL + R A+  EI KAYRK A  +HPDR+     + +K  E KF ++ +A  +L+DA K+ +YD+G+D  + EQ
Sbjct:   42 YTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQAN--YDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPE-IKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQ 449          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080866)

HSP 1 Score: 104.375 bits (259), Expect = 2.340e-23
Identity = 98/411 (23.84%), Postives = 183/411 (44.53%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLL--LQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRN---RGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQ 1459
            Y  A+   P++   Y  RA  ++ +    SA+ D  +++ + P F  A  + A   L  G +   ++ + ++  L      V A++         EA   A   Y+   + + + YL+  ++        R ++A      G   +A++     +KL     D I      LY T N D+ ++     L LDPDH    +     K+L ++  +     K  RY +      +  K +   +    + L N    ++++   + A+  C        Q    +   A  +   E ++ +++ Y+  L+ +   +  K  ++ A+  LK SK+++YYKIL + R A+  EI KAYRK A  +HPDR+     + +K  E KF ++ +A  +L+DA K+ +YD+G+D  + EQ
Sbjct:   72 YTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQAN--YDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPE-IKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQ 479          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajc3b (DnaJ (Hsp40) homolog, subfamily C, member 3b [Source:ZFIN;Acc:ZDB-GENE-000831-4])

HSP 1 Score: 370.548 bits (950), Expect = 4.440e-122
Identity = 203/445 (45.62%), Postives = 291/445 (65.39%), Query Frame = 2
Query:  140 NLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGD-NKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
            +L ++  + + P +++ +L+ G +LLAAGQL +AL+ Y  AVEGD  NYL YY+RATVFLAMGK+KSA+ DL+ ++ LKP+F+ AR QR N+ LKQG   EA+ED   +L H P+  EA   L+   ++    E A   +       A+  L  V+E +      RE+RA  Y++ G+ +KAI D   A +L  D+R   L+LS+L Y  G    SL ++RECLKLD D K+CF  YK +KKL K ++S ++   ++R+ + I K E++ ++EP   FY + A +  C C  K+  A+ A+++C  AH  EPQN  ++ D AEA+I  + Y+ A+  YQ+  E D  NQ  +EG+ RA KLLK S+KR+YYKIL V R+A K+EI+KAYRKLA ++HPD  + + +KK AE+KFIDI+ AK+VLTD E RQK+D+GEDPLDPE Q
Sbjct:   28 DLQLDGVLGATPVEIEHHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRATVFLAMGKSKSALPDLTQAIQLKPDFLAARLQRGNILLKQGSTQEAREDFQAVLNHSPDHEEAHDQLLKADKLESLQEEAHEAHRRGDCRIAVQVLEHVIELSPWDPESRELRAECYIQLGEPRKAIMDLTPASRLRADNRAAFLKLSQLHYSLGEHHDSLNQVRECLKLDQDDKECFALYKQVKKLSKQLDSAEELISEQRFQEAIEKYESVMRTEPNVAFYTNKAKERTCFCLVKMKSAEEAVDICSEAHQREPQNIHILRDRAEAYILMQEYEKAVEDYQEAREFDQENQELREGLDRAHKLLKISRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIASAKEVLTDPEMRQKFDSGEDPLDPENQ 472          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajc3a (DnaJ (Hsp40) homolog, subfamily C, member 3a [Source:ZFIN;Acc:ZDB-GENE-030131-1264])

HSP 1 Score: 359.762 bits (922), Expect = 6.529e-118
Identity = 211/465 (45.38%), Postives = 300/465 (64.52%), Query Frame = 2
Query:   98 IINKRLTLISILL--FNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            + +K L+ +  LL   +L  E       G V+ +L+ G +LLAAGQL DAL+ +  AV+G+P NY+ +YRRATV+LAMGK+KSA+ DLS  + LKP+F  AR QR NL LK GKL EA+ D   +L+  P   E+ EAQ  L    EI   +  A++ +++  +  A  +L+ +++T       REMRA  +++ G+  KAI+D + A KL +D+     +LS + Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL K I S ++  + ++Y+D ++K E++ K+EP    F   A + +C+C SK  +   AI VC      +PQN + + D AEA + D+ Y+ AI  +Q   E   N+++ KEG++RAQ+LLK SKKR+YYKIL V RTA KKEILKAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD E R K+D GEDP+DPE Q 
Sbjct:    7 VAHKLLSYVPFLLVLIDLRYEGVNGGKDGGVENHLEMGKKLLAAGQLADALSHFHAAVDGEPKNYMAFYRRATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKHGKLDEAESDFKKVLKSNPSSREEQEAQSQLKKSDEIQRLVSQAQSDFKHREYSSAASHLDIIIDTCVWDVDSREMRAECFIQMGELGKAISDLKAASKLKSDNTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDQDHKQCFSHYKQVKKLNKQIQSAEELIQQEKYSDAVSKYESVMKTEPNVPHFTLNAKERMCHCLSKDQQTARAISVCSEVLNTDPQNVNALKDRAEALLQDDQYEEAIKDFQSAKEYSENDRQIKEGLERAQRLLKQSKKRDYYKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGEDPMDPESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajc3a (DnaJ (Hsp40) homolog, subfamily C, member 3a [Source:ZFIN;Acc:ZDB-GENE-030131-1264])

HSP 1 Score: 359.762 bits (922), Expect = 6.529e-118
Identity = 211/465 (45.38%), Postives = 300/465 (64.52%), Query Frame = 2
Query:   98 IINKRLTLISILL--FNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            + +K L+ +  LL   +L  E       G V+ +L+ G +LLAAGQL DAL+ +  AV+G+P NY+ +YRRATV+LAMGK+KSA+ DLS  + LKP+F  AR QR NL LK GKL EA+ D   +L+  P   E+ EAQ  L    EI   +  A++ +++  +  A  +L+ +++T       REMRA  +++ G+  KAI+D + A KL +D+     +LS + Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL K I S ++  + ++Y+D ++K E++ K+EP    F   A + +C+C SK  +   AI VC      +PQN + + D AEA + D+ Y+ AI  +Q   E   N+++ KEG++RAQ+LLK SKKR+YYKIL V RTA KKEILKAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD E R K+D GEDP+DPE Q 
Sbjct:    7 VAHKLLSYVPFLLVLIDLRYEGVNGGKDGGVENHLEMGKKLLAAGQLADALSHFHAAVDGEPKNYMAFYRRATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKHGKLDEAESDFKKVLKSNPSSREEQEAQSQLKKSDEIQRLVSQAQSDFKHREYSSAASHLDIIIDTCVWDVDSREMRAECFIQMGELGKAISDLKAASKLKSDNTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDQDHKQCFSHYKQVKKLNKQIQSAEELIQQEKYSDAVSKYESVMKTEPNVPHFTLNAKERMCHCLSKDQQTARAISVCSEVLNTDPQNVNALKDRAEALLQDDQYEEAIKDFQSAKEYSENDRQIKEGLERAQRLLKQSKKRDYYKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGEDPMDPESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 116.316 bits (290), Expect = 3.894e-27
Identity = 106/411 (25.79%), Postives = 197/411 (47.93%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDC---ITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            Y KA++  P N   Y  RA   + + + + A+ED   ++ L  +F+    +    +L  G    A   +  +L+ +P++ +AQ+ + N   I E   MA+  +E   F   +  +++V+++ +     + ++A      G   +A +     +++ + + D +      LY     D+++    + L++ PDH+      +  K L         A K+  Y +     T+A      N+K +   Y        CN     SK+++ + AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K  +K AQ  LK SK+++YYK+L V + AT+ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  VL+D +K+ +YD+G D
Sbjct:   80 YTKAIDLCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREPDNSQAQQEMKNAESILEYERMAEISFEKRDFRMVVFCMDRVLDSASACHRFKVLKAECLALLGRYPEAQSVASDILRMDSTNGDALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLY--------CNRATVGSKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KNLLKNAQLELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHD 481          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 115.546 bits (288), Expect = 4.557e-27
Identity = 106/411 (25.79%), Postives = 197/411 (47.93%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDC---ITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            Y KA++  P N   Y  RA   + + + + A+ED   ++ L  +F+    +    +L  G    A   +  +L+ +P++ +AQ+ + N   I E   MA+  +E   F   +  +++V+++ +     + ++A      G   +A +     +++ + + D +      LY     D+++    + L++ PDH+      +  K L         A K+  Y +     T+A      N+K +   Y        CN     SK+++ + AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K  +K AQ  LK SK+++YYK+L V + AT+ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  VL+D +K+ +YD+G D
Sbjct:   36 YTKAIDLCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREPDNSQAQQEMKNAESILEYERMAEISFEKRDFRMVVFCMDRVLDSASACHRFKVLKAECLALLGRYPEAQSVASDILRMDSTNGDALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLY--------CNRATVGSKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KNLLKNAQLELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHD 437          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019480.1 (dnaJ homolog subfamily C member 3 like [Source:NCBI gene;Acc:734020])

HSP 1 Score: 372.859 bits (956), Expect = 5.701e-123
Identity = 210/448 (46.88%), Postives = 294/448 (65.62%), Query Frame = 2
Query:  131 LLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
            ++ +L ++  + ++  +++ +L+ G +LLAAGQL +AL+ Y  AV+GDPNNYL YY+RA V+LAMGK +SA+ DLS ++ LKP+F+ AR QR N+ LKQG + EA+ED   +LQ  P + EAQ  L  + E+  ++  A   YE   +  AI  L KV+E +      RE+RA  YL  G+   A+ D +   KL ND+R   L+LSKL Y  G   +SL  +RECLKLD D KDCF HYK +KKL + ++  ++  +++RY D I K E   K+EP  + +   A + +C+C SK    + AI VC  AH  +PQN  ++ D AEA+I +E Y+ A+  +Q+  E D  N+  KEG++RAQKLLK SKKR+YYKIL V R A K+E++KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD E RQK D GEDPLDPE Q
Sbjct:   20 VILDLQLDGLLAANHAEIEGHLEMGRKLLAAGQLAEALSHYHAAVDGDPNNYLTYYKRAAVYLAMGKFRSALPDLSRAIQLKPDFLAARLQRGNILLKQGDVQEAREDFLSVLQSSPTNEEAQNQLERVKEVESSMGGASEAYERRDYYGAIALLEKVIEFSPWDPSARELRAECYLLVGELSNAVQDLKPTTKLRNDNRAAFLKLSKLYYSMGEHGESLSHVRECLKLDQDDKDCFSHYKQVKKLSRQLDMAEEFIQEQRYEDAIEKYEASIKTEPRVEEYSRRAKERICHCLSKSQRTEEAISVCTEAHERDPQNPLILRDRAEAYILNEEYEKAVEDFQQAKELDGENEEMKEGLERAQKLLKQSKKRDYYKILGVKRNANKQEVIKAYRKLAQQWHPDNFQSEEEKKEAEKKFIDIAAAKEVLTDPEMRQKVDAGEDPLDPENQ 467          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: gask1b (golgi associated kinase 1B [Source:Xenbase;Acc:XB-GENE-960860])

HSP 1 Score: 372.474 bits (955), Expect = 1.174e-122
Identity = 219/471 (46.50%), Postives = 304/471 (64.54%), Query Frame = 2
Query:   83 FVSMSI-INKRLTLISILL--FNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             VS+S    K L+    LL  F+L  E        DVDK+L+ G +LLAAGQL DAL+ +  A++GDP+NY+ YYRRATV+LAMGK+K+AI DLS  + LKP+F  AR QR +L LKQGKL EA+ED   +L+  P   E+ EA   L+   EI          Y+   +  A  YLN V+ET      +RE+RA  Y+  G+  KAI+D + A KL +D+ +   ++SK+ Y+ G+ + SL EIRECLKLDPDHK+CF HYK +KKL K I + ++   + RY D + K E + K+E   P+Y +   +  C+C+SK  ++  AI VC      EP N + + D AEA+I +E Y+ AI  Y+   +++ N+++ +EG+ +AQKLLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD EKR ++D GEDPLDPE Q 
Sbjct:    1 MVSLSASAQKLLSFFPFLLVLFDLQYEGVECGINADVDKHLEMGKKLLAAGQLADALSHFHSAIDGDPDNYVAYYRRATVYLAMGKSKAAIPDLSKVIELKPDFTSARVQRGHLLLKQGKLDEAEEDFKKVLKSNPNEQEEKEANAQLLKSSEIQSMRSQGIAAYKEGDYSTAETYLNFVLETCIWDAEIRELRAECYISQGEPGKAISDLKAASKLKSDNTNAFYKVSKIYYQLGDHEMSLSEIRECLKLDPDHKECFSHYKQVKKLNKQIQAAEELIHEGRYEDALPKYEGILKTEPNVPYYSALVQERSCHCYSKSQQSTEAIRVCTEFLQQEPNNVNALKDRAEAYILEEMYEEAIRDYETAQQNNENDKQIREGLDKAQKLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLAQQWHPDNFQDEEEKKKAEKKFIDIASAKEVLTDPEKRSRFDAGEDPLDPESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: gask1b (golgi associated kinase 1B [Source:Xenbase;Acc:XB-GENE-960860])

HSP 1 Score: 368.237 bits (944), Expect = 4.195e-121
Identity = 209/437 (47.83%), Postives = 291/437 (66.59%), Query Frame = 2
Query:  176 GDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             DVDK+L+ G +LLAAGQL DAL+ +  A++GDP+NY+ YYRRATV+LAMGK+K+AI DLS  + LKP+F  AR QR +L LKQGKL EA+ED   +L+  P   E+ EA   L+   EI          Y+   +  A  YLN V+ET      +RE+RA  Y+  G+  KAI+D + A KL +D+ +   ++SK+ Y+ G+ + SL EIRECLKLDPDHK+CF HYK +KKL K I + ++   + RY D + K E + K+E   P+Y +   +  C+C+SK  ++  AI VC      EP N + + D AEA+I +E Y+ AI  Y+   +++ N+++ +EG+ +AQKLLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD EKR ++D GEDPLDPE Q 
Sbjct:   29 ADVDKHLEMGKKLLAAGQLADALSHFHSAIDGDPDNYVAYYRRATVYLAMGKSKAAIPDLSKVIELKPDFTSARVQRGHLLLKQGKLDEAEEDFKKVLKSNPNEQEEKEANAQLLKSSEIQSMRSQGIAAYKEGDYSTAETYLNFVLETCIWDAEIRELRAECYISQGEPGKAISDLKAASKLKSDNTNAFYKVSKIYYQLGDHEMSLSEIRECLKLDPDHKECFSHYKQVKKLNKQIQAAEELIHEGRYEDALPKYEGILKTEPNVPYYSALVQERSCHCYSKSQQSTEAIRVCTEFLQQEPNNVNALKDRAEAYILEEMYEEAIRDYETAQQNNENDKQIREGLDKAQKLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLAQQWHPDNFQDEEEKKKAEKKFIDIASAKEVLTDPEKRSRFDAGEDPLDPESQQ 465          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019462.1 (dnaJ homolog subfamily C member 3 like [Source:NCBI gene;Acc:734020])

HSP 1 Score: 353.599 bits (906), Expect = 1.442e-115
Identity = 205/449 (45.66%), Postives = 287/449 (63.92%), Query Frame = 2
Query:  131 LLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            ++ +L ++  + ++  +++ +L+ G +LLAAGQL +AL+ Y  AV+GDPNNYL YY+RA V+LAMGK +SA+ DLS ++ LKP+F+ AR QR N+ LKQG + EA+ED   +LQ  P + EAQ  L  + E+  ++  A   YE   +  AI  L KV+E +      RE+RA  YL  G+   A+ D +   KL ND+R   L+LSKL Y              CLKLD D KDCF HYK +KKL + ++  ++  +++RY D I K E   K+EP  + +   A + +C+C SK    + AI VC  AH  +PQN  ++ D AEA+I +E Y+ A+  +Q+  E D  N+  KEG++RAQKLLK SKKR+YYKIL V R A K+E++KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD E RQK D GEDPLDPE Q 
Sbjct:   20 VILDLQLDGLLAANHAEIEGHLEMGRKLLAAGQLAEALSHYHAAVDGDPNNYLTYYKRAAVYLAMGKFRSALPDLSRAIQLKPDFLAARLQRGNILLKQGDVQEAREDFLSVLQSSPTNEEAQNQLERVKEVESSMGGASEAYERRDYYGAIALLEKVIEFSPWDPSARELRAECYLLVGELSNAVQDLKPTTKLRNDNRAAFLKLSKLYYMRPEGG--------CLKLDQDDKDCFSHYKQVKKLSRQLDMAEEFIQEQRYEDAIEKYEASIKTEPRVEEYSRRAKERICHCLSKSQRTEEAISVCTEAHERDPQNPLILRDRAEAYILNEEYEKAVEDFQQAKELDGENEEMKEGLERAQKLLKQSKKRDYYKILGVKRNANKQEVIKAYRKLAQQWHPDNFQSEEEKKEAEKKFIDIAAAKEVLTDPEMRQKVDAGEDPLDPENQQ 460          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019451.1 (dnaJ homolog subfamily C member 3 like [Source:NCBI gene;Acc:734020])

HSP 1 Score: 352.058 bits (902), Expect = 5.521e-115
Identity = 204/438 (46.58%), Postives = 281/438 (64.16%), Query Frame = 2
Query:  161 VTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
            + ++  +++ +L+ G +LLAAGQL +AL+ Y  AV+GDPNNYL YY+RA V+LAMGK +SA+ DLS ++ LKP+F+ AR QR N+ LKQG + EA+ED   +LQ  P + EAQ  L  + E+  ++  A   YE   +  AI  L KV+E +      RE+RA  YL  G+   A+ D +   KL ND+R   L+LSKL Y              CLKLD D KDCF HYK +KKL + ++  ++  +++RY D I K E   K+EP  + +   A + +C+C SK    + AI VC  AH  +PQN  ++ D AEA+I +E Y+ A+  +Q+  E D  N+  KEG++RAQKLLK SKKR+YYKIL V R A K+E++KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VLTD E RQK D GEDPLDPE Q
Sbjct:   25 LAANHAEIEGHLEMGRKLLAAGQLAEALSHYHAAVDGDPNNYLTYYKRAAVYLAMGKFRSALPDLSRAIQLKPDFLAARLQRGNILLKQGDVQEAREDFLSVLQSSPTNEEAQNQLERVKEVESSMGGASEAYERRDYYGAIALLEKVIEFSPWDPSARELRAECYLLVGELSNAVQDLKPTTKLRNDNRAAFLKLSKLYYMRPEGG--------CLKLDQDDKDCFSHYKQVKKLSRQLDMAEEFIQEQRYEDAIEKYEASIKTEPRVEEYSRRAKERICHCLSKSQRTEEAISVCTEAHERDPQNPLILRDRAEAYILNEEYEKAVEDFQQAKELDGENEEMKEGLERAQKLLKQSKKRDYYKILGVKRNANKQEVIKAYRKLAQQWHPDNFQSEEEKKEAEKKFIDIAAAKEVLTDPEMRQKVDAGEDPLDPENQ 454          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajc3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:MGI Symbol;Acc:MGI:107373])

HSP 1 Score: 358.607 bits (919), Expect = 2.649e-117
Identity = 211/471 (44.80%), Postives = 306/471 (64.97%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDR-NRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D   +L+  P   E+ EA+  LV   E+      A   ++   +  AI +L+K++E       LRE+RA  ++K G+ +KAI+D + A KL +D+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI +C      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD     + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVGSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:MGI Symbol;Acc:MGI:1928373])

HSP 1 Score: 108.612 bits (270), Expect = 1.109e-24
Identity = 105/416 (25.24%), Postives = 195/416 (46.88%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYN---DCITKA-----ENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            Y KA++  PNN   Y  RA   + +G+ + A+ D   S+ L  +F+    +    +L  G    A       L+   ++ +AQ+   N   + E  ++A+  +E   F   +  +++ +E        + ++A      G   +A       +++ + + D +      LY     ++++    + L++ PDH+      +  K L         A K+  Y    +  T+A      N+K +   Y        CN    +SK+ + + AIE C  A   +          A+ ++  E ++ A+  Y+KV +++   +  K+ +K AQ  LK SK+++YYKIL V + A++ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  +L+D +K+ +YD+G+D LD E
Sbjct:   51 YTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLY--------CNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKEH-KQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQD-LDEE 456          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb8 (DnaJ heat shock protein family (Hsp40) member B8 [Source:MGI Symbol;Acc:MGI:1922801])

HSP 1 Score: 72.0182 bits (175), Expect = 1.056e-13
Identity = 34/65 (52.31%), Postives = 50/65 (76.92%), Query Frame = 2
Query: 1235 NYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            NYY++L V  +A+ ++I KAYRKLA  +HPD+N  DNK+ AE+KF  +S+A +VL+D++KR  YD
Sbjct:    3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNP-DNKEEAEKKFKQVSEAYEVLSDSKKRSVYD 66          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb11 (DnaJ heat shock protein family (Hsp40) member B11 [Source:MGI Symbol;Acc:MGI:1915088])

HSP 1 Score: 71.633 bits (174), Expect = 5.346e-13
Identity = 39/73 (53.42%), Postives = 54/73 (73.97%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPL 1447
            R++YKIL V R+A+ K+I KAYRKLA + HPDRN  D +  A+ KF D+  A +VL+D+EKR++YD  GE+ L
Sbjct:   24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQ--AQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGL 94          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb11 (DnaJ heat shock protein family (Hsp40) member B11 [Source:MGI Symbol;Acc:MGI:1915088])

HSP 1 Score: 71.633 bits (174), Expect = 5.346e-13
Identity = 39/73 (53.42%), Postives = 54/73 (73.97%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPL 1447
            R++YKIL V R+A+ K+I KAYRKLA + HPDRN  D +  A+ KF D+  A +VL+D+EKR++YD  GE+ L
Sbjct:   24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQ--AQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGL 94          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27968|DNJC3_BOVIN (DnaJ homolog subfamily C member 3 OS=Bos taurus OX=9913 GN=DNAJC3 PE=1 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 5.236e-119
Identity = 215/471 (45.65%), Postives = 309/471 (65.61%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAY---QYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D   +L+  P   E+ EAQ  LV   E+      A   +E++ F  AI +L+K++E       LRE+RA  ++K G+ +KAI+D + + KL ND+ +   ++S L YE G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  K+ RY D I+K E++ K+EP    +     + +C+C SK  +   AI VC      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S++R+YYKIL V R A K+EI+KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIELKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLVKSDEMQRLRSQALDAFESSDFTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKASSKLKNDNTEAFYKISTLYYELGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIKEGRYTDAISKYESVMKTEPGVHEYTIRSKERICHCFSKDEKPVEAIRVCSEVLQVEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQRRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 471          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13217|DNJC3_HUMAN (DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 1.492e-117
Identity = 213/471 (45.22%), Postives = 306/471 (64.97%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDR-NRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D   +L+  P   E+ EAQ  L+   E+      A   + +  +  AI +L+K++E       LRE+RA  ++K G+ +KAI+D + A KL ND+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI VC      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD     + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 471          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R0T3|DNJC3_RAT (DnaJ homolog subfamily C member 3 OS=Rattus norvegicus OX=10116 GN=Dnajc3 PE=1 SV=3)

HSP 1 Score: 358.607 bits (919), Expect = 1.700e-116
Identity = 211/471 (44.80%), Postives = 310/471 (65.82%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQG+L+EA++D   +L+  P   E+ EAQ  LV   E+      A   +++  +  AI +L++++E       LRE+RA  ++K G+ +KAI+D + A KL ND+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI++C      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD  +  + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVRSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTRVIELKMDFTAARLQRGHLLLKQGRLAEAEDDFKKVLKSNPSENEEKEAQSQLVKADEMQRLRAQALDAFDSADYTAAITFLDEILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISILYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIGSAEELIRDGRYTDATSKYESVMKAEPSVAEYTVRSKERICHCFSKDEKPVEAIKICSEVLQLEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEQNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQSEEEKKKAEKKFIDIAAAKEVLSDPEMRRKFDDGEDPLDAETQQ 471          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91YW3|DNJC3_MOUSE (DnaJ homolog subfamily C member 3 OS=Mus musculus OX=10090 GN=Dnajc3 PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.853e-116
Identity = 211/471 (44.80%), Postives = 306/471 (64.97%), Query Frame = 2
Query:   83 FVSMSIINKRLTLIS---ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPF---YQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDR-NRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             V+   +  RL  +    ++L +L  E +      DV+K+L+ G +LLAAGQL DAL+Q+  AV+GDP+NY+ YYRRATVFLAMGK+K+A+ DL+  + LK +F  AR QR +L LKQGKL EA++D   +L+  P   E+ EA+  LV   E+      A   ++   +  AI +L+K++E       LRE+RA  ++K G+ +KAI+D + A KL +D+ +   ++S L Y+ G+ + SL E+RECLKLD DHK CF HYK +KKL KLI S ++  +D RY D  +K E++ K+EP    Y   + + +C+C SK  +   AI +C      EP N + + D AEA++ +E YD AI  Y+   E + N+Q+ +EG+++AQ+LLK S+KR+YYKIL V R A K+EI+KAYRKLA ++HPD     + KK AE+KFIDI+ AK+VL+D E R+K+D+GEDPLD E Q 
Sbjct:    1 MVAPGSVGSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQ 471          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZI13|DNJC3_CHICK (DnaJ homolog subfamily C member 3 OS=Gallus gallus OX=9031 GN=DNAJC3 PE=2 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 5.888e-108
Identity = 199/437 (45.54%), Postives = 288/437 (65.90%), Query Frame = 2
Query:  176 GDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
             +V+K L+ G +LLAAGQL DAL+ +  A+EGD +NY+ YYRRATV+LAMGK+K+AI DLS  + LK +F  +R QR +L LKQGK  EA++D   +L+  P   E+ EAQ  L    E+      A + Y    +E AI  L++++        LRE+RA  Y+K G+  KAI+D + A KL +D+ +   ++S++ Y+ G+ + SL E+RECLKLD DHK CF  YK +KKL K I S ++  ++ RY D I+K +++ K+E   P Y + A + +C+C SK  +A  AI VC      EP N + + D AEA++ ++ Y+ AI  Y+    +  N+Q+ +EG++RAQ++LK S+KR+YYKIL V R A K+EI+KAYRKLA+++HPD  +  + KK AE+KFIDI+ AK+VLTD E R+K+D GEDPLD E Q 
Sbjct:   35 AEVEKQLEMGKKLLAAGQLADALSHFHAAIEGDSDNYIAYYRRATVYLAMGKSKAAIRDLSKVVELKQDFT-SRLQRGHLLLKQGKFDEAEDDFKNVLKSNPSNNEEKEAQTQLTKSDELQRLYSQALSAYRQEDYEAAIPLLDEILAVCVWDAELRELRAECYIKEGEPSKAISDLKAAAKLKSDNTEAFYKISRIYYQLGDHELSLSEVRECLKLDQDHKQCFSLYKQVKKLNKQIESAEEFIREGRYEDAISKYDSVMKTEPDVPVYATRAKERICHCLSKNQQATEAITVCTQVLQLEPTNVNALKDRAEAYLLEDLYEEAIKDYETAQANSENDQQIREGLERAQRMLKQSQKRDYYKILGVKRNARKQEIIKAYRKLASQWHPDNFQSEEEKKKAEKKFIDIAAAKEVLTDPEMRRKFDAGEDPLDAESQQ 470          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A1I8GA67 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 1.780e-132
Identity = 224/469 (47.76%), Postives = 319/469 (68.02%), Query Frame = 2
Query:   83 FVSMSIINKRLTLISILLFNLYIEESV-TSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAY------QYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ 1468
            F+S +    R   I I LF+++I +SV  S   ++DK+L+ G +LLAAGQL DAL+ Y  A+E DP NY  Y+RRATV++A+GK+K A+ DL   + LKP+F  A  QR  +YLK G+LS+AK D+  +L+  P + EA K +  +  +AE  E A+   EN ++ DAI +L + +E + +   LR +RA++Y   G+  KA +D R   +L+ D+  G LR+S L Y  G+ +QSL E+RECLKLDPDHKDCFKHYK +KK+ K  +++  ++++K+++ C+   E L K+    Q  A        Y C C +K  ++  A++VC      EP N D +C+ AEA+   + ++ AI+ YQKVLE+D NNQRAKEG+  AQK LK+S++RNYY+IL V R+A K+EILKAYRKLAA+YHPD  +G++K +A+RKFIDISDAK+VLTD EKR K+DNG+DPLDPEQQH+
Sbjct:    3 FLSRTTRIYREIYIIIALFDIWISDSVLASSQAEIDKHLELGKKLLAAGQLADALSHYHAAIELDPTNYQSYFRRATVYMAIGKSKPALPDLDKVIELKPDFATAYLQRGGIYLKTGQLSDAKADLRRVLELDPSNAEAAKQIEQLTPLAEFAENARNLAENGQYTDAIDFLTRALEISPMDADLRALRADAYEAIGEGFKAASDLRAINRLTTDNTAGHLRVSHLFYRLGDPEQSLNEVRECLKLDPDHKDCFKHYKQVKKVAKAFDAVVKSSEEKQWDVCLQSLEKLTKT--IKQKSAGLTRQMDSYQCMCGAKNGDS-AAVDVCSRVLEAEPGNADALCNRAEAYKHQDMFNEAIADYQKVLETDKNNQRAKEGIADAQKKLKSSRRRNYYQILGVPRSARKREILKAYRKLAAQYHPDHYKGNDKASAQRKFIDISDAKEVLTDEEKRAKFDNGQDPLDPEQQHE 468          
BLAST of J domain-containing protein vs. TrEMBL
Match: K1PZ23 (DnaJ-like protein subfamily C member 3 OS=Crassostrea gigas OX=29159 GN=CGI_10007563 PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 6.125e-132
Identity = 205/409 (50.12%), Postives = 279/409 (68.22%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ 1468
            Y  AV+GDPNNYL Y+RRATVFLAMGK+KSA+ DL+  + LKP+F  AR QRAN+ LKQGKL +A++D   +++  P D EA   L  I E+   I  A  Y+E+ +   A+  L +V+E       L E RA  Y++ G+  KAI+D R    L +D+R    ++S L Y+ G A++SL++IRECLKLDPD K C  HYK +KKLVK IN+ Q+A  + +Y++C+ KA+   K+EP   FYQ     YLC+C++K    + A+ +C       P+N + + D AEA++A E ++ AI+ +QK L  +  N+RA+EG+ +AQKLLK S+K++YYKIL V RTA KKEILKAYRKLAA +HPD+  GD+K  AE+ FIDI+ AK+VLTD EKRQK+DNGEDPLDPEQQ  
Sbjct:   18 YHSAVDGDPNNYLTYFRRATVFLAMGKSKSALPDLTKVIELKPDFTAARIQRANVLLKQGKLDDAEKDFKSVIERGPND-EALSQLNAIAELRRDISEAYMYFEHGQLPTAVDILGRVIEKCPWDPSLHETRAECYIQMGEYYKAISDIRPTTSLRSDNRPAFYKMSDLYYKLGEAEESLIQIRECLKLDPDDKQCQPHYKKVKKLVKQINAAQEAKVNGQYDECLNKAKQFMKTEPNEEFYQLKGQGYLCHCNAKGGHIQEALRICNRLLNKNPENVEALMDRAEAYLASEKWEEAINDFQKALNMEEGNRRAQEGLNKAQKLLKQSQKKDYYKILGVKRTARKKEILKAYRKLAAIWHPDKYDGDDKAKAEKMFIDIAAAKEVLTDPEKRQKFDNGEDPLDPEQQQH 425          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A267E2W3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000801g2 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 1.216e-129
Identity = 220/465 (47.31%), Postives = 315/465 (67.74%), Query Frame = 2
Query:   83 FVSMSIINKRLTLISILLFNLYIEESV-TSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAY------QYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            F+S +    R   I I LF+++I +SV  S   ++DK+L+ G +LLAAGQL DAL+ Y  A+E DP NY  Y+RRATV++A+GK+K A+ DL   + LKP+F  A  QR  +YLK G+LS+AK D+  +L+  P + EA K +  +  +AE  E A+   EN ++ DAI +L + +E + +   LR +RA++Y   G+  KA +D R   +L+ D+  G LR+S L Y  G+ +QSL E+RECLKLDPDHKDCFKHYK +KK+ K  +++  ++++K+++ C+   E L K+    Q  A        Y C C +K  ++  A++VC      EP N D +C+ AEA+   + ++ AI+ YQKVLE+D NNQRAKEG+  AQK LK+S++RNYY+IL V R+A K+EILKAYRKLAA+YHPD  +G++K +A+RKFIDISDAK+VLTD EKR++YD+G DPLDPE
Sbjct:    3 FLSRTTRIYREIYIIIALFDIWISDSVLASSQAEIDKHLELGKKLLAAGQLADALSHYHAAIELDPTNYQSYFRRATVYMAIGKSKPALPDLDKVIELKPDFATAYLQRGGIYLKTGQLSDAKADLRRVLELDPSNAEAAKQIEQLTPLAEFAENARNLAENGQYTDAIDFLTRALEISPMDADLRALRADAYEAIGEGFKAASDLRAINRLTTDNTAGHLRVSHLFYRLGDPEQSLNEVRECLKLDPDHKDCFKHYKQVKKVAKAFDAVVKSSEEKQWDVCLQSLEKLTKT--IKQKSAGLTRQMDSYQCMCGAKNGDS-AAVDVCSRVLEAEPGNADALCNRAEAYKHQDMFNEAIADYQKVLETDKNNQRAKEGIADAQKKLKSSRRRNYYQILGVPRSARKREILKAYRKLAAQYHPDHYKGNDKASAQRKFIDISDAKEVLTDEEKRKQYDSGHDPLDPE 464          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A1W7RHU9 (DnaJ subfamily C member 3-like protein OS=Agkistrodon contortrix contortrix OX=8713 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.272e-129
Identity = 221/460 (48.04%), Postives = 302/460 (65.65%), Query Frame = 2
Query:  107 KRLTLISILL---FNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            KRL   + LL   F+L +   + +   ++D +L+ G +LLAAGQL +AL+ Y  AVE DP NYL YY+RAT++LAMGK KSA+ DLS ++ LKP+F+ AR QR N+ LKQG   EAK+D   +L+  PED EAQ  L  + E   +++ A+T ++   +  A+ +L++V+E +      +E+R+  YL  GD  KAI D +   KL ND+R   L+LSKL Y  G  ++SL ++RECLKLD D KDCF HYK +KKL K + S ++  K +RY D I K +   K+EP    Y   A   +C+C SK      AI++C  AH  +P+N  V+ D AEAFI +E ++ AI  YQ+  E D  N+  KEG++RAQKLLK SKKRNYYKIL + R A K+EI+KAYRKLA ++HPD  +  D KK AE++FIDI+ AK+VLTD E RQK+D+GEDPLDPE Q 
Sbjct:   31 KRLLWAASLLCVLFDLQLPGLLAAGQAEIDNHLEMGRKLLAAGQLAEALSHYHSAVEIDPKNYLTYYKRATIYLAMGKFKSALPDLSKAIELKPDFLAARLQRGNILLKQGHTQEAKQDFEAVLKSNPEDAEAQSQLSRVVEQEFSMQEAQTAFQKKNYLGAVSFLDRVIEISPWDPEPKELRSECYLHLGDYNKAIMDLKPTTKLRNDNRAAFLKLSKLYYNLGEHEESLTQVRECLKLDQDDKDCFSHYKQVKKLTKQLESAEEHIKAQRYADAIEKYKAAMKTEPNVEIYTIKAKGRICHCLSKSKRVAEAIDLCSEAHQLDPRNTFVLRDRAEAFILNEEFEKAIEDYQEAKEFDAENEELKEGLERAQKLLKQSKKRNYYKILGIQRNANKQEIIKAYRKLAQQWHPDNFQSEDEKKEAEKRFIDIAAAKEVLTDPEMRQKFDSGEDPLDPENQQ 490          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A0F7Z8P5 (DnaJ subfamily C member 3-like protein OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.004e-127
Identity = 214/433 (49.42%), Postives = 291/433 (67.21%), Query Frame = 2
Query:  176 GDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
             ++D +L+ G +LLAAGQL +AL+ Y  AVE DP NYL YY+RAT++LAMGK KSA+ DLS ++ LKP+F+ AR QR N+ LKQG   EAK+D   +L+  PED EAQ  L  + E   +++ A+T ++   +  A+ +L++V+E +      +E+R+  YL  GD  KAI D +   KL ND+R   L+LSKL Y  G  ++SL ++RECLKLD D KDCF HYK +KKL K + S ++  K +RY D I K +   K+EP    Y   A  ++C+C SK      AI++C  AH  +P+N  V+ D AEAFI +E ++ AI  YQ+  E D  N+  KEG++RAQKLLK SKKRNYYKIL + R A K+EI+KAYRKLA ++HPD  +  D KK AE++FIDI+ AK+VLTD E RQK+D+GEDPLDPE Q
Sbjct:   57 AEIDNHLEMGRKLLAAGQLAEALSHYHSAVETDPKNYLTYYKRATIYLAMGKFKSALPDLSKAIELKPDFLAARLQRGNILLKQGHTQEAKQDFEAVLKSNPEDAEAQSQLSRVVEQEFSMQEAQTAFQKKNYLGAVSFLDRVIEISPWDPEPKELRSECYLHLGDYNKAIMDLKPTTKLRNDNRAAFLKLSKLYYNLGEHEESLSQVRECLKLDQDDKDCFSHYKQVKKLTKQLESAEEHIKAQRYADAIEKYKAAMKTEPNVEIYTIKAKGWICHCLSKSKRVAEAIDLCSEAHQLDPRNTFVLRDRAEAFILNEEFEKAIEDYQEAKEFDAENEELKEGLERAQKLLKQSKKRNYYKILGIQRNANKQEIIKAYRKLAQQWHPDNFQSEDEKKEAEKRFIDIAAAKEVLTDPEMRQKFDSGEDPLDPENQ 489          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajc3b (dnaJ homolog subfamily C member 3-like [Source:NCBI gene;Acc:103042161])

HSP 1 Score: 381.333 bits (978), Expect = 2.041e-126
Identity = 210/449 (46.77%), Postives = 300/449 (66.82%), Query Frame = 2
Query:  131 LLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN-KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            ++ +L ++  + + P +++++L+ G +LLAAGQL +AL+ Y  AVEGD  NYL YY+RA VFLAMGK+KSA+ DL+ ++ LKP+F+ AR QR N+ LKQG   EA+ED   +LQ  P+  EA+  L    E+ E  E A   +    +   I  L+ V+E +      REMRA  Y++ G+ +KAI D   A +L  D+R   L+LS+LLY+ G    SL EIRECLKLD D K+CF HYK +KKL K ++S ++   ++RY + I K E++ K+EP   FY + A + +C    K+ EA+ A++ C  AH  +PQN  ++ D AEA+I  ++Y+ A+  YQ+  E D  NQ  +EG+ RAQKLLK S+KR+YYKIL V R+A K+EI+KAYRKLA ++HPD  + ++ KK AE++FIDI+ AK+VLTD E RQK+D+GEDPLDPE Q 
Sbjct:   22 VVLDLQLDGVLGASPVEIEQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLAMGKSKSALPDLTRAIQLKPDFLAARIQRGNILLKQGNTQEAREDFEAVLQRSPDQEEARNQLHKAEELEELQEEAHKAHHRGDYTSTIQVLDHVIELSPWDPESREMRAECYIRLGEPRKAILDLTPAARLRTDNRAAFLKLSRLLYDLGEHRDSLSEIRECLKLDQDDKECFAHYKQVKKLSKQMDSAEELISEQRYQEAIDKYESVMKTEPKITFYTTKAKERICFSLVKIKEAEKALDTCSEAHQRDPQNIHILRDRAEAYILLQDYEKAVEDYQEAREFDQENQEIREGLDRAQKLLKLSRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSESEKKEAEKRFIDIASAKEVLTDPEMRQKFDSGEDPLDPENQQ 470          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajc3b (dnaJ homolog subfamily C member 3-like [Source:NCBI gene;Acc:103042161])

HSP 1 Score: 381.333 bits (978), Expect = 2.041e-126
Identity = 210/449 (46.77%), Postives = 300/449 (66.82%), Query Frame = 2
Query:  131 LLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEP---FYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN-KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            ++ +L ++  + + P +++++L+ G +LLAAGQL +AL+ Y  AVEGD  NYL YY+RA VFLAMGK+KSA+ DL+ ++ LKP+F+ AR QR N+ LKQG   EA+ED   +LQ  P+  EA+  L    E+ E  E A   +    +   I  L+ V+E +      REMRA  Y++ G+ +KAI D   A +L  D+R   L+LS+LLY+ G    SL EIRECLKLD D K+CF HYK +KKL K ++S ++   ++RY + I K E++ K+EP   FY + A + +C    K+ EA+ A++ C  AH  +PQN  ++ D AEA+I  ++Y+ A+  YQ+  E D  NQ  +EG+ RAQKLLK S+KR+YYKIL V R+A K+EI+KAYRKLA ++HPD  + ++ KK AE++FIDI+ AK+VLTD E RQK+D+GEDPLDPE Q 
Sbjct:   22 VVLDLQLDGVLGASPVEIEQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLAMGKSKSALPDLTRAIQLKPDFLAARIQRGNILLKQGNTQEAREDFEAVLQRSPDQEEARNQLHKAEELEELQEEAHKAHHRGDYTSTIQVLDHVIELSPWDPESREMRAECYIRLGEPRKAILDLTPAARLRTDNRAAFLKLSRLLYDLGEHRDSLSEIRECLKLDQDDKECFAHYKQVKKLSKQMDSAEELISEQRYQEAIDKYESVMKTEPKITFYTTKAKERICFSLVKIKEAEKALDTCSEAHQRDPQNIHILRDRAEAYILLQDYEKAVEDYQEAREFDQENQEIREGLDRAQKLLKLSRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSESEKKEAEKRFIDIASAKEVLTDPEMRQKFDSGEDPLDPENQQ 470          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:103030310])

HSP 1 Score: 380.178 bits (975), Expect = 7.800e-126
Identity = 212/453 (46.80%), Postives = 295/453 (65.12%), Query Frame = 2
Query:  128 ILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQH 1465
            ++L +L +E  +      V+++L+ G +LLAAGQL DAL+ +  AV+GDP NY+ YYRRATV+LAMGK+KSA+ DLS  + LKP+F  AR QR NL LKQGKL +A+ D   +L+  P   E+ EAQ  L    EI   +  A+  +  N +  A  +L+ ++ET       REMRA  ++K G+  KAI+D + A KL ND+     +LS + Y  G+ + SL E+RECLKLDPDH  CF HYK +KKL KLI S ++  + +RY + ++K E++ KS+   P Y   A + +C+C SK  +   AI VC     ++P+N + + D AEA++ DE Y+ AI  ++       N+Q  KEG+ RAQ+LLK S+KR+YYKIL V RTA KKEI+KAYRKLA ++HPD  +  ++KK AE+KFIDI+ AK+VLTD E R K+D GEDPLDPE Q 
Sbjct:   19 LVLLDLQLEGVICGKSNSVEQHLEMGKKLLAAGQLADALSHFHTAVDGDPKNYMAYYRRATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKQGKLDDAESDFKKVLKSSPSSREEQEAQNQLKKSDEIQRLVTQARNDFSRNDYGPAASHLDIIIETCAWDVDSREMRAECFIKLGEMGKAISDLKAASKLRNDNTQAFYKLSTIYYNLGDHEMSLNEVRECLKLDPDHPQCFSHYKRVKKLNKLILSAEELIQQQRYGEAVSKYESVMKSDPNVPQYALLAKERICHCLSKDQQGAQAIPVCSEVLKSDPENVNALKDRAEAYLQDEQYEEAIKDFESAKMHSENDQEIKEGLDRAQRLLKQSQKRDYYKILGVKRTAQKKEIIKAYRKLAQQWHPDNFQDPEDKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGEDPLDPESQQ 471          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:103043863])

HSP 1 Score: 114.005 bits (284), Expect = 2.050e-26
Identity = 105/411 (25.55%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKR-------YNDCIT-KAENLKKSEPFYQSFAYQYLCN---CHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            Y KA++  P N   Y  RA   + + + + A+ED   ++ L   F+    +    +L  G    A      +L+ +P++ +AQ+ L N   I E   MA+  ++   F   +  +++ +E+ +     + ++A      G   +A +     +++   + D +      LY     D+++    + L++ PDH+      +  K L         A K+         Y++ +T    N+K +   Y        CN     SK+ + + AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K  +K AQ  LK SK+++YYK+L V ++AT+ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  VL+D +K+ +YD+G D
Sbjct:   64 YTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQQELKNAESILEYERMAEIGFDKRDFRMVVFCMDRALESASACHRFKVLKAECLALLGRYPEAQSVASDILRMDATNGDALYVRGLCLYYEDCIDKAVQFFIQALRMAPDHEKARLACRNAKALKAKKEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLY--------CNRATVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KHLLKTAQLELKKSKRKDYYKVLGVDKSATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKSRYDSGHD 465          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:103043863])

HSP 1 Score: 113.62 bits (283), Expect = 2.101e-26
Identity = 105/411 (25.55%), Postives = 194/411 (47.20%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKR-------YNDCIT-KAENLKKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLD 1450
            Y KA++  P N   Y  RA   + + + + A+ED   ++ L   F+    +    +L  G    A      +L+ +P++ +AQ+ L N   I E   MA+  ++   F   +  +++ +E+ +     + ++A      G   +A +     +++   + D +      LY     D+++    + L++ PDH+      +  K L         A K+         Y++ +T    N+K +   Y + A        SK+ + + AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K  +K AQ  LK SK+++YYK+L V ++AT+ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  VL+D +K+ +YD+G D  D
Sbjct:   64 YTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQQELKNAESILEYERMAEIGFDKRDFRMVVFCMDRALESASACHRFKVLKAECLALLGRYPEAQSVASDILRMDATNGDALYVRGLCLYYEDCIDKAVQFFIQALRMAPDHEKARLACRNAKALKAKKEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLYCNRA-----TVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEH-KHLLKTAQLELKKSKRKDYYKVLGVDKSATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKSRYDSGHDLED 468          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000796.1 (pep scaffold:Pmarinus_7.0:GL487111:2166:5165:-1 gene:ENSPMAG00000000730.1 transcript:ENSPMAT00000000796.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 8.054e-12
Identity = 30/63 (47.62%), Postives = 45/63 (71.43%), Query Frame = 2
Query: 1241 YKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            Y +L V R+A + +I KAY+ LA E+HPD+NR  N   AE +F++I+ A +VL++ EKR +YD
Sbjct:   39 YAVLGVARSAPQSDIKKAYKALAREWHPDKNRDPN---AEDRFVEITKAYEVLSNEEKRSQYD 98          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001704.1 (pep scaffold:Pmarinus_7.0:GL487204:33:3976:-1 gene:ENSPMAG00000001540.1 transcript:ENSPMAT00000001704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.015e-11
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            R YY++L V R A+ +E+ KAYR+LA ++HPD+N  DN + A   F  I  A DVL+DA++R  YD
Sbjct:    2 RCYYEVLGVARNASDEELKKAYRRLALQWHPDKN-ADNVEEATETFKLIQAAYDVLSDAQERAWYD 66          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 63.5438 bits (153), Expect = 9.764e-11
Identity = 62/255 (24.31%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  146 YIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNI----GEIAEAIE------------------MAKTYYENNRFEDA-IGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCF 841
            + E++V+ DP  +D Y+  G  L  A     A+A Y +A+  + N+ +++   A V+   G    AI+    ++ L+PNF  A    AN   ++G ++EA+E  N  L   P   ++   L NI    G I EA+                   +A    +  + +DA + Y   +  + T ++    M  N+  +  D Q A+  +  A++++    D    L+ +  ++GN  +++   R  LKL PD  D +
Sbjct:  214 HFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNM-GNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAY 467          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 60.4622 bits (145), Expect = 3.948e-10
Identity = 33/72 (45.83%), Postives = 46/72 (63.89%), Query Frame = 2
Query: 1226 KKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            K+  YY +L V   +T  E+ KAYRKLA +YHPD+N  + +     KF  IS A +VL+DA+KR+ YD G +
Sbjct:    3 KETAYYDLLGVKPNSTADELKKAYRKLALKYHPDKNPNEGE-----KFKQISQAYEVLSDAKKRELYDRGGE 69          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: dnajc5aa (DnaJ (Hsp40) homolog, subfamily C, member 5aa [Source:ZFIN;Acc:ZDB-GENE-031113-20])

HSP 1 Score: 57.3806 bits (137), Expect = 5.668e-10
Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 2
Query: 1241 YKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            Y +L + + AT  EI K+YRKLA +YHPD+N  DN +A E KF +I++A  +L+D +KR  YD
Sbjct:   18 YIVLGLQKGATADEIKKSYRKLALKYHPDKNP-DNPEAVE-KFKEINNANGILSDLKKRNIYD 78          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 67.3958 bits (163), Expect = 1.675e-12
Identity = 32/66 (48.48%), Postives = 49/66 (74.24%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            ++YY IL + + AT+KEI  AYR+L+ +YHPD+N G  +  A +KFI++ +A DVL+D EK++ YD
Sbjct:   22 QDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEE--AHQKFIEVGEAYDVLSDPEKKKIYD 85          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 61.2326 bits (147), Expect = 1.463e-10
Identity = 39/75 (52.00%), Postives = 50/75 (66.67%), Query Frame = 2
Query: 1226 KKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPL 1447
            K+  +Y IL V  TAT  EI KAYRK A +YHPD+N   +++AAE KF + S A ++L+D EKR  YD  GED L
Sbjct:    3 KETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKN--PSEEAAE-KFKEASAAYEILSDPEKRDIYDQFGEDGL 74          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: HLJ1 (Co-chaperone for Hsp40p; anchored in the ER membrane; with its homolog Ydj1p promotes ER-associated protein degradation (ERAD) of integral membrane substrates; similar to E. coli DnaJ [Source:SGD;Acc:S000004771])

HSP 1 Score: 58.151 bits (139), Expect = 4.065e-10
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 2
Query: 1229 KRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPLD 1450
            K  +Y+IL V R AT  EI KAYRKLA + HPD+N   + KA E  F  I+ A +VL++ EKR  YD  G DP D
Sbjct:   19 KHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKN--SHPKAGE-AFKVINRAFEVLSNEEKRSIYDRIGRDPDD 90          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 55.0694 bits (131), Expect = 1.214e-8
Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = 2
Query: 1226 KKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            K+   Y +L V  +A ++E+ K YRK A +YHPD+  GD +     KF +IS+A ++L D +KR+ YD
Sbjct:    3 KETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE-----KFKEISEAFEILNDPQKREIYD 65          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: XDJ1 (Chaperone with a role in facilitating mitochondrial protein import; ascomycete-specific member of the DnaJ-like family, closely related to Ydj1p; predicted to be C-terminally prenylated; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000004080])

HSP 1 Score: 55.0694 bits (131), Expect = 1.804e-8
Identity = 30/64 (46.88%), Postives = 43/64 (67.19%), Query Frame = 2
Query: 1241 YKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            Y +L V R AT +EI  AYRKLA ++HPD+    D+K+  E KF +I+ A ++L+D EK+  YD
Sbjct:   11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYD 74          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO32703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB0])

HSP 1 Score: 337.035 bits (863), Expect = 2.874e-110
Identity = 181/405 (44.69%), Postives = 258/405 (63.70%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            Y  AV+GDPNN+L  ++RATV +A+G+++SAI DL   L L+P F  AR QR N++LKQG+  EA  D   +L++ PE+ +A + L  I  I   +  AK   E      AI  L   +E       LR MRA+ Y + GD  KAI+D +   KL ND+    LR+SKL YE G  +++L E+RECLKLD DHK C   YK +KKL K +++ QD    ++Y++ I K +   ++E   +     A + LC+CH K+  ++ AI+ C AA + +  + D +CD AEA+I +E Y+ A++ +QK    + +  + +EG+ RAQ+LLK S+KR+YYKIL + R   K+EI KAYRKLA ++HPD  +G++KK AE+ FIDI+ AK+VLTD EKR KYD GEDPLDPE
Sbjct:   18 YHAAVDGDPNNFLPRFQRATVLIALGRSRSAIPDLDKVLELRPEFYQARVQRGNVFLKQGRFDEAHIDYEGVLRYSPENKDALQQLGVIEPIKRTVMEAKYAMERGDCHSAIEQLTHAIEVAPWDPELRMMRADCYERQGDLIKAISDIKPTTKLINDNTQAFLRMSKLHYEIGELEEALREVRECLKLDQDHKQCHPFYKKMKKLNKQLSAAQDLINKEQYHEAIDKLKKALRTESKNKPLVGKARRQLCHCHLKLGFSQEAIKECNAALSIDENDVDALCDRAEAYILEEMYNEAVNDFQKAKSINEHLHKVQEGLDRAQRLLKQSQKRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEKRAKYDAGEDPLDPE 422          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO37560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFH5])

HSP 1 Score: 76.6406 bits (187), Expect = 4.092e-17
Identity = 36/79 (45.57%), Postives = 63/79 (79.75%), Query Frame = 2
Query: 1214 LKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG---DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            LK SK+++YYKILN+ +TA++ EI KAY+K A ++HPDR+ G   + KK +E++F ++++A  +L+D +K+++YD+G+D
Sbjct:    1 LKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKMSEKQFKEVNEAYSILSDPKKKRRYDSGQD 79          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO26658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBE9])

HSP 1 Score: 68.5514 bits (166), Expect = 2.522e-14
Identity = 35/95 (36.84%), Postives = 65/95 (68.42%), Query Frame = 2
Query: 1103 FIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG---DNKKAAERKFIDI 1378
             +  E Y+ A+  Y+ + + D +++  +  +++A+  LK SK+++YYKILN+ +TA++ EI KAY+K A ++HPDR+ G   + KK AE++F ++
Sbjct:    1 MMESEKYEEAVRDYESLCKKDRSSREFRRLLEKAKLELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEV 95          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO40501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6W8])

HSP 1 Score: 70.4774 bits (171), Expect = 5.413e-14
Identity = 36/73 (49.32%), Postives = 55/73 (75.34%), Query Frame = 2
Query: 1232 RNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPL 1447
            ++YY+IL V R A+ K+I KA+RK+A +YHPD+N+G   K AE KF ++++A +VL+D  KR++YD  GE+ L
Sbjct:   25 KDYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKG---KDAEEKFREVAEAYEVLSDENKRRQYDQFGEEGL 94          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO35736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKN4])

HSP 1 Score: 69.3218 bits (168), Expect = 2.108e-13
Identity = 38/78 (48.72%), Postives = 57/78 (73.08%), Query Frame = 2
Query: 1235 NYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN-GEDPLDPEQQH 1465
            +YY IL V R+A++++I K+YRKLA ++HPD+N   NK+ AERKF +IS+A +VL+D+++R  YD  G+D L     H
Sbjct:    3 DYYDILEVPRSASEQDIKKSYRKLALKWHPDKNP-QNKEEAERKFKEISEAYEVLSDSKRRDVYDRYGKDGLTGNGGH 79          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:101166264])

HSP 1 Score: 379.022 bits (972), Expect = 1.927e-125
Identity = 211/470 (44.89%), Postives = 304/470 (64.68%), Query Frame = 2
Query:   74 NIDFVSMSIINKRLTLISILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKP---EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
            +ID V+  I+     ++  +L ++  E       G VD +++ G +LLAAGQL DAL+ +  AV+GDP NY+ +YRRATVFLAMGK+KSA+ DLS  + LKP+F  AR QR NL LKQGKL EA+ D   +L+  P   E+ EA+  L    EI   +  +++ +    +  AI  L+ ++ET       REMRA  Y++ G+  KA++D + A KL ND+     +LS + Y+ G+ + SL E+RECLKLDPDHK C+ HYK +KKL K I S ++  +++RY D ++K E + K+EP  Q F   A + +C+  +K  +A  AI VC     ++P+N +V+ D AEA++ DE Y+ AI  Y+   +   N+ + KEG++RAQ+LLK S++R+YYKIL V RTA KKEI+KAYRKLA ++HPD  +    KK AE++FIDI+ AK+VLTD E R K+D GEDP+DP+ Q
Sbjct:    3 SIDHVTSKILTYMPYIL--VLIDMRYEGVRCGKDGSVDNHMEMGKKLLAAGQLADALSHFHAAVDGDPKNYMAFYRRATVFLAMGKSKSALPDLSRVIELKPDFTSARLQRGNLLLKQGKLDEAESDFKKVLKSNPSDKEEREAKSQLAKSDEIQRLVAQSRSSFNGKDYMTAITLLDTIIETCVWDASSREMRAECYIQMGEMGKAVSDLKAASKLKNDNTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDPDHKQCYNHYKRVKKLNKQIQSAEELIQEQRYVDAVSKYEAVMKTEPNVQQFTLLAKERICHALAKDQQASRAISVCSEVLQSDPENVNVLKDRAEAYVQDEQYEEAIKDYETAGKHSENDHQIKEGLERAQRLLKQSQRRDYYKILGVKRTAKKKEIIKAYRKLAQQWHPDNFQDPQEKKKAEKRFIDIAQAKEVLTDPEMRNKFDQGEDPMDPDSQ 470          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajc3b (dnaJ homolog subfamily C member 3 [Source:NCBI gene;Acc:101168077])

HSP 1 Score: 370.548 bits (950), Expect = 3.925e-122
Identity = 208/452 (46.02%), Postives = 300/452 (66.37%), Query Frame = 2
Query:  113 LTLISILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
            L L+ +LL ++ ++    +   +++++L+ G +LLAAGQL +AL+ Y  AVEGD  NYL YY+RA VFLA+GK+KSA+ DL+ ++ LKP+F+ AR QR N+ LKQG   EA+ D   +L+  P+  EA++ L+   E+    E A   +    +  AI  L + +E +     LRE+RA  Y+++GD QKAI D     KL ND+R   L+LS L Y  G   +SL  +RECLKLD D KDCF HYK +KKL K ++S ++   ++RY D I K E++ K+E   PFY + A + +C C  K++    AI+VC  AH  +P+N  ++ D AEA+I +++Y+ A+  YQ+  E D ++   KEG++RAQKLLK S+KR+YYKIL V R+A K+E++KAYRKLA ++HPD  +    KK AE+KFIDI+ AK+VLTD E RQK+D+GEDPLDPE
Sbjct:   16 LPLLCVLL-DMQLDGVFGATRAEIEQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLALGKSKSALPDLTRAIELKPDFLAARLQRGNILLKQGNTEEARADFESVLKRSPDQEEARQQLMKASELEGLQEEAYAAHHQGEYSAAIAVLERAIEISPWDPDLRELRAECYVRTGDPQKAIQDLTPTTKLRNDNRAAFLKLSLLHYSLGQHHESLNHVRECLKLDQDDKDCFNHYKQVKKLSKQLDSAEELILEERYRDAIDKYESVMKTESDVPFYTNLAKERICFCFVKLNLVSEAIDVCSEAHQRDPRNAKILRDRAEAYILNQDYEKAVEDYQEAREFDGDSNDIKEGLERAQKLLKVSQKRDYYKILGVSRSANKQEVIKAYRKLAQQWHPDNFQSEAEKKEAEKKFIDIASAKEVLTDPEMRQKFDSGEDPLDPE 466          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajc3b (dnaJ homolog subfamily C member 3 [Source:NCBI gene;Acc:101168077])

HSP 1 Score: 366.696 bits (940), Expect = 7.757e-121
Identity = 204/431 (47.33%), Postives = 289/431 (67.05%), Query Frame = 2
Query:  176 GDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSE---PFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPE 1456
             +++++L+ G +LLAAGQL +AL+ Y  AVEGD  NYL YY+RA VFLA+GK+KSA+ DL+ ++ LKP+F+ AR QR N+ LKQG   EA+ D   +L+  P+  EA++ L+   E+    E A   +    +  AI  L + +E +     LRE+RA  Y+++GD QKAI D     KL ND+R   L+LS L Y  G   +SL  +RECLKLD D KDCF HYK +KKL K ++S ++   ++RY D I K E++ K+E   PFY + A + +C C  K++    AI+VC  AH  +P+N  ++ D AEA+I +++Y+ A+  YQ+  E D ++   KEG++RAQKLLK S+KR+YYKIL V R+A K+E++KAYRKLA ++HPD  +    KK AE+KFIDI+ AK+VLTD E RQK+D+GEDPLDPE
Sbjct:   29 AEIEQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLALGKSKSALPDLTRAIELKPDFLAARLQRGNILLKQGNTEEARADFESVLKRSPDQEEARQQLMKASELEGLQEEAYAAHHQGEYSAAIAVLERAIEISPWDPDLRELRAECYVRTGDPQKAIQDLTPTTKLRNDNRAAFLKLSLLHYSLGQHHESLNHVRECLKLDQDDKDCFNHYKQVKKLSKQLDSAEELILEERYRDAIDKYESVMKTESDVPFYTNLAKERICFCFVKLNLVSEAIDVCSEAHQRDPRNAKILRDRAEAYILNQDYEKAVEDYQEAREFDGDSNDIKEGLERAQKLLKVSQKRDYYKILGVSRSANKQEVIKAYRKLAQQWHPDNFQSEAEKKEAEKKFIDIASAKEVLTDPEMRQKFDSGEDPLDPE 459          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:101166264])

HSP 1 Score: 279.641 bits (714), Expect = 6.504e-87
Identity = 145/331 (43.81%), Postives = 214/331 (64.65%), Query Frame = 2
Query:  482 EDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSF---AYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNR-GDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQ 1462
            E+ EA+  L    EI   +  +++ +    +  AI  L+ ++ET       REMRA  Y++ G+  KA++D + A KL ND+     +LS + Y+ G+ + SL E+RECLKLDPDHK C+ HYK +KKL K I S ++  +++RY D ++K E + K+EP  Q F   A + +C+  +K  +A  AI VC     ++P+N +V+ D AEA++ DE Y+ AI  Y+   +   N+ + KEG++RAQ+LLK S++R+YYKIL V RTA KKEI+KAYRKLA ++HPD  +    KK AE++FIDI+ AK+VLTD E R K+D GEDP+DP+ Q
Sbjct:  150 EEREAKSQLAKSDEIQRLVAQSRSSFNGKDYMTAITLLDTIIETCVWDASSREMRAECYIQMGEMGKAVSDLKAASKLKNDNTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDPDHKQCYNHYKRVKKLNKQIQSAEELIQEQRYVDAVSKYEAVMKTEPNVQQFTLLAKERICHALAKDQQASRAISVCSEVLQSDPENVNVLKDRAEAYVQDEQYEEAIKDYETAGKHSENDHQIKEGLERAQRLLKQSQRRDYYKILGVKRTAKKKEIIKAYRKLAQQWHPDNFQDPQEKKKAEKRFIDIAQAKEVLTDPEMRNKFDQGEDPMDPDSQ 480          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:101161810])

HSP 1 Score: 114.775 bits (286), Expect = 7.230e-27
Identity = 107/408 (26.23%), Postives = 193/408 (47.30%), Query Frame = 2
Query:  251 YDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKD-------KRYNDCIT-KAENLKKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDN---KKAAERKFIDISDAKDVLTDAEKRQKYDNGED 1441
            Y KA++  P N   Y  RA   + + + + A+ED   ++ L  NF+    +    +L  G    A+     +L+ + E+ +AQ+ + N   I E   MA+  +E   F   +  +++ +E+       + ++A      G   +A +     +++ + + D +      LY     D+++    + L++ PDH       +  K L         A KD       + Y++ +T    N+K +   Y + A        SK+ +   AIE C  A   +          A+ ++  E Y+ A+  Y+KV +++   +  K  +K AQ  LK SK+++YYKIL V + AT+ EI KAYRK A  +HPDR+ G +   +K  E+KF ++ +A  VL+D +K+ +YD+G+D
Sbjct:   51 YTKAIDMCPRNPSYYGNRAATLMMLCRYREALEDAQQAVRLDGNFVKGHLREGKCHLSLGNAMAARRCFQKVLELELENGQAQQEVKNAESILEYERMAEIGFEKRDFRMVVFCMDRALESAPACHKFKILKAECLALLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHDKARLACRDAKALKAKKEEGNKAFKDGNFEAAYELYSEALTIDPNNIKTNAKLYCNRA-----TVGSKLKKLDQAIEDCTKAIKLDETYIKAYLRRAQCYMDTELYEEAVRDYEKVYQTEKTKEH-KHLLKTAQLELKKSKRKDYYKILGVEKNATEDEIKKAYRKRALLHHPDRHSGASPELQKEEEKKFKEVGEAFSVLSDPKKKSRYDSGQD 452          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000009124.1 (SMESG000009124.1)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 455/459 (99.13%), Postives = 455/459 (99.13%), Query Frame = 2
Query:   92 MSIINKRLTLISILLFNLYIEESVTSDPGDVDKYLQTGTRXXXXXXXXXXXXXYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ 1468
            MSIINKR TLISILLFNLYIEESVTSDPGDVDKYLQTGTRLLAAGQLLDAL QYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCI KAE LKKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ
Sbjct:    1 MSIINKRFTLISILLFNLYIEESVTSDPGDVDKYLQTGTRLLAAGQLLDALVQYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCFKHYKFIKKLVKLINSIQDAAKDKRYNDCIIKAEKLKKSEPFYQSFAYQYLCNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISYYQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGEDPLDPEQQHQ 459          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000005351.1 (SMESG000005351.1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.399e-13
Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 2
Query: 1238 YYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            YY ILNV   +   EI K YRKLA  +HPD+N  DNK  AE+KF +IS+A +VL+DAEKR+ YD
Sbjct:    6 YYDILNVSPNSDASEIKKQYRKLALRWHPDKNP-DNKIEAEKKFKEISEAYEVLSDAEKRKMYD 68          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000027166.1 (SMESG000027166.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.198e-12
Identity = 34/65 (52.31%), Postives = 47/65 (72.31%), Query Frame = 2
Query: 1235 NYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYD 1429
            +YYK+L V + A KK+I  AYRKLA +YHPD+N+   +K A  KF+ I+ A +VL+D  KRQ+YD
Sbjct:   24 DYYKLLGVSKNADKKQIKSAYRKLAVKYHPDKNK---EKDAGEKFMKITKAYEVLSDQNKRQQYD 85          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000017290.1 (SMESG000017290.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.483e-11
Identity = 35/68 (51.47%), Postives = 48/68 (70.59%), Query Frame = 2
Query: 1229 KRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDN 1432
            K++YYKIL V++ A+ KEI  AY +LA +YHPD N+  N K AE KF D S+A +VL+D  K+ +YD 
Sbjct:   28 KKDYYKILGVNKNASPKEIKSAYYQLAKKYHPDTNK--NNKDAEEKFKDASEAYEVLSDTNKKAEYDT 93          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000012107.1 (SMESG000012107.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.063e-11
Identity = 36/70 (51.43%), Postives = 46/70 (65.71%), Query Frame = 2
Query: 1226 KKRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNG 1435
            K+  YY IL VH   +++E+ KAYRKLA +YHPD+N       A  KF +IS A +VL DA+KRQ YD G
Sbjct:    3 KETKYYDILGVHPNVSEQELKKAYRKLALKYHPDKN-----PDAGDKFKEISQAFEVLADAKKRQIYDEG 67          
The following BLAST results are available for this feature:
BLAST of J domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC33.106e-11845.22DnaJ heat shock protein family (Hsp40) member C3 [... [more]
DNAJC33.747e-10343.38DnaJ heat shock protein family (Hsp40) member C3 [... [more]
DNAJC71.071e-2425.48DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC71.456e-2325.25DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC71.456e-2325.25DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-73.911e-9740.80DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-285.586e-8037.99DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-226.876e-1349.35DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-208.032e-1252.05DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;... [more]
dnj-131.387e-1147.95DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P58IPK2.001e-10540.55gene:FBgn0037718 transcript:FBtr0082074[more]
Tpr21.151e-2323.84gene:FBgn0032586 transcript:FBtr0080867[more]
Tpr21.151e-2323.84gene:FBgn0032586 transcript:FBtr0333488[more]
Tpr21.503e-2323.84gene:FBgn0032586 transcript:FBtr0333486[more]
Tpr22.340e-2323.84gene:FBgn0032586 transcript:FBtr0080866[more]
back to top
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc3b4.440e-12245.62DnaJ (Hsp40) homolog, subfamily C, member 3b [Sour... [more]
dnajc3a6.529e-11845.38DnaJ (Hsp40) homolog, subfamily C, member 3a [Sour... [more]
dnajc3a6.529e-11845.38DnaJ (Hsp40) homolog, subfamily C, member 3a [Sour... [more]
dnajc73.894e-2725.79DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
dnajc74.557e-2725.79DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000019480.15.701e-12346.88dnaJ homolog subfamily C member 3 like [Source:NCB... [more]
gask1b1.174e-12246.50golgi associated kinase 1B [Source:Xenbase;Acc:XB-... [more]
gask1b4.195e-12147.83golgi associated kinase 1B [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000019462.11.442e-11545.66dnaJ homolog subfamily C member 3 like [Source:NCB... [more]
ENSXETT00000019451.15.521e-11546.58dnaJ homolog subfamily C member 3 like [Source:NCB... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc32.649e-11744.80DnaJ heat shock protein family (Hsp40) member C3 [... [more]
Dnajc71.109e-2425.24DnaJ heat shock protein family (Hsp40) member C7 [... [more]
Dnajb81.056e-1352.31DnaJ heat shock protein family (Hsp40) member B8 [... [more]
Dnajb115.346e-1353.42DnaJ heat shock protein family (Hsp40) member B11 ... [more]
Dnajb115.346e-1353.42DnaJ heat shock protein family (Hsp40) member B11 ... [more]
back to top
BLAST of J domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27968|DNJC3_BOVIN5.236e-11945.65DnaJ homolog subfamily C member 3 OS=Bos taurus OX... [more]
sp|Q13217|DNJC3_HUMAN1.492e-11745.22DnaJ homolog subfamily C member 3 OS=Homo sapiens ... [more]
sp|Q9R0T3|DNJC3_RAT1.700e-11644.80DnaJ homolog subfamily C member 3 OS=Rattus norveg... [more]
sp|Q91YW3|DNJC3_MOUSE1.853e-11644.80DnaJ homolog subfamily C member 3 OS=Mus musculus ... [more]
sp|Q5ZI13|DNJC3_CHICK5.888e-10845.54DnaJ homolog subfamily C member 3 OS=Gallus gallus... [more]
back to top
BLAST of J domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GA671.780e-13247.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1PZ236.125e-13250.12DnaJ-like protein subfamily C member 3 OS=Crassost... [more]
A0A267E2W31.216e-12947.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W7RHU97.272e-12948.04DnaJ subfamily C member 3-like protein OS=Agkistro... [more]
A0A0F7Z8P51.004e-12749.42DnaJ subfamily C member 3-like protein OS=Crotalus... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc3b2.041e-12646.77dnaJ homolog subfamily C member 3-like [Source:NCB... [more]
dnajc3b2.041e-12646.77dnaJ homolog subfamily C member 3-like [Source:NCB... [more]
dnajc3a7.800e-12646.80DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc72.050e-2625.55DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc72.101e-2625.55DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000796.18.054e-1247.62pep scaffold:Pmarinus_7.0:GL487111:2166:5165:-1 ge... [more]
ENSPMAT00000001704.11.015e-1148.48pep scaffold:Pmarinus_7.0:GL487204:33:3976:-1 gene... [more]
ogt.19.764e-1124.31O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
dnaja13.948e-1045.83DnaJ heat shock protein family (Hsp40) member A1 [... [more]
dnajc5aa5.668e-1049.21DnaJ (Hsp40) homolog, subfamily C, member 5aa [Sou... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SCJ11.675e-1248.48One of several homologs of bacterial chaperone Dna... [more]
YDJ11.463e-1052.00Type I HSP40 co-chaperone; involved in regulation ... [more]
HLJ14.065e-1050.67Co-chaperone for Hsp40p; anchored in the ER membra... [more]
SIS11.214e-841.18Type II HSP40 co-chaperone that interacts with the... [more]
XDJ11.804e-846.88Chaperone with a role in facilitating mitochondria... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327032.874e-11044.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375604.092e-1745.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266582.522e-1436.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405015.413e-1449.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357362.108e-1348.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc3a1.927e-12544.89DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc3b3.925e-12246.02dnaJ homolog subfamily C member 3 [Source:NCBI gen... [more]
dnajc3b7.757e-12147.33dnaJ homolog subfamily C member 3 [Source:NCBI gen... [more]
dnajc3a6.504e-8743.81DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc77.230e-2726.23DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of J domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009124.10.000e+099.13SMESG000009124.1[more]
SMESG000005351.12.399e-1357.81SMESG000005351.1[more]
SMESG000027166.11.198e-1252.31SMESG000027166.1[more]
SMESG000017290.12.483e-1151.47SMESG000017290.1[more]
SMESG000012107.13.063e-1151.43SMESG000012107.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010506 ID=SMED30010506|Name=J domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1752bp
TAAGATTTGAACACACCGAATTAAATTATCAACCTATTAATTTCAAATTA
CACTTATTATACGTATACTTAGGAACATTGATTTTGTTTCAATGTCAATC
ATAAATAAGCGGTTAACTTTGATATCCATTTTACTTTTTAATCTTTATAT
AGAAGAATCTGTTACCTCTGATCCTGGAGACGTGGACAAGTATCTTCAAA
CTGGGACACGGTTACTAGCAGCTGGACAATTATTAGATGCCCTTGCGCAA
TATGATAAGGCAGTCGAAGGAGATCCAAACAATTATTTGATATATTACCG
CAGAGCTACAGTGTTTTTAGCTATGGGAAAAACTAAATCAGCCATTGAAG
ATTTAAGTAATTCGTTATTATTAAAGCCAAATTTTATTCCGGCAAGAACA
CAAAGAGCCAACTTATATTTAAAACAAGGGAAATTATCAGAAGCAAAAGA
AGATATTAATTTACTGCTTCAGCACAAACCAGAGGACGTTGAAGCCCAGA
AAATGCTAGTAAACATCGGTGAAATTGCTGAGGCTATTGAAATGGCCAAG
ACATACTATGAAAATAATCGGTTCGAAGATGCCATTGGATATCTGAACAA
AGTCATGGAAACCACAACTCTCAGTGAATATTTGCGTGAAATGCGAGCAA
ATAGCTACTTGAAGTCCGGTGACAATCAAAAGGCAATAAATGACTTTAGG
TACGCAGTTAAATTGTCCAATGATGACAGAGATGGCATTTTGCGATTGAG
TAAATTGCTGTATGAAACCGGCAACGCAGATCAGTCATTGGTGGAAATTC
GAGAGTGTCTTAAACTCGATCCCGATCATAAAGACTGTTTTAAGCATTAT
AAATTCATTAAAAAACTTGTCAAATTGATCAACTCCATTCAAGACGCAGC
CAAAGACAAGCGATATAACGACTGTATTACTAAAGCTGAAAATTTGAAAA
AATCTGAGCCATTTTATCAATCCTTCGCATATCAATATCTATGCAATTGC
CATAGCAAGGTCAGTGAAGCGAAAACCGCTATTGAAGTGTGTGAAGCTGC
ACATGCGAATGAGCCTCAGAATTGGGATGTAATCTGTGATTTAGCGGAAG
CATTTATAGCCGATGAAAATTACGATTCAGCGATTAGCTACTATCAGAAA
GTTCTTGAATCAGACAATAATAATCAGCGAGCAAAAGAAGGAATGAAAAG
AGCTCAGAAATTGCTGAAAAATTCTAAAAAAAGAAATTATTACAAAATAT
TAAATGTTCACAGAACTGCAACCAAAAAAGAAATTCTCAAAGCATACCGG
AAGCTAGCAGCCGAATATCATCCTGATCGTAATAGAGGTGATAACAAAAA
AGCAGCAGAAAGAAAATTTATCGACATTTCTGACGCAAAAGATGTTTTAA
CCGATGCTGAGAAGCGCCAAAAATATGACAATGGTGAAGATCCATTAGAT
CCAGAACAGCAACATCAAGGTCCAACAGGGAATCCATTTGGTGGATTCAC
ATTCCATAACTTTAATCCCTTTGAAGATGGGGGATTTGAATTTCATTTTG
GCTGATAAATATCAAATAAATACTTTTATTATCTTATTTTTTGTGCCTAA
AATAAAAAATAAAAAATCAGTCGGATCAAATCATATTTCTCTTGTTTTCA
ACTATTTTTTTTGAAAATAAATCAGTTACTGTTTGCTTGATTAATTATAA
ATTTTTCCGATTTCCACACGAAATTGCTTTGAATTTATAAGAATTGTGAA
CT
back to top

protein sequence of SMED30010506-orf-1

>SMED30010506-orf-1 ID=SMED30010506-orf-1|Name=SMED30010506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MSIINKRLTLISILLFNLYIEESVTSDPGDVDKYLQTGTRLLAAGQLLDA
LAQYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNFIP
ARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIE
MAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAIN
DFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKLDPDHKDCF
KHYKFIKKLVKLINSIQDAAKDKRYNDCITKAENLKKSEPFYQSFAYQYL
CNCHSKVSEAKTAIEVCEAAHANEPQNWDVICDLAEAFIADENYDSAISY
YQKVLESDNNNQRAKEGMKRAQKLLKNSKKRNYYKILNVHRTATKKEILK
AYRKLAAEYHPDRNRGDNKKAAERKFIDISDAKDVLTDAEKRQKYDNGED
PLDPEQQHQGPTGNPFGGFTFHNFNPFEDGGFEFHFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR015155PFU
IPR001623DnaJ_domain
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004860protein kinase inhibitor activity
GO:0019901protein kinase binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
GO:0006469negative regulation of protein kinase activity
GO:0006986response to unfolded protein
GO:0036494positive regulation of translation initiation in response to endoplasmic reticulum stress
GO:0070417cellular response to cold
GO:1903912negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 361..381
NoneNo IPR availablePFAMPF14559TPR_19coord: 76..138
e-value: 3.2E-6
score: 27.5
NoneNo IPR availablePANTHERPTHR44140FAMILY NOT NAMEDcoord: 13..486
NoneNo IPR availablePANTHERPTHR44140:SF3DNAJ HOMOLOG SUBFAMILY C MEMBER 3coord: 13..486
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.635
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 421..441
score: 43.07
coord: 384..402
score: 47.81
coord: 402..417
score: 58.74
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 381..441
e-value: 1.9E-23
score: 93.9
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 382..446
e-value: 4.8E-22
score: 77.9
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 382..449
score: 19.718
IPR001623DnaJ domainCDDcd06257DnaJcoord: 382..438
e-value: 1.70708E-18
score: 77.2005
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 65..98
e-value: 0.0019
score: 27.5
coord: 294..327
e-value: 110.0
score: 5.9
coord: 99..132
e-value: 0.023
score: 23.9
coord: 179..212
e-value: 6.2
score: 15.8
coord: 213..246
e-value: 90.0
score: 6.6
coord: 328..361
e-value: 0.004
score: 26.4
coord: 31..64
e-value: 170.0
score: 4.1
coord: 145..178
e-value: 230.0
score: 2.9
IPR019734Tetratricopeptide repeatPFAMPF13176TPR_7coord: 331..361
e-value: 0.0028
score: 17.5
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 213..246
score: 7.493
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 179..212
score: 7.906
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 31..64
score: 8.968
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 328..361
score: 9.027
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 99..132
score: 7.434
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 294..327
score: 5.015
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 145..178
score: 6.018
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 65..98
score: 8.349
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 29..379
e-value: 4.7E-102
score: 343.9
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 20..392
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 380..487
e-value: 1.6E-27
score: 98.2
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 376..477
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 31..361
score: 34.693