CEP135

Overview
NameCEP135
Smed IDSMED30010503
Uniprot Best hitTestis-specific gene 10 protein OS=Homo sapiens OX=9606 GN=TSGA10 PE=1 SV=1 (E=1.49944e-49)
Length (bp)3100
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CEP135 (SMED30010503) t-SNE clustered cells

Violin plots show distribution of expression levels for CEP135 (SMED30010503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CEP135 (SMED30010503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CEP135 (SMED30010503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010503SMESG000077870.1 dd_Smed_v6_5218_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010503SMESG000077870.1 dd_Smed_v6_5218_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010503SMESG000077870.1 dd_Smed_v6_5218_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30010503SMESG000077870.1 dd_Smed_v6_5218_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010503SMESG000077870.1 dd_Smed_v4_5218_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CEP135 vs. Ensembl Human
Match: TSGA10 (testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14927])

HSP 1 Score: 191.815 bits (486), Expect = 2.476e-50
Identity = 171/634 (26.97%), Postives = 343/634 (54.10%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+L  E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L    N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ DND L  + ++ ++ N++L   + D   E ++++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + D +T K EL   E + + L+ ++D L +EV +     R  +S+IS L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE     +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        + +S + KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHH 678          
BLAST of CEP135 vs. Ensembl Human
Match: TSGA10 (testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14927])

HSP 1 Score: 191.43 bits (485), Expect = 3.122e-50
Identity = 171/634 (26.97%), Postives = 343/634 (54.10%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+L  E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L    N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ DND L  + ++ ++ N++L   + D   E ++++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + D +T K EL   E + + L+ ++D L +EV +     R  +S+IS L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE     +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        + +S + KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHH 678          
BLAST of CEP135 vs. Ensembl Human
Match: TSGA10 (testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14927])

HSP 1 Score: 191.43 bits (485), Expect = 3.122e-50
Identity = 171/634 (26.97%), Postives = 343/634 (54.10%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+L  E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L    N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ DND L  + ++ ++ N++L   + D   E ++++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + D +T K EL   E + + L+ ++D L +EV +     R  +S+IS L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE     +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        + +S + KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHH 678          
BLAST of CEP135 vs. Ensembl Human
Match: TSGA10 (testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14927])

HSP 1 Score: 191.43 bits (485), Expect = 3.122e-50
Identity = 171/634 (26.97%), Postives = 343/634 (54.10%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+L  E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L    N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ DND L  + ++ ++ N++L   + D   E ++++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + D +T K EL   E + + L+ ++D L +EV +     R  +S+IS L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE     +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        + +S + KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHH 678          
BLAST of CEP135 vs. Ensembl Human
Match: CEP135 (centrosomal protein 135 [Source:HGNC Symbol;Acc:HGNC:29086])

HSP 1 Score: 164.081 bits (414), Expect = 2.208e-40
Identity = 151/630 (23.97%), Postives = 353/630 (56.03%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSEL----ENKKEGCSQLK---QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSL----------SPSYKP 2871
            +IQS+VKLLT E+D+   +Y E+++E+  + +E            +    +++ +E E++   ++L R+  E+++L E+ +   E +   K   E+ IE L+       +EK ++  ++  ++  I  LEN+LK   + A Q FS +     ++K   + L+   +QL++S   +D  + ++     +L  ++ ++ + E+KI +L   +    ++   ++     +D++KD L+ T+ E   +I  L+ +L   E+ + + +  +   E  + ++ E L  R++E   LR+Q D    +++E  +   I  ++N RL ++ + + R N+ +  +++  ++E++E++ +   Y++EV   E L+A +E++  +LL++FQ+L   A  ++ +    + + S+ + EL   + +  +L+ R++ LEKE+ E    +   ES+IS +   +++ +E+++  + E+  ++ DLS+LR+LC +L+  K+ + +++++K+L+ E++   ++++++E++ +K++L  +   ++ +E++L ++R+ E +  +   +K +E+ +L ++L  +E KL    RE   L+ + + L+ + + ++R +S E++E++RA+ E+R H L          SPS+ P
Sbjct:  521 DIQSNVKLLTAERDKLSVLYNEAQEELSALRKE--------STQTTAPHNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENKLK---VQA-QKFSHVAGDSSHQKTEVNSLRIVNEQLQRS---VDDYQHRLSIKRGELESAQAQIKILEEKIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIMISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLRELCIKLDSGKDIMTQQLNSKNLEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLTSHEKDTEIQLLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLATPPLSSTLRSPSHSP 1135          

HSP 2 Score: 55.4546 bits (132), Expect = 7.042e-7
Identity = 53/223 (23.77%), Postives = 121/223 (54.26%), Query Frame = 1
Query:  133 LSYDNRGANN------LRKEIALLMEENDNLKHKIEE-MDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDL---QESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            LS ++R   N      L  ++  L + N +L+ +I E M+ K +    + ++L ++N  L  +L+ +++  + ++  K+++L   + EL + +K +++   E +  E+   KL   L   Q   + + ++L    + + ++ +L+ +K RLS+++E    TER L LE+ER +      +   + ++++ +++GIEE+RDY+K E   L+ + ++ + S  ++
Sbjct:  257 LSLESRNKTNEKLIAHLNIQVDFLQQANKDLEKRIRELMETKETVTSEV-VNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKLSEMQDLEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVTERQLTLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYS 478          
BLAST of CEP135 vs. Ensembl Fly
Match: Cep135 (gene:FBgn0036480 transcript:FBtr0075638)

HSP 1 Score: 51.9878 bits (123), Expect = 3.164e-6
Identity = 95/366 (25.96%), Postives = 161/366 (43.99%), Query Frame = 1
Query: 1186 LNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQ-NFSELENK------KEGCSQLKQQLKKSEMHLD--STERQVVSLTTQLNKSEERVALQEQKILDLVD------DLRIH----------------RDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGIL--SRD-----NDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAA 2169
            + RVE ERD  + EL RV+ ERD+L E+   +V+                              A+ ++ALR R  +L + L+ +E   R+ N + L  +      KE   Q++Q++   +  +D   TE   +   T LN   ER+    Q  L + +      D+R                  R D   LR     L+ +KD L   L     R+++LE++L   +E+      N+   E QL +++         NRQ   +    S + +  +++I  L  SRD     N RL ++ S+ Q   ++LQ  + D   +   ++ Q   YV EVK AEDLL Q+E+++ ++L+Q+  L++  A
Sbjct:  511 IARVERERDCARTELERVRCERDTLREKQLSTVQL----------------------------HADELQALRLRNEELNDRLRQMERDNRELNSARLPTETNLVLLKEDLLQMRQRVASMQTEIDQLKTENDQI---TMLNDQNERIIADYQSKLLVAERQRQSADVRASTLDSSRESNRSEVTQLRMDLGALRQTYISLEHEKDTLLHQLDTKTERVYKLEYELKDCKEKRNALEQNVKDLEDQLRKLA-------NRNRQRDSELTETSTESKTLRQQIVALKASRDEAIAENRRLMDKLSDAQVEARTLQKKLTDSELQVANMKQQLHKYVQEVKKAEDLLIQKEKERDDMLDQYHCLTQGQA 838          
BLAST of CEP135 vs. Ensembl Fly
Match: Cep135 (gene:FBgn0036480 transcript:FBtr0333853)

HSP 1 Score: 51.6026 bits (122), Expect = 4.156e-6
Identity = 95/366 (25.96%), Postives = 161/366 (43.99%), Query Frame = 1
Query: 1186 LNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQ-NFSELENK------KEGCSQLKQQLKKSEMHLD--STERQVVSLTTQLNKSEERVALQEQKILDLVD------DLRIH----------------RDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGIL--SRD-----NDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAA 2169
            + RVE ERD  + EL RV+ ERD+L E+   +V+                              A+ ++ALR R  +L + L+ +E   R+ N + L  +      KE   Q++Q++   +  +D   TE   +   T LN   ER+    Q  L + +      D+R                  R D   LR     L+ +KD L   L     R+++LE++L   +E+      N+   E QL +++         NRQ   +    S + +  +++I  L  SRD     N RL ++ S+ Q   ++LQ  + D   +   ++ Q   YV EVK AEDLL Q+E+++ ++L+Q+  L++  A
Sbjct:  511 IARVERERDCARTELERVRCERDTLREKQLSTVQL----------------------------HADELQALRLRNEELNDRLRQMERDNRELNSARLPTETNLVLLKEDLLQMRQRVASMQTEIDQLKTENDQI---TMLNDQNERIIADYQSKLLVAERQRQSADVRASTLDSSRESNRSEVTQLRMDLGALRQTYISLEHEKDTLLHQLDTKTERVYKLEYELKDCKEKRNALEQNVKDLEDQLRKLA-------NRNRQRDSELTETSTESKTLRQQIVALKASRDEAIAENRRLMDKLSDAQVEARTLQKKLTDSELQVANMKQQLHKYVQEVKKAEDLLIQKEKERDDMLDQYHCLTQGQA 838          
BLAST of CEP135 vs. Ensembl Zebrafish
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:553303])

HSP 1 Score: 195.282 bits (495), Expect = 2.265e-50
Identity = 171/606 (28.22%), Postives = 337/606 (55.61%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQIL---SEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ+ VKLLT E+D+     +++++E+ R+ +EL            +S +L  R+  +R+  + EL RV  ERD+L +R KV+  TA  D+   E +  DL NTI+    EK D+  ++  L+   + +E ELK       QN  E   ++   S L+   ++ E  L   + ++   T +L  + +++   E+KI DL       +D+   L++    LD +KD L+  + +    +  L+ ++   EE L E R  +   E  L ++  +L++RE+E   LR+Q D +  ++    +   +  R+N RL ++ + + R N+++  ++Q+ + ERDEL+++  +Y+SEV   E L+A +EQ+  ++L +F+ +   SED  L   +L+  +   ++ + EL   + +  +L+ R+   ++E+ E     +  E+++S L   +++ +E+V+  + E+  ++ DL+++R+LC +L+ SKE   +++ +KS+++E++   ++D+ +E E +K++L  +   +R +ET+L ++R  E    I   +K SE+ VL DRL   + K     REV +L+ + S L+ E + ++R L+ E+FE++RA+ E+R
Sbjct:  530 DIQTRVKLLTAERDQLSSQCQQAQEELRRVQREL------------ESSELQRRIRDDREQTEAELQRVTAERDALRDRLKVAHSTALTDREQEEFRFLDLENTIEKLEREKADLRAQVTVLKESRVVVEKELKAQSAVLLQNVEEATQQRVESSALRLLQEQMEQSLSDVQHRLSVKTNELQAAHQQIDKLEEKIADLSRHGSSQKDEVVILQNTIASLDREKDTLQDAVDQKTESVVLLQQEVHRKEETLLEVRLTVTDLENSLNQLQAVLSSREREIASLRRQLDQSQEELFSVSRDREVALRENRRLQDDLATMTRENQAVHAEMQEALNERDELKLRVHSYISEVARIESLMAAKEQENRDMLERFRSIHTESEDKEL---KLQQSEGLNNSIRLELLSSDTERRHLRERVSLQDREIQEHLNALQAYEAQVSSLARAMSRLEEEVQAARAEKASVLADLASVRELCVKLDSSKELTVRQLTSKSMELERVTGELEDVRSEMELLKKQLGSERLTVRNLETLLSTNRQKEFQTHISASEKESELKVLKDRLALADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQLTTERFERERAVQEMR 1120          
BLAST of CEP135 vs. Ensembl Zebrafish
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:553303])

HSP 1 Score: 194.512 bits (493), Expect = 3.254e-50
Identity = 171/606 (28.22%), Postives = 337/606 (55.61%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQIL---SEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ+ VKLLT E+D+     +++++E+ R+ +EL            +S +L  R+  +R+  + EL RV  ERD+L +R KV+  TA  D+   E +  DL NTI+    EK D+  ++  L+   + +E ELK       QN  E   ++   S L+   ++ E  L   + ++   T +L  + +++   E+KI DL       +D+   L++    LD +KD L+  + +    +  L+ ++   EE L E R  +   E  L ++  +L++RE+E   LR+Q D +  ++    +   +  R+N RL ++ + + R N+++  ++Q+ + ERDEL+++  +Y+SEV   E L+A +EQ+  ++L +F+ +   SED  L   +L+  +   ++ + EL   + +  +L+ R+   ++E+ E     +  E+++S L   +++ +E+V+  + E+  ++ DL+++R+LC +L+ SKE   +++ +KS+++E++   ++D+ +E E +K++L  +   +R +ET+L ++R  E    I   +K SE+ VL DRL   + K     REV +L+ + S L+ E + ++R L+ E+FE++RA+ E+R
Sbjct:  530 DIQTRVKLLTAERDQLSSQCQQAQEELRRVQREL------------ESSELQRRIRDDREQTEAELQRVTAERDALRDRLKVAHSTALTDREQEEFRFLDLENTIEKLEREKADLRAQVTVLKESRVVVEKELKAQSAVLLQNVEEATQQRVESSALRLLQEQMEQSLSDVQHRLSVKTNELQAAHQQIDKLEEKIADLSRHGSSQKDEVVILQNTIASLDREKDTLQDAVDQKTESVVLLQQEVHRKEETLLEVRLTVTDLENSLNQLQAVLSSREREIASLRRQLDQSQEELFSVSRDREVALRENRRLQDDLATMTRENQAVHAEMQEALNERDELKLRVHSYISEVARIESLMAAKEQENRDMLERFRSIHTESEDKEL---KLQQSEGLNNSIRLELLSSDTERRHLRERVSLQDREIQEHLNALQAYEAQVSSLARAMSRLEEEVQAARAEKASVLADLASVRELCVKLDSSKELTVRQLTSKSMELERVTGELEDVRSEMELLKKQLGSERLTVRNLETLLSTNRQKEFQTHISASEKESELKVLKDRLALADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQLTTERFERERAVQEMR 1120          
BLAST of CEP135 vs. Ensembl Zebrafish
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:553303])

HSP 1 Score: 151.754 bits (382), Expect = 9.973e-37
Identity = 162/606 (26.73%), Postives = 315/606 (51.98%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQIL---SEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ+ VKLLT E+D+     +++++E+ R+ +EL            +S +L  R+  +R+  + EL RV  ERD+L +R KV+  TA  D+   E +  DL NTI+    EK D+  ++  L+   + +E ELK       QN  E   ++   S L+   ++ E  L   + ++   T +L  + +++   E+KI DL       +D+   L++    LD +KD L+  + +    +  L+ ++   EE L E R  +   E  L ++  +L++RE+E   LR+Q D +       Q+++  +SRD +    E       N+ LQ+D+  +  E                        +EQ+  ++L +F+ +   SED  L   +L+  +   ++ + EL   + +  +L+ R+   ++E+ E     +  E+++S L   +++ +E+V+  + E+  ++ DL+++R+LC +L+ SKE   +++ +KS+++E++   ++D+ +E E +K++L  +   +R +ET+L ++R  E    I   +K SE+ VL DRL   + K     REV +L+ + S L+ E + ++R L+ E+FE++RA+ E+R
Sbjct:  530 DIQTRVKLLTAERDQLSSQCQQAQEELRRVQREL------------ESSELQRRIRDDREQTEAELQRVTAERDALRDRLKVAHSTALTDREQEEFRFLDLENTIEKLEREKADLRAQVTVLKESRVVVEKELKAQSAVLLQNVEEATQQRVESSALRLLQEQMEQSLSDVQHRLSVKTNELQAAHQQIDKLEEKIADLSRHGSSQKDEVVILQNTIASLDREKDTLQDAVDQKTESVVLLQQEVHRKEETLLEVRLTVTDLENSLNQLQAVLSSREREIASLRRQLDQS-------QEELFSVSRDREVALRE-------NRRLQDDLATMTRE-----------------------NQEQENRDMLERFRSIHTESEDKEL---KLQQSEGLNNSIRLELLSSDTERRHLRERVSLQDREIQEHLNALQAYEAQVSSLARAMSRLEEEVQAARAEKASVLADLASVRELCVKLDSSKELTVRQLTSKSMELERVTGELEDVRSEMELLKKQLGSERLTVRNLETLLSTNRQKEFQTHISASEKESELKVLKDRLALADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQLTTERFERERAVQEMR 1083          
BLAST of CEP135 vs. Ensembl Zebrafish
Match: tsga10 (testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-061013-482])

HSP 1 Score: 122.865 bits (307), Expect = 3.554e-28
Identity = 171/645 (26.51%), Postives = 311/645 (48.22%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGG--RANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILD-----LVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRI----HQLEHD------LVAAEEELQET----RDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTEL---LNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKE--ELLQKD-----ENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR---IHSLSP 2859
            + E Q++VK+LT E+D+    Y+++++EI  + +E++ ++   G    +  ++ +L RVE ERD   ++L R+  ERDSL ER K+S ET+  ++   EQ +EDL   +     E+ +   R   +R  ++ LE E+ NL      +  EL   +  C  L+    + E  L   +R++ +   +L  ++ER      K LD     LV  + + R++    R+  ++LD+ ++ L+  + + +  I    HQL+ +      L    E+L+ T    RD +   E++L  +   L+  EKE   L K  D       E  ++ G L  D DR   E       N++L+  + +   E ++L+ + Q++++++   EDLL+ +E++  EL     +  IL E       R E    +L   + EL +  ++I  L+ R D LE  + +     R   S++S L   +   +E +   + E  +   DL   R+LC                      ++ A+ D ++ E ES     ELLQK       +++ +E++L S+R  E    +  Q++ +E+ +L D+L   + K     RE+ +LK R+  LE + E  +R LS E+FE++RA+ ELR   + ++SP
Sbjct:   56 LSETQANVKVLTAERDKTRMHYQQAQEEIAALRREVMKSKAARGAKSCSVTAQSILKRVETERDEAISDLNRMTTERDSLRERLKISQETSISERAHLEQTLEDLQAAVLTLEQERGEQKCRHAQMRENMMGLEEEVHNLSRKLSASEEELIRCRNECCSLRLSNNQMESSLSENQRRLTNRIGELQNAQER-----NKTLDEMNDSLVRQVTVLREELNTQRATISQLDQQRNTLQEQMEKKSDLINTANHQLDENEKTIRSLKLRAEDLETTLIALRDTISGKERELDVLKRKLSDSEKEMDTLMKVKD-------EASQENGQLRDDLDRAHQE-------NQTLKFKLDEANLEIEDLQKKVQDHIADISRTEDLLSAKERECRELQESRRKESILVESWEDQARRAETTVIEL---RLELHNANSEILRLKERADSLENRLQQALSAERSCTSQLSQLNRKMIHMEEDLCQARAEHTQAQADLEKTRELCV---------------------KLDASKDAVQRELESCCSEIELLQKQLTSERLSVQTLESLLVSTREKELQRQLTSQERQTEIEILKDKLSMADSKANSQSREMAQLKTRSCQLEADLEMTKRHLSTERFERERAVQELRRQGLSAISP 657          
BLAST of CEP135 vs. Ensembl Zebrafish
Match: tsga10 (testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-061013-482])

HSP 1 Score: 122.865 bits (307), Expect = 3.554e-28
Identity = 171/645 (26.51%), Postives = 311/645 (48.22%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGG--RANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILD-----LVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRI----HQLEHD------LVAAEEELQET----RDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTEL---LNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKE--ELLQKD-----ENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR---IHSLSP 2859
            + E Q++VK+LT E+D+    Y+++++EI  + +E++ ++   G    +  ++ +L RVE ERD   ++L R+  ERDSL ER K+S ET+  ++   EQ +EDL   +     E+ +   R   +R  ++ LE E+ NL      +  EL   +  C  L+    + E  L   +R++ +   +L  ++ER      K LD     LV  + + R++    R+  ++LD+ ++ L+  + + +  I    HQL+ +      L    E+L+ T    RD +   E++L  +   L+  EKE   L K  D       E  ++ G L  D DR   E       N++L+  + +   E ++L+ + Q++++++   EDLL+ +E++  EL     +  IL E       R E    +L   + EL +  ++I  L+ R D LE  + +     R   S++S L   +   +E +   + E  +   DL   R+LC                      ++ A+ D ++ E ES     ELLQK       +++ +E++L S+R  E    +  Q++ +E+ +L D+L   + K     RE+ +LK R+  LE + E  +R LS E+FE++RA+ ELR   + ++SP
Sbjct:   56 LSETQANVKVLTAERDKTRMHYQQAQEEIAALRREVMKSKAARGAKSCSVTAQSILKRVETERDEAISDLNRMTTERDSLRERLKISQETSISERAHLEQTLEDLQAAVLTLEQERGEQKCRHAQMRENMMGLEEEVHNLSRKLSASEEELIRCRNECCSLRLSNNQMESSLSENQRRLTNRIGELQNAQER-----NKTLDEMNDSLVRQVTVLREELNTQRATISQLDQQRNTLQEQMEKKSDLINTANHQLDENEKTIRSLKLRAEDLETTLIALRDTISGKERELDVLKRKLSDSEKEMDTLMKVKD-------EASQENGQLRDDLDRAHQE-------NQTLKFKLDEANLEIEDLQKKVQDHIADISRTEDLLSAKERECRELQESRRKESILVESWEDQARRAETTVIEL---RLELHNANSEILRLKERADSLENRLQQALSAERSCTSQLSQLNRKMIHMEEDLCQARAEHTQAQADLEKTRELCV---------------------KLDASKDAVQRELESCCSEIELLQKQLTSERLSVQTLESLLVSTREKELQRQLTSQERQTEIEILKDKLSMADSKANSQSREMAQLKTRSCQLEADLEMTKRHLSTERFERERAVQELRRQGLSAISP 657          
BLAST of CEP135 vs. Ensembl Xenopus
Match: CEP135 (centrosomal protein 135kDa [Source:NCBI gene;Acc:100145056])

HSP 1 Score: 187.963 bits (476), Expect = 5.849e-48
Identity = 169/620 (27.26%), Postives = 343/620 (55.32%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKL-----LNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK---QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            + EIQS+V++LT E+D+   +YE+++ E+  + +E+          +  SKKL     L ++E ERD   ++L RV +E + L  + K   ET  +++  F QK  +L N+I+    E+ ++   +  L+  I  LE E K           E    K   + L+   +QL+KS   LD  + ++   ++++  +++ +A  ++ I +L   +    D+   LR   + LD++KD L+  + +   RI  LE ++   E+ +   R  L   E  L ++ + +  +++E   LR+Q D   +++ E  +   I  ++N RL ++ + + R  +++  +++ ++ E++EL+++   Y++EV   E L+A +EQ+  +LL+QF+++   A  ++ + +  + + S+ + EL   + D  +L+ R   LE E+ E    ++  ES+IS +   I++ +EQ++  Q+E+  ++ DLS++R+LC +L+ +KE   +++  ++++ E+I   ++D+++E E +K++L  +   I+ +ET+L S+R  E    +   +K SE+ +L D+L  +E KL    RE   L+N+ + L+ + +  +R L+ E+FE++RA+ ELR H LS S
Sbjct:  525 MAEIQSNVRVLTAERDKIRILYEQAQNELVMLKKEI----------SPLSKKLSYQNELRQIEEERDLAISDLRRVTDENEGLRNKIKFQQETLTNEESQFAQKNSELENSIRMLEAERYELKSTVSKLKENIALLERESKINSTNLSHTLDESSQYKAEMNSLRHLNEQLQKS---LDDLQHRLTVKSSEVQFAQDEIAALQENIDELTSQISKQTDEMNVLRKTVSVLDKEKDSLQEAVDDKTERIACLEDNVANKEKTITNLRLTLSDLESSLDQLKDSVGNKDRELASLRRQLDSVQSELTENARLREISLKENRRLQDDLATMAREAQAVTLELETVMHEKEELKLRVHGYIAEVSRIESLMASKEQENRDLLDQFRLVHSQAEEWESKAQNAEGESSSVRLELLSVDTDRRHLRERAVHLENEIQEHMNAHQAYESQISSMAKTISKLEEQLRHEQNEKTAILADLSSVRELCVKLDSNKEHFSRQLTMRTMEHERILDELEDIKSEAELLKKQLASERLTIKNLETLLASNREKEFQSHLTTHEKDSEIQLLKDKLTLSESKLTSHSREATMLRNKVTQLQADYDVSKRQLTTERFERERAVQELRRHGLSTS 1131          

HSP 2 Score: 55.8398 bits (133), Expect = 4.464e-7
Identity = 38/159 (23.90%), Postives = 91/159 (57.23%), Query Frame = 1
Query:  262 LSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQES-------QNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNE 717
            L+L  +N  L  +L+ ++   + ++ +K+++L+  + E+ + +  + +++ E    E    KL + L+  +     + ++L++        ++L++ ++ +K RLS ++EK   TER LVLE+ER +      +S  + ++++ +++ +EE+RDY+K E
Sbjct:  307 LNLSTKNEELCKELTEIDHLAQQLERDKERVLVTADAEIEEAKSEITRLQHEMHVLESAISKLKSDLSTCEFEKNKLADELEKRADENLKLESLLNHVEHEKQRLSSKVEKQMVTERELVLEVERMRTQYGIMRSERSPSRLDSFVKSLEEERDYYKRE 465          
BLAST of CEP135 vs. Ensembl Xenopus
Match: CEP135 (centrosomal protein 135kDa [Source:NCBI gene;Acc:100145056])

HSP 1 Score: 177.178 bits (448), Expect = 1.482e-44
Identity = 171/630 (27.14%), Postives = 350/630 (55.56%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKL-----LNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKI--EDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK----------QQLKKSEMHLDSTERQVVSLTTQLNKSEERVA-LQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            + EIQS+V++LT E+D+   +YE+++ E+  + +E+          +  SKKL     L ++E ERD   ++L RV +E + L  + KV     NH  Y+   ++  ++  NT+  ++ +     ER E L+S +  L+  +  LE  ++ N + L +  +  SQ K          +QL+KS   LD  + ++   ++++  +++ +A LQE    ++   + +  D+   LR   + LD++KD L+  + +   RI  LE ++   E+ +   R  L   E  L ++ + +  +++E   LR+Q D   +++ E  +   I  ++N RL ++ + + R  +++  +++ ++ E++EL+++   Y++EV   E L+A +EQ+  +LL+QF+++   A  ++ + +  + + S+ + EL   + D  +L+ R   LE E+ E    ++  ES+IS +   I++ +EQ++  Q+E+  ++ DLS++R+LC +L+ +KE   +++  ++++ E+I   ++D+++E E +K++L  +   I+ +ET+L S+R  E    +   +K SE+ +L D+L  +E KL    RE   L+N+ + L+ + +  +R L+ E+FE++RA+ ELR H LS S
Sbjct:  485 MAEIQSNVRVLTAERDKIRILYEQAQNELVMLKKEI----------SPLSKKLSYQNELRQIEEERDLAISDLRRVTDENEGLRNKIKV-----NHFFYVLNAELCKQNSHNTMLLHQNQDPFTTERYE-LKSTVSKLKENIALLERESKINSTNLSHTLDESSQYKAEMNSLRHLNEQLQKS---LDDLQHRLTVKSSEVQFAQDEIAALQE----NIGKSIFMSTDEMNVLRKTVSVLDKEKDSLQEAVDDKTERIACLEDNVANKEKTITNLRLTLSDLESSLDQLKDSVGNKDRELASLRRQLDSVQSELTENARLREISLKENRRLQDDLATMAREAQAVTLELETVMHEKEELKLRVHGYIAEVSRIESLMASKEQENRDLLDQFRLVHSQAEEWESKAQNAEGESSSVRLELLSVDTDRRHLRERAVHLENEIQEHMNAHQAYESQISSMAKTISKLEEQLRHEQNEKTAILADLSSVRELCVKLDSNKEHFSRQLTMRTMEHERILDELEDIKSEAELLKKQLASERLTIKNLETLLASNREKEFQSHLTTHEKDSEIQLLKDKLTLSESKLTSHSREATMLRNKVTQLQADYDVSKRQLTTERFERERAVQELRRHGLSTS 1091          

HSP 2 Score: 51.6026 bits (122), Expect = 7.752e-6
Identity = 45/160 (28.12%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  262 LSLDHENFHLKNDLSSVERFNRSMKHEKDQILI--DVELELTK------MQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNE 717
            L+L  +N  L  +L+ ++   + ++ +K+++L+  D E+E  K       +KN    E+EK   E  N KL + L  ++H                     +K RLS ++EK   TER LVLE+ER +      +S  + ++++ +++ +EE+RDY+K E
Sbjct:  306 LNLSTKNEELCKELTEIDHLAQQLERDKERVLVTADAEIEEAKDLSTCEFEKNKLADELEKRADE--NLKLESLLNHVEH---------------------EKQRLSSKVEKQMVTERELVLEVERMRTQYGIMRSERSPSRLDSFVKSLEEERDYYKRE 442          
BLAST of CEP135 vs. Ensembl Xenopus
Match: tsga10 (testis specific 10 [Source:NCBI gene;Acc:100145206])

HSP 1 Score: 172.555 bits (436), Expect = 2.378e-43
Identity = 165/639 (25.82%), Postives = 347/639 (54.30%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDN----DRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIH-----------SLSPS-------YKPSC 2877
            + EIQ++VK+LT ++D+   +Y+ +++EI ++ +E L + +   +++  ++ +L RVE ERD   ++L R+  ERDSL ER K+S E A  D+   EQ+IE+  +TI+    E  ++  ++  ++  +  +ENELK L         EL  +K  C  L+    ++E  L+ T+R++ +  ++L  ++E++   E+K+ +        R++ + L+     L+++KD L  ++ +    I  LE  +   +  ++  RD L   E    + ++ L++ E+E  +LR+Q D  S+++ +  +      ++N    D+L+  K  IQ +N  L    +D   E ++++++ Q+  +E+   + L   +E++  +LL  ++  S  +  ++++    + + S+ K +L  +E++   L+ R++ LEKE+ +     +  +S++S+L   + + +E+++  + E+  ++EDL++ R+LC +L+ SKE + + +  ++ DIE+ +  ++   ++ E ++++L  +  +++ +E +L S++  E    +  QD  SE+ +L D+L   E KL    RE  +L+N+ +  E + E  +R LS E+FE++ A  ELR             SLSPS       ++PS 
Sbjct:  250 MAEIQANVKVLTSDRDKANMLYDRAQQEITQLRREFLRSPK-TPKSSVTAQAILQRVENERDIATSDLRRMTTERDSLRERLKISQENAISDRAHLEQRIEEYQSTIRIMENEHAELKSKLSLMKETLASVENELKILTSRTIDTEGELSRQKAECESLRLLNGETEHSLEETQRRLSAKNSELQIAQEKLIRLEEKLAEQSSHCFNLREEISFLKGTITELEKEKDSLIFSVDKKTENISTLEDSISVKDSTIKGLRDALSEIESSARQSAKTLSSHEQEISRLRRQLDDMSDELTKTGRDRESAFKENSSLHDQLSKSKLNIQTLNSKL----KDSQNEHEDIKLKLQSAKAEIVRLDSLNNSKEKEYRDLLENYRRASAQSESWENKFHQMESESSSAKLDLMGKESECRLLKERVESLEKEIEQYITSEQSHKSQMSNLAKSVTRVEEELRQAKAEKVTILEDLASTRELCVKLDTSKEVINRHLCARNQDIERFQDELESSRSDIELLRKQLASERISVKNLEALLVSNQEKEFQSQVHAQDLDSELQLLGDKLALAETKLGTQSREAAQLRNKLNQQEAQLEMTKRQLSTERFERELAAKELRRQTDYQATSTLRGSLSPSRLSPEYTFRPSV 883          
BLAST of CEP135 vs. Ensembl Xenopus
Match: tsga10 (testis specific 10 [Source:NCBI gene;Acc:100145206])

HSP 1 Score: 172.555 bits (436), Expect = 2.400e-43
Identity = 165/639 (25.82%), Postives = 347/639 (54.30%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDN----DRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIH-----------SLSPS-------YKPSC 2877
            + EIQ++VK+LT ++D+   +Y+ +++EI ++ +E L + +   +++  ++ +L RVE ERD   ++L R+  ERDSL ER K+S E A  D+   EQ+IE+  +TI+    E  ++  ++  ++  +  +ENELK L         EL  +K  C  L+    ++E  L+ T+R++ +  ++L  ++E++   E+K+ +        R++ + L+     L+++KD L  ++ +    I  LE  +   +  ++  RD L   E    + ++ L++ E+E  +LR+Q D  S+++ +  +      ++N    D+L+  K  IQ +N  L    +D   E ++++++ Q+  +E+   + L   +E++  +LL  ++  S  +  ++++    + + S+ K +L  +E++   L+ R++ LEKE+ +     +  +S++S+L   + + +E+++  + E+  ++EDL++ R+LC +L+ SKE + + +  ++ DIE+ +  ++   ++ E ++++L  +  +++ +E +L S++  E    +  QD  SE+ +L D+L   E KL    RE  +L+N+ +  E + E  +R LS E+FE++ A  ELR             SLSPS       ++PS 
Sbjct:  250 MAEIQANVKVLTSDRDKANMLYDRAQQEITQLRREFLRSPK-TPKSSVTAQAILQRVENERDIATSDLRRMTTERDSLRERLKISQENAISDRAHLEQRIEEYQSTIRIMENEHAELKSKLSLMKETLASVENELKILTSRTIDTEGELSRQKAECESLRLLNGETEHSLEETQRRLSAKNSELQIAQEKLIRLEEKLAEQSSHCFNLREEISFLKGTITELEKEKDSLIFSVDKKTENISTLEDSISVKDSTIKGLRDALSEIESSARQSAKTLSSHEQEISRLRRQLDDMSDELTKTGRDRESAFKENSSLHDQLSKSKLNIQTLNSKL----KDSQNEHEDIKLKLQSAKAEIVRLDSLNNSKEKEYRDLLENYRRASAQSESWENKFHQMESESSSAKLDLMGKESECRLLKERVESLEKEIEQYITSEQSHKSQMSNLAKSVTRVEEELRQAKAEKVTILEDLASTRELCVKLDTSKEVINRHLCARNQDIERFQDELESSRSDIELLRKQLASERISVKNLEALLVSNQEKEFQSQVHAQDLDSELQLLGDKLALAETKLGTQSREAAQLRNKLNQQEAQLEMTKRQLSTERFERELAAKELRRQTDYQATSTLRGSLSPSRLSPEYTFRPSV 883          
BLAST of CEP135 vs. Ensembl Xenopus
Match: CEP135 (centrosomal protein 135kDa [Source:NCBI gene;Acc:100145056])

HSP 1 Score: 172.555 bits (436), Expect = 3.990e-43
Identity = 169/629 (26.87%), Postives = 341/629 (54.21%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKL-----LNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK----------QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQ--IRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            + EIQS+V++LT E+D+   +YE+++ E+  + +E+          +  SKKL     L ++E ERD   ++L RV +E + L  + KV     NH  YL                      AER E L+S +  L+  +  LE  ++ N + L +  +  SQ K          +QL+KS   LD  + ++   ++++  +++ +A  ++ I +L   +    D+   LR   + LD++KD L+  + +   RI  LE ++   E+ +   R  L   E  L ++ + +  +++E   LR+Q D   +++ E  +   I  ++N RL ++ + + R  +++  +++ ++ E++EL+++   Y++EV   E L+A +EQ+  +LL+QF+++   A  ++ + +  + + S+ + EL   + D  +L+ R   LE E+ E    ++  ES+IS +   I++ +EQ++  Q+E+  ++ DLS++R+LC +L+ +KE   +++  ++++ E+  ++  ++D+++E E +K++L  +   I+ +ET+L S+R  E    +   +K SE+ +L D+L  +E KL    RE   L+N+ + L+ + +  +R L+ E+FE++RA+ ELR H LS S
Sbjct:  502 MAEIQSNVRVLTAERDKIRILYEQAQNELVMLKKEI----------SPLSKKLSYQNELRQIEEERDLAISDLRRVTDENEGLRNKIKV-----NHFFYL---------------------EAERYE-LKSTVSKLKENIALLERESKINSTNLSHTLDESSQYKAEMNSLRHLNEQLQKS---LDDLQHRLTVKSSEVQFAQDEIAALQENIDELTSQISKQTDEMNVLRKTVSVLDKEKDSLQEAVDDKTERIACLEDNVANKEKTITNLRLTLSDLESSLDQLKDSVGNKDRELASLRRQLDSVQSELTENARLREISLKENRRLQDDLATMAREAQAVTLELETVMHEKEELKLRVHGYIAEVSRIESLMASKEQENRDLLDQFRLVHSQAEEWESKAQNAEGESSSVRLELLSVDTDRRHLRERAVHLENEIQEHMNAHQAYESQISSMAKTISKLEEQLRHEQNEKTAILADLSSVRELCVKLDSNKEHFSRQLTMRTMEHERVSVKEQLEDIKSEAELLKKQLASERLTIKNLETLLASNREKEFQSHLTTHEKDSEIQLLKDKLTLSESKLTSHSREATMLRNKVTQLQADYDVSKRQLTTERFERERAVQELRRHGLSTS 1090          

HSP 2 Score: 51.9878 bits (123), Expect = 6.177e-6
Identity = 45/160 (28.12%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  262 LSLDHENFHLKNDLSSVERFNRSMKHEKDQILI--DVELELTK------MQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNE 717
            L+L  +N  L  +L+ ++   + ++ +K+++L+  D E+E  K       +KN    E+EK   E  N KL + L  ++H                     +K RLS ++EK   TER LVLE+ER +      +S  + ++++ +++ +EE+RDY+K E
Sbjct:  306 LNLSTKNEELCKELTEIDHLAQQLERDKERVLVTADAEIEEAKDLSTCEFEKNKLADELEKRADE--NLKLESLLNHVEH---------------------EKQRLSSKVEKQMVTERELVLEVERMRTQYGIMRSERSPSRLDSFVKSLEEERDYYKRE 442          
BLAST of CEP135 vs. Ensembl Mouse
Match: Tsga10 (testis specific 10 [Source:MGI Symbol;Acc:MGI:2685063])

HSP 1 Score: 189.889 bits (481), Expect = 8.219e-50
Identity = 170/634 (26.81%), Postives = 346/634 (54.57%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+LT E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L +  N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ +ND L  + +++++ N++L   + D   E  +++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + + +T K EL   E + + L+ ++D L +EV +     R  +S+I+ L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE +   +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        ++L P  KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLTSERDKTFLLYEQAQEEIARLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMANMTLMKETITTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGATLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKVKQENQALSKKLNDTHNELSDIKQKVQDTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENKARQTEAENNTLKLELITAEAEGNRLKEKVDALNREVEQHLNAERSYKSQIATLHKSLVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMMENELDSARSEIELLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYNLGP-MKPNTKCHSPERAHH 677          
BLAST of CEP135 vs. Ensembl Mouse
Match: Tsga10 (testis specific 10 [Source:MGI Symbol;Acc:MGI:2685063])

HSP 1 Score: 189.504 bits (480), Expect = 1.002e-49
Identity = 170/634 (26.81%), Postives = 346/634 (54.57%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+LT E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L +  N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ +ND L  + +++++ N++L   + D   E  +++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + + +T K EL   E + + L+ ++D L +EV +     R  +S+I+ L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE +   +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        ++L P  KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLTSERDKTFLLYEQAQEEIARLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMANMTLMKETITTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGATLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKVKQENQALSKKLNDTHNELSDIKQKVQDTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENKARQTEAENNTLKLELITAEAEGNRLKEKVDALNREVEQHLNAERSYKSQIATLHKSLVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMMENELDSARSEIELLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYNLGP-MKPNTKCHSPERAHH 677          
BLAST of CEP135 vs. Ensembl Mouse
Match: Cep135 (centrosomal protein 135 [Source:MGI Symbol;Acc:MGI:2681869])

HSP 1 Score: 186.808 bits (473), Expect = 1.149e-47
Identity = 161/614 (26.22%), Postives = 352/614 (57.33%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKK-LLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK---QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            +IQS+VKLLT E+D+   +Y+E+++E+  + +E           NS S   L++ VE E++   +EL R+  E+++L E+ K   E     K   E+ IE L+        EK ++  +M  ++  +  LEN+ K           +  ++K   + L+   +QL++S   LD  + ++     +L  ++E++ + EQK+ +L   + +  ++   ++     +D++KD L+ T+ E   +I  L+  L++ E+ + + +  +   E  L ++ E LTTR++E   LR+Q D +  ++++  K   I  ++N RL ++ + + R N+ +  +++  ++E++E++ +   Y++EV   E L+A +E++  +LL++FQ+L   A  ++ + +  + + S+ + EL   + +  +L+ R+D LEKE+ E    +   ES+IS +   ++Q +E+++  + E+  ++ D+S+LR+LC +L+  K+ + +++++KSL++E+  A ++++++E+E +K++L  + + I+ +E++L ++R+ E    +   +K +E+ +L ++L  +E KL    RE   L+ + + L+ + + ++R +SNEK+E++RA+ E+R   L  S
Sbjct:  521 DIQSNVKLLTAERDKLNVLYKEAKEELSTLRKE---------STNSTSPNHLVSCVEKEKERALSELRRITAEKEALREKLKNIQERNAVGKSDLEKTIEHLTYINHQLENEKYELQSKMLMMKETVESLENKSKLQAQKLSHVTGDSSHQKTEMTSLRIVSEQLQRS---LDDCQHRLSIKRGELESAQEQIKMLEQKLENLSHRMTVQSEETHAMKKTIGVMDKEKDFLQETVDEKTEKIANLQESLLSKEKVIAQLKVTVAEYETSLNQLQETLTTRDREINSLRRQLDASHKELDDVGKSREISFKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENKDLLDRFQMLHSRAEDWEVKAQQAEGENSSVRLELLSIDTERRHLRERVDLLEKEIQEHINAHHAYESQISSMAKAMSQLEEELRRHESEKATMLGDVSSLRELCIKLDSGKDVMTQQLNSKSLELERAVAELENVKSESELLKKQLTNERQTIKNLESLLATNRDKEFQSHLTSHEKDTEIQLLKEKLNLSESKLTTQSRETSMLRTKVTQLQTDYDNLKRQMSNEKYERERAIQEMRRLGLPTS 1122          

HSP 2 Score: 55.4546 bits (132), Expect = 3.749e-7
Identity = 59/223 (26.46%), Postives = 119/223 (53.36%), Query Frame = 1
Query:  133 LSYDNRGANN------LRKEIALLMEENDNLKHKIEEMDMKMSQERAIEL-SLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTK-------MIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLREL-QRKVNA 756
            LS + R   N      L  ++  L + N  L+  I+E+ M+  +    E+ +L + N  L  +L+ +++  + ++  K+Q+L   + EL + +K +++   E    E+   KL   L +L H  K       ++++DL+    ++ +L+ +K RLS++++    TER L LE+ER +      +  ++ ++++ +++GIEE+RDY+K E   L+ L QR+  A
Sbjct:  257 LSLETRNKTNEKLIAHLNVQVDFLQQANKELEKHIQEL-METKETVTTEVVNLSNRNEKLCQELTEIDQLAQRLERHKEQVLETADKELGEAKKEIKRNLCEMRNLEEKMSKLQWEL-DLSHKEKERLNSELLLKSDLE---TVVHQLEQEKQRLSKKLQSFAVTERELTLEVERMRLEHGIKRRDKSPSRLDTFLKGIEEERDYYKKELEKLQHLIQRRSCA 474          
BLAST of CEP135 vs. Ensembl Mouse
Match: Cep135 (centrosomal protein 135 [Source:MGI Symbol;Acc:MGI:2681869])

HSP 1 Score: 186.808 bits (473), Expect = 1.149e-47
Identity = 161/614 (26.22%), Postives = 352/614 (57.33%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKK-LLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK---QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            +IQS+VKLLT E+D+   +Y+E+++E+  + +E           NS S   L++ VE E++   +EL R+  E+++L E+ K   E     K   E+ IE L+        EK ++  +M  ++  +  LEN+ K           +  ++K   + L+   +QL++S   LD  + ++     +L  ++E++ + EQK+ +L   + +  ++   ++     +D++KD L+ T+ E   +I  L+  L++ E+ + + +  +   E  L ++ E LTTR++E   LR+Q D +  ++++  K   I  ++N RL ++ + + R N+ +  +++  ++E++E++ +   Y++EV   E L+A +E++  +LL++FQ+L   A  ++ + +  + + S+ + EL   + +  +L+ R+D LEKE+ E    +   ES+IS +   ++Q +E+++  + E+  ++ D+S+LR+LC +L+  K+ + +++++KSL++E+  A ++++++E+E +K++L  + + I+ +E++L ++R+ E    +   +K +E+ +L ++L  +E KL    RE   L+ + + L+ + + ++R +SNEK+E++RA+ E+R   L  S
Sbjct:  521 DIQSNVKLLTAERDKLNVLYKEAKEELSTLRKE---------STNSTSPNHLVSCVEKEKERALSELRRITAEKEALREKLKNIQERNAVGKSDLEKTIEHLTYINHQLENEKYELQSKMLMMKETVESLENKSKLQAQKLSHVTGDSSHQKTEMTSLRIVSEQLQRS---LDDCQHRLSIKRGELESAQEQIKMLEQKLENLSHRMTVQSEETHAMKKTIGVMDKEKDFLQETVDEKTEKIANLQESLLSKEKVIAQLKVTVAEYETSLNQLQETLTTRDREINSLRRQLDASHKELDDVGKSREISFKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENKDLLDRFQMLHSRAEDWEVKAQQAEGENSSVRLELLSIDTERRHLRERVDLLEKEIQEHINAHHAYESQISSMAKAMSQLEEELRRHESEKATMLGDVSSLRELCIKLDSGKDVMTQQLNSKSLELERAVAELENVKSESELLKKQLTNERQTIKNLESLLATNRDKEFQSHLTSHEKDTEIQLLKEKLNLSESKLTTQSRETSMLRTKVTQLQTDYDNLKRQMSNEKYERERAIQEMRRLGLPTS 1122          

HSP 2 Score: 55.4546 bits (132), Expect = 3.749e-7
Identity = 59/223 (26.46%), Postives = 119/223 (53.36%), Query Frame = 1
Query:  133 LSYDNRGANN------LRKEIALLMEENDNLKHKIEEMDMKMSQERAIEL-SLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTK-------MIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLREL-QRKVNA 756
            LS + R   N      L  ++  L + N  L+  I+E+ M+  +    E+ +L + N  L  +L+ +++  + ++  K+Q+L   + EL + +K +++   E    E+   KL   L +L H  K       ++++DL+    ++ +L+ +K RLS++++    TER L LE+ER +      +  ++ ++++ +++GIEE+RDY+K E   L+ L QR+  A
Sbjct:  257 LSLETRNKTNEKLIAHLNVQVDFLQQANKELEKHIQEL-METKETVTTEVVNLSNRNEKLCQELTEIDQLAQRLERHKEQVLETADKELGEAKKEIKRNLCEMRNLEEKMSKLQWEL-DLSHKEKERLNSELLLKSDLE---TVVHQLEQEKQRLSKKLQSFAVTERELTLEVERMRLEHGIKRRDKSPSRLDTFLKGIEEERDYYKKELEKLQHLIQRRSCA 474          
BLAST of CEP135 vs. Ensembl Mouse
Match: Tsga10 (testis specific 10 [Source:MGI Symbol;Acc:MGI:2685063])

HSP 1 Score: 131.339 bits (329), Expect = 5.510e-31
Identity = 111/422 (26.30%), Postives = 228/422 (54.03%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEV 2292
            + EIQ +VK+LT E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L +  N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ +ND L  + +++++ N++L   + D   E  +++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + + +T K EL   E + + L+ ++D L +EV
Sbjct:   47 LAEIQGNVKVLTSERDKTFLLYEQAQEEIARLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMANMTLMKETITTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGATLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKVKQENQALSKKLNDTHNELSDIKQKVQDTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENKARQTEAENNTLKLELITAEAEGNRLKEKVDALNREV 466          

HSP 2 Score: 56.9954 bits (136), Expect = 1.065e-7
Identity = 41/150 (27.33%), Postives = 83/150 (55.33%), Query Frame = 1
Query: 2479 IDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            +D  + ++EQ+   +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        ++L P  KP+  C+    A H
Sbjct:  459 VDALNREVEQMENELDSARSEIELLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYNLGP-MKPNTKCHSPERAHH 607          
BLAST of CEP135 vs. UniProt
Match: sp|Q9BZW7|TSG10_HUMAN (Testis-specific gene 10 protein OS=Homo sapiens OX=9606 GN=TSGA10 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.499e-49
Identity = 171/634 (26.97%), Postives = 343/634 (54.10%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+L  E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L    N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ DND L  + ++ ++ N++L   + D   E ++++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + D +T K EL   E + + L+ ++D L +EV +     R  +S+IS L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE     +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        + +S + KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHH 678          
BLAST of CEP135 vs. UniProt
Match: sp|Q5RG45|CP135_DANRE (Centrosomal protein of 135 kDa OS=Danio rerio OX=7955 GN=cep135 PE=3 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 1.710e-49
Identity = 171/606 (28.22%), Postives = 337/606 (55.61%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQIL---SEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ+ VKLLT E+D+     +++++E+ R+ +EL            +S +L  R+  +R+  + EL RV  ERD+L +R KV+  TA  D+   E +  DL NTI+    EK D+  ++  L+   + +E ELK       QN  E   ++   S L+   ++ E  L   + ++   T +L  + +++   E+KI DL       +D+   L++    LD +KD L+  + +    +  L+ ++   EE L E R  +   E  L ++  +L++RE+E   LR+Q D +  ++    +   +  R+N RL ++ + + R N+++  ++Q+ + ERDEL+++  +Y+SEV   E L+A +EQ+  ++L +F+ +   SED  L   +L+  +   ++ + EL   + +  +L+ R+   ++E+ E     +  E+++S L   +++ +E+V+  + E+  ++ DL+++R+LC +L+ SKE   +++ +KS+++E++   ++D+ +E E +K++L  +   +R +ET+L ++R  E    I   +K SE+ VL DRL   + K     REV +L+ + S L+ E + ++R L+ E+FE++RA+ E+R
Sbjct:  530 DIQTRVKLLTAERDQLSSQCQQAQEELRRVQREL------------ESSELQRRIRDDREQTEAELQRVTAERDALRDRLKVAHSTALTDREQEEFRFLDLENTIEKLEREKADLRAQVTVLKESRVVVEKELKAQSAVLLQNVEEATQQRVESSALRLLQEQMEQSLSDVQHRLSVKTNELQAAHQQIDKLEEKIADLSRHGSSQKDEVVILQNTIASLDREKDTLQDAVDQKTESVVLLQQEVHRKEETLLEVRLTVTDLENSLNQLQAVLSSREREIASLRRQLDQSQEELFSVSRDREVALRENRRLQDDLATMTRENQAVHAEMQEALNERDELKLRVHSYISEVARIESLMAAKEQENRDMLERFRSIHTESEDKEL---KLQQSEGLNNSIRLELLSSDTERRHLRERVSLQDREIQEHLNALQAYEAQVSSLARAMSRLEEEVQAARAEKASVLADLASVRELCVKLDSSKELTVRQLTSKSMELERVTGELEDVRSEMELLKKQLGSERLTVRNLETLLSTNRQKEFQTHISASEKESELKVLKDRLALADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQLTTERFERERAVQEMR 1120          
BLAST of CEP135 vs. UniProt
Match: sp|Q6NY15|TSG10_MOUSE (Testis-specific gene 10 protein OS=Mus musculus OX=10090 GN=Tsga10 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 5.749e-49
Identity = 170/634 (26.81%), Postives = 346/634 (54.57%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR-------IHSLSPSYKPS--CYLSNGAAH 2901
            + EIQ +VK+LT E+D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+  ERDSL ER K++ ETA ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L +  N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ +ND L  + +++++ N++L   + D   E  +++ + Q+   EV   +++L   E +  +++ Q +  +EDA  ++++    + + +T K EL   E + + L+ ++D L +EV +     R  +S+I+ L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE +   +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR        ++L P  KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLTSERDKTFLLYEQAQEEIARLRREMMKSCKSPKSTTAHA--ILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMANMTLMKETITTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGATLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKVKQENQALSKKLNDTHNELSDIKQKVQDTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENKARQTEAENNTLKLELITAEAEGNRLKEKVDALNREVEQHLNAERSYKSQIATLHKSLVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMMENELDSARSEIELLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYNLGP-MKPNTKCHSPERAHH 677          
BLAST of CEP135 vs. UniProt
Match: sp|Q6P5D4|CP135_MOUSE (Centrosomal protein of 135 kDa OS=Mus musculus OX=10090 GN=Cep135 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.035e-47
Identity = 161/614 (26.22%), Postives = 352/614 (57.33%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKK-LLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLK---QQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPS 2862
            +IQS+VKLLT E+D+   +Y+E+++E+  + +E           NS S   L++ VE E++   +EL R+  E+++L E+ K   E     K   E+ IE L+        EK ++  +M  ++  +  LEN+ K           +  ++K   + L+   +QL++S   LD  + ++     +L  ++E++ + EQK+ +L   + +  ++   ++     +D++KD L+ T+ E   +I  L+  L++ E+ + + +  +   E  L ++ E LTTR++E   LR+Q D +  ++++  K   I  ++N RL ++ + + R N+ +  +++  ++E++E++ +   Y++EV   E L+A +E++  +LL++FQ+L   A  ++ + +  + + S+ + EL   + +  +L+ R+D LEKE+ E    +   ES+IS +   ++Q +E+++  + E+  ++ D+S+LR+LC +L+  K+ + +++++KSL++E+  A ++++++E+E +K++L  + + I+ +E++L ++R+ E    +   +K +E+ +L ++L  +E KL    RE   L+ + + L+ + + ++R +SNEK+E++RA+ E+R   L  S
Sbjct:  521 DIQSNVKLLTAERDKLNVLYKEAKEELSTLRKE---------STNSTSPNHLVSCVEKEKERALSELRRITAEKEALREKLKNIQERNAVGKSDLEKTIEHLTYINHQLENEKYELQSKMLMMKETVESLENKSKLQAQKLSHVTGDSSHQKTEMTSLRIVSEQLQRS---LDDCQHRLSIKRGELESAQEQIKMLEQKLENLSHRMTVQSEETHAMKKTIGVMDKEKDFLQETVDEKTEKIANLQESLLSKEKVIAQLKVTVAEYETSLNQLQETLTTRDREINSLRRQLDASHKELDDVGKSREISFKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENKDLLDRFQMLHSRAEDWEVKAQQAEGENSSVRLELLSIDTERRHLRERVDLLEKEIQEHINAHHAYESQISSMAKAMSQLEEELRRHESEKATMLGDVSSLRELCIKLDSGKDVMTQQLNSKSLELERAVAELENVKSESELLKKQLTNERQTIKNLESLLATNRDKEFQSHLTSHEKDTEIQLLKEKLNLSESKLTTQSRETSMLRTKVTQLQTDYDNLKRQMSNEKYERERAIQEMRRLGLPTS 1122          

HSP 2 Score: 55.4546 bits (132), Expect = 2.622e-6
Identity = 59/223 (26.46%), Postives = 119/223 (53.36%), Query Frame = 1
Query:  133 LSYDNRGANN------LRKEIALLMEENDNLKHKIEEMDMKMSQERAIEL-SLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTK-------MIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLREL-QRKVNA 756
            LS + R   N      L  ++  L + N  L+  I+E+ M+  +    E+ +L + N  L  +L+ +++  + ++  K+Q+L   + EL + +K +++   E    E+   KL   L +L H  K       ++++DL+    ++ +L+ +K RLS++++    TER L LE+ER +      +  ++ ++++ +++GIEE+RDY+K E   L+ L QR+  A
Sbjct:  257 LSLETRNKTNEKLIAHLNVQVDFLQQANKELEKHIQEL-METKETVTTEVVNLSNRNEKLCQELTEIDQLAQRLERHKEQVLETADKELGEAKKEIKRNLCEMRNLEEKMSKLQWEL-DLSHKEKERLNSELLLKSDLE---TVVHQLEQEKQRLSKKLQSFAVTERELTLEVERMRLEHGIKRRDKSPSRLDTFLKGIEEERDYYKKELEKLQHLIQRRSCA 474          
BLAST of CEP135 vs. UniProt
Match: sp|Q9Z220|TSG10_RAT (Testis-specific gene 10 protein OS=Rattus norvegicus OX=10116 GN=Tsga10 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 7.803e-41
Identity = 167/650 (25.69%), Postives = 340/650 (52.31%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTE-----------------LLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSP------SYKPS--CYLSNGAAH 2901
            + EIQ +VK+LT  +D+   +YE++++EI R+ +E++ + +      + +  +L RVE ERD    +L R+   RDSL ER K++   A ++K   EQ+IE+L  T+ N   E+ +    M  ++  I  +E E+K+L   A    SEL  +K   + L+   + +E  L  T+R +     +L  ++E++   ++KI +        R++ + L +  N L ++K+ L+  L + +  I  L   L   E+ +   ++ +   EQ   + +E L   E++  ++R+Q D  ++++ +  ++  IL+ +ND L  + +++++ N++L   + D   E  +++ + Q+   EV   +++L   E    E                 ++ Q +  +EDA  ++++    + + +T K EL   E + + L+ ++D L +EV +     R  +S+I+ L   + + +E+++ +Q E+   + DLS+ R+LC +L+ SKE L +++  K  +IE +   +D   +E E ++ ++  +  +++ +E +L ++R+ E    I +Q+K SE+ +L + L   E K+ +  R+V + +N  + LE + +  +R L  E+FE++RA+ ELR  + S       S KP+  C+    A H
Sbjct:   47 LAEIQGNVKVLTSVRDKTFLLYEQAQEEIARLRREMMKSCQSPKSTTAHA--ILRRVETERDVAFTDLRRMTTARDSLRERLKIA--QAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETITIVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGATLNDLAKEKECLQTCLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKVKQENQALSKKLNDTHNELSDIKQKVQDTNLEVNKLKNILKSEESTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENKARQLEAENNTLKLELITAEAEGNRLKEKVDALNREVEQHLNAERSYKSQIATLHKSLVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMMENELDSARSEIELLRSQMTNERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHLGSMKPNTKCHSPERAHH 692          
BLAST of CEP135 vs. TrEMBL
Match: gnl|BL_ORD_ID|20301680 (tr|A0A481MTH8|A0A481MTH8_SCHMD CEP135 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1654.42 bits (4283), Expect = 0.000e+0
Identity = 925/927 (99.78%), Postives = 926/927 (99.89%), Query Frame = 1
Query:  121 MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNXXXXXXXXXXXXXXXXXXXXXXXXXXXIESLRQEKXXXXXXXXXXXXXXXXXXXNKTLKKSDEDIVQIXXXXXXXXXXXXXXXXXVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH 2901
            MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKN+RQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNSPSKSPKKQLSKEKKELEREKEDLKQKIESLRQEKNSSPVRNRSPSPTLRSRSPNKTLKKSDEDIVQIRRERDDLRNLLNKLEKRVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKE CSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGRLERSKEELEKEIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH
Sbjct:    1 MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNVRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNSPSKSPKKQLSKEKKELEREKEDLKQKIESLRQEKNSSPVRNRSPSPTLRSRSPNKTLKKSDEDIVQIRRERDDLRNLLNKLEKRVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKERCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGRLERSKEELEKEIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH 927          
BLAST of CEP135 vs. TrEMBL
Match: gnl|BL_ORD_ID|18270635 (tr|A0A267GQE4|A0A267GQE4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021784g1 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 4.982e-86
Identity = 204/605 (33.72%), Postives = 373/605 (61.65%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            + EIQ +V++LTQE+D+  ++ +++  E+HR  +ELL +     + +  ++ +L RVE ERD    +L R+  ERDSL ER KV+ ETA  DK   EQ+IEDL N  +   TE+ D+  R   LR R  +LE++ K L+ G  +   EL N++   +Q +       M  ++ +R    L   L ++++   L + + + L  +++  RDD A++R+    LD +KD L+G L E   R   LE +L A E +  + R  L  AE QLGR  + L  REKE RQ RK  +   N +   ++++  L R+  RL ++   + R N SLQ ++Q+ ++ER++ + + Q+YV+EV+  E+LL+Q+E+++++LL Q+++L+ ++  Y+      + D S+ + EL+ ++ D   L+ ++++ E ++ + +      E ++++L   ++  ++ ++  Q ER+E+++DLSALRDLC +LE SK++ ++++ +K+LD +Q+   +DDL++EN+ ++E+LL + +  + +ET+L +SR  E    ++ Q++ +E+++L +RL+  E KL+   RE+ +L++R+S+LE E ER+ R LS+E+FE++R  SELR
Sbjct:  348 MAEIQGNVRVLTQERDQLSRLLDDTNDELHRARRELLASPSQP-KVSLAAQAVLKRVETERDDALADLRRMMTERDSLRERLKVATETALSDKARLEQRIEDLQNAARKTATERDDLGTRSAQLRQRCQELEDQTKQLQRGLAERTEELSNERAISNQQR-------MQAEAAQRTGRQLEADLLQAQDAANLLQDRCITLEREIKALRDDQAQMRTAMANLDYEKDSLEGVLRERTDRARALEDELKAKEAQAGDLRTQLHHAEYQLGRAQDQLAAREKELRQSRKSGEATQNDLAAEKRRVEALQREVARLQDDLQALARDNSSLQAELQETVQEREQFKHKAQDYVAEVRRVEELLSQKERERSDLLEQYRLLTAESDKYQAEAHQLESDASSLRLELSAKDADCKRLREKLEQAESDLQDNRRSINSYELQVANLSRSVSDLEDSLRQQQCEREEVLKDLSALRDLCAKLESSKDQAQRQLTSKALDADQLAGQLDDLQHENDLLREQLLAEQDAKKSLETVLSASREKEFQTQLDSQERHAELSMLRERLELGETKLEQQGRELTRLRSRSSELESEVERLTRQLSSERFERERLASELR 944          

HSP 2 Score: 90.8929 bits (224), Expect = 9.953e-15
Identity = 75/217 (34.56%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  172 EIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNR--SMKHEKDQILIDVELELTKMQKNLRQMEIEKETS-----EQNNFKLSNSL--TELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKR------HSKSGK--SRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            +I  L   N  L+  +  +  ++  ER  E+ LD  N  L  +L +V++  +    +  +     D E+    M+++  Q       S     +Q+  KL +SL  T+ Q ++  ++N  ++ Q LI++ Q DK RL+QRIEKLTA ER LVLEIER +R       +  GK  S  T +++EQY++GIEEDRDYWK+EA    EL + +    V N
Sbjct:   25 QIDALNRRNHELERTLAGLQHRLGVERRAEIDLDLANQRLSGELETVDKLAQRLEAEKAEALKAADAEIANANMERDRAQQRAAAAESRCTQLDQDRKKLQDSLNDTKKQAASSTMDN--RQLQELIAQQQADKKRLTQRIEKLTANERELVLEIERLRRKGSGANGTTGGKKASAATTSKIEQYLKGIEEDRDYWKHEAE---ELNKMLRTPAVLN 236          
BLAST of CEP135 vs. TrEMBL
Match: gnl|BL_ORD_ID|18274733 (tr|A0A1I8I410|A0A1I8I410_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 8.295e-86
Identity = 204/605 (33.72%), Postives = 373/605 (61.65%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            + EIQ +V++LTQE+D+  ++ +++  E+HR  +ELL +     + +  ++ +L RVE ERD    +L R+  ERDSL ER KV+ ETA  DK   EQ+IEDL N  +   TE+ D+  R   LR R  +LE++ K L+ G  +   EL N++   +Q +       M  ++ +R    L   L ++++   L + + + L  +++  RDD A++R+    LD +KD L+G L E   R   LE +L A E +  + R  L  AE QLGR  + L  REKE RQ RK  +   N +   ++++  L R+  RL ++   + R N SLQ ++Q+ ++ER++ + + Q+YV+EV+  E+LL+Q+E+++++LL Q+++L+ ++  Y+      + D S+ + EL+ ++ D   L+ ++++ E ++ + +      E ++++L   ++  ++ ++  Q ER+E+++DLSALRDLC +LE SK++ ++++ +K+LD +Q+   +DDL++EN+ ++E+LL + +  + +ET+L +SR  E    ++ Q++ +E+++L +RL+  E KL+   RE+ +L++R+S+LE E ER+ R LS+E+FE++R  SELR
Sbjct:  345 MAEIQGNVRVLTQERDQLSRLLDDTNDELHRARRELLASPSQP-KVSLAAQAVLKRVETERDDALADLRRMMTERDSLRERLKVATETALSDKARLEQRIEDLQNAARKTATERDDLGTRSAQLRQRCQELEDQTKQLQRGLAERTEELSNERAISNQQR-------MQAEAAQRTGRQLEADLLQAQDAANLLQDRCITLEREIKALRDDQAQMRTAMANLDYEKDSLEGVLRERTDRARALEDELKAKEAQAGDLRTQLHHAEYQLGRAQDQLAAREKELRQSRKSGEATQNDLAAEKRRVEALQREVARLQDDLQALARDNSSLQAELQETVQEREQFKHKAQDYVAEVRRVEELLSQKERERSDLLEQYRLLTAESDKYQAEAHQLESDASSLRLELSAKDADCKRLREKLEQAESDLQDNRRSINSYELQVANLSRSVSDLEDSLRQQQCEREEVLKDLSALRDLCAKLESSKDQAQRQLTSKALDADQLAGQLDDLQHENDLLREQLLAEQDAKKSLETVLSASREKEFQTQLDSQERHAELSMLRERLELGETKLEQQGRELTRLRSRSSELESEVERLTRQLSSERFERERLASELR 941          

HSP 2 Score: 90.8929 bits (224), Expect = 1.072e-14
Identity = 75/217 (34.56%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  172 EIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNR--SMKHEKDQILIDVELELTKMQKNLRQMEIEKETS-----EQNNFKLSNSL--TELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKR------HSKSGK--SRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            +I  L   N  L+  +  +  ++  ER  E+ LD  N  L  +L +V++  +    +  +     D E+    M+++  Q       S     +Q+  KL +SL  T+ Q ++  ++N  ++ Q LI++ Q DK RL+QRIEKLTA ER LVLEIER +R       +  GK  S  T +++EQY++GIEEDRDYWK+EA    EL + +    V N
Sbjct:   25 QIDALNRRNHELERTLAGLQHRLGVERRAEIDLDLANQRLSGELETVDKLAQRLEAEKAEALKAADAEIANANMERDRAQQRAAAAESRCTQLDQDRKKLQDSLNDTKKQAASSTMDN--RQLQELIAQQQADKKRLTQRIEKLTANERELVLEIERLRRKGSGANGTTGGKKASAATTSKIEQYLKGIEEDRDYWKHEAE---ELNKMLRTPAVLN 236          
BLAST of CEP135 vs. TrEMBL
Match: gnl|BL_ORD_ID|18260260 (tr|A0A267G3Z8|A0A267G3Z8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008019g1 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 6.103e-83
Identity = 204/605 (33.72%), Postives = 369/605 (60.99%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            + EIQ +V++LTQE+D+  ++ +++  E+HR  +ELL +     + +  ++ +L RVE ERD    +L R+  ERDSL ER KV+ ETA  DK   EQ+IEDL N  +   TE+ D+  R   LR R  +LE++ K L+ G  +   EL N++   +Q +       M  ++ +R    L   L ++++   L + + + L  +++  RDD  ++R+    LD +KD L+G L E   R   LE +L A E +  + R  L  AE QLGR  + L  REKE RQ RK  +   N +   ++++  L R+  RL ++   + R N SLQ ++Q+ ++ER++ + + Q+YV+EV+  E+LL+Q+E+++++LL Q+++L+ ++  Y+      + D S+ + EL+ ++ D   L  R  + E ++ + +      E ++++L   ++  ++ ++  Q ER+E+++DLSALRDLC +LE SK++ ++++ +K+LD +Q+   +DDL++EN+ ++E+LL + +  + +ET+L +SR  E    ++ Q++ +E+++L +RL+  E KL+   RE+ +L++R+S+LE E ER+ R LS+E+FE++R  SELR
Sbjct:  348 MAEIQGNVRVLTQERDQLSRLLDDTNDELHRARRELLASPSQP-KVSLAAQAVLKRVETERDDALADLRRMMTERDSLRERLKVATETALSDKARLEQRIEDLQNAARKTATERDDLGTRSAQLRQRCQELEDQTKQLQRGLAERTEELSNERAISNQQR-------MQAEAAQRTGRQLEADLLQAQDAANLLQDRCITLEREIKALRDDQVQMRTAMANLDYEKDSLEGVLRERTDRARALEDELKAKEAQAGDLRTQLHHAEYQLGRAQDQLAAREKELRQSRKSGEATQNDLAAEKRRVEALQREVARLQDDLQALARDNSSLQAELQETVQEREQFKHKAQDYVAEVRRVEELLSQKERERSDLLEQYRLLTAESDKYQAEAHQLESDASSLRLELSAKDADCKRL--REKQAESDLQDNRRSINSYELQVANLSRSVSDLEDSLRQQQCEREEVLKDLSALRDLCAKLESSKDQAQRQLTSKALDADQLAGQLDDLQHENDLLREQLLAEQDAKKSLETVLSASREKEFQTQLDSQERHAELSMLRERLELGETKLEQQGRELTRLRSRSSELESEVERLTRQLSSERFERERLASELR 942          

HSP 2 Score: 90.8929 bits (224), Expect = 1.073e-14
Identity = 75/217 (34.56%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  172 EIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNR--SMKHEKDQILIDVELELTKMQKNLRQMEIEKETS-----EQNNFKLSNSL--TELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKR------HSKSGK--SRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            +I  L   N  L+  +  +  ++  ER  E+ LD  N  L  +L +V++  +    +  +     D E+    M+++  Q       S     +Q+  KL +SL  T+ Q ++  ++N  ++ Q LI++ Q DK RL+QRIEKLTA ER LVLEIER +R       +  GK  S  T +++EQY++GIEEDRDYWK+EA    EL + +    V N
Sbjct:   25 QIDALNRRNHELERTLAGLQHRLGVERRAEIDLDLANQRLSGELETVDKLAQRLEAEKAEALKAADAEIANANMERDRAQQRAAAAESRCTQLDQDRKKLQDSLNDTKKQAASSTMDN--RQLQELIAQQQADKKRLTQRIEKLTANERELVLEIERLRRKGSGANGTTGGKKASAATTSKIEQYLKGIEEDRDYWKHEAE---ELNKMLRTPAVLN 236          
BLAST of CEP135 vs. TrEMBL
Match: gnl|BL_ORD_ID|18227869 (tr|A0A1I8H6A7|A0A1I8H6A7_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.556e-82
Identity = 203/605 (33.55%), Postives = 367/605 (60.66%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            + EIQ +V++LTQE+D+  ++ +++  E+HR  +ELL +     + +  ++ +L RVE ERD    +L R+  ERDSL ER KV+ ETA  DK   EQ+IEDL N  +   TE+ D+  R   LR R  +LE++ K L+ G  +   EL N++   +Q +       M  ++ +R    L   L ++++   L + + + L  +++  RDD A++R+    LD +KD L+G L E   R   LE +L A E +  + R  L  AE QLGR  + L  REKE RQ RK  +   N +   ++++  L R+  RL ++   + R N SLQ        ER++ + + Q+YV+EV+  E+LL+Q+E+++++LL Q+++L+ ++  Y+      + D S+ + EL+ ++ D   L+ ++++ E ++ + +      E ++++L   ++  ++ ++  Q ER+E+++DLSALRDLC +LE SK++ ++++ +K+LD +Q+   +DDL++EN+ ++E+LL + +  + +ET+L +SR  E    ++ Q++ +E+++L +RL+  E KL+   RE+ +L++R+S+LE E ER+ R LS+E+FE++R  SELR
Sbjct:  238 MAEIQGNVRVLTQERDQLSRLLDDTNDELHRARRELLASPSQP-KVSLAAQAVLKRVETERDDALADLRRMMTERDSLRERLKVATETALSDKARLEQRIEDLQNAARKTATERDDLGTRSAQLRQRCQELEDQTKQLQRGLAERTEELSNERAISNQQR-------MQAEAAQRTGRQLEADLLQAQDAANLLQDRCITLEREIKALRDDQAQMRTAMANLDYEKDSLEGVLRERTDRARALEDELKAKEAQAGDLRTQLHHAEYQLGRAQDQLAAREKELRQSRKSGEATQNDLAAEKRRVEALQREVARLQDDLQALARDNSSLQ--------EREQFKHKAQDYVAEVRRVEELLSQKERERSDLLEQYRLLTAESDKYQAEAHQLESDASSLRLELSAKDADCKRLREKLEQAESDLQDNRRSINSYELQVANLSRSVSDLEDSLRQQQCEREEVLKDLSALRDLCAKLESSKDQAQRQLTSKALDADQLAGQLDDLQHENDLLREQLLAEQDAKKSLETVLSASREKEFQTQLDSQERHAELSMLRERLELGETKLEQQGRELTRLRSRSSELESEVERLTRQLSSERFERERLASELR 826          

HSP 2 Score: 86.2705 bits (212), Expect = 2.879e-13
Identity = 56/119 (47.06%), Postives = 77/119 (64.71%), Query Frame = 1
Query:  445 KLSNSL--TELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKR------HSKSGK--SRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            KL +SL  T+ Q ++  ++N  ++ Q LI++ Q DK RL+QRIEKLTA ER LVLEIER +R       +  GK  S  T +++EQY++GIEEDRDYWK+EA    EL + +    V N
Sbjct:   16 KLQDSLNDTKKQAASSTMDN--RQLQELIAQQQADKKRLTQRIEKLTANERELVLEIERLRRKGSGANGTTGGKKASAATTSKIEQYLKGIEEDRDYWKHEAE---ELNKMLRTPAVLN 129          
BLAST of CEP135 vs. Ensembl Cavefish
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:103038838])

HSP 1 Score: 195.282 bits (495), Expect = 1.980e-50
Identity = 167/603 (27.69%), Postives = 328/603 (54.39%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ+ VKLLT EKD+    Y+++++E+  + +EL+ + E   R              ER+    EL +V  ERD+L ER KV+  +A  D+   E +I DL NT++    E+ D+  ++  L+   +  E ELK       QN  E   ++   S L+   ++ E  L   + ++   T ++  + +++   E+KI +L        D+ A L S    LD +KD L+  + +    +  L+  L   E  L E R  +   E+ L ++  +L +RE+E   LR+Q D +  ++    +   I  R+N RL ++ + + R N+++  ++++ + ERDEL+++  +Y+SEV   E ++A +EQ+  E+L +F++   D    + +L+  +   ++ K EL   + +  +L+ R+   ++E+ E     +  E++IS L   +++ +E+++  + E+  ++ DLS++R+LC +L+ SKE   +++  KS+++E++   ++D+ +E E +K++L  +   +R +ET+L ++R  E    +   ++ SE+ VL DRL   + K     REV +L+ + S L+ E + ++R L+ E+FE++RA+ E+R
Sbjct:  530 DIQTKVKLLTAEKDQLSAQYQQAQEELKGVRRELMFSPERQQRGRE-----------EREQTDAELHKVTAERDALRERLKVAQTSALTDREQEEMRILDLENTVQTLERERADLRTQVAVLKESRVTFEEELKARSAALLQNAEETVQQRAENSALRLLQEQMEKSLAEIQHRLSVKTNEIQVAHQQIDKLEEKITELSRHGSSQNDEVAALHSAIASLDHEKDALQEIVDQKTESMVLLQDQLQVKERTLTEVRLTITEMEKSLDQLKGVLGSREREIASLRRQLDQSQEEMSSVNRDREIALRENRRLQDDLATMTRENQAVHAEMEEALRERDELKMRVHSYISEVAKIEKMMAAKEQENREMLERFRMAHSDVEERELKLQQAEGLNNSIKLELLSSDTERRHLRERVSLQDQEIQEHMNALQAYEAQISTLARTMSRLEEELQKARAEKVTVLADLSSVRELCVKLDSSKELTARQLTAKSMELERVTGELEDVRSETELLKKQLASEKVTVRNLETLLSTNRQKEFQSHLNASERESELKVLKDRLALADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQLTTERFERERAVQEMR 1121          

HSP 2 Score: 63.929 bits (154), Expect = 7.826e-10
Identity = 50/206 (24.27%), Postives = 115/206 (55.83%), Query Frame = 1
Query:  172 EIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQ-------NLISRLQDDKLRLSQRIEKLTATERALVLEIERHK-RHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPV 765
            +I  L E N  L+ K+E +  + +   +    L   N  L ++L+ +++  + ++ +K+++L   ++EL + +K ++++  + E  E+   KL   + E  H    + + L E Q        L++ L+++K RL  ++EK+T  ++ ++LE+ER + RH   GK R + ++++ +++ +E++RD+++ EA   R+ +   + SP+
Sbjct:  277 QIEYLQETNRALEQKVEGLQQRKNTVSSEVADLSARNQELCHELTQIDQLAQQLEKDKEKVLETADMELQEAKKEIQRLHRQMEDLEEVISKLRREMAEEDHEKDRVRDQLAEVQEQNEKMEGLLNFLEEEKRRLQDKVEKMTQADKEMILELERMRVRHGMCGKER-SPSRLDAFVKSLEDERDHYRQEAERYRKTRGGSDRSPI 481          
BLAST of CEP135 vs. Ensembl Cavefish
Match: tsga10 (testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-061013-482])

HSP 1 Score: 134.42 bits (337), Expect = 6.395e-32
Identity = 159/644 (24.69%), Postives = 322/644 (50.00%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANS-QSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLG-----------RVSEILTTREKENRQLRKQNDHNSNQVEEF----QKKIGI-------------LSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLN-QFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYK 2868
            + E+Q+++++LT ++D+   +Y +++ +I  + + ++  +   G  NS  ++ +L R+E ERD    +L R+  ERDSL ER ++S ETA  ++   EQ +EDL N + +   E+ +   R   +R  ++ LE E+  L      +  EL   K  CS L+     +E  L  T+R++ S   +L  +     L++ K LD  +D+         L+ E + L E+   L+ T++E       L+    + +++L++  D L  A +QL            R+ ++ TT E  +  LR   +   N+  +     +K +GI             L R+N +L +E    +  N+SL+  ++  ++E ++L+ + +NYV+++   EDLL+ +E++  EL   ++++ ++  +   H     + +++  + +L   +++   L+  +  LE  + E     R   + ++ L       KE+++  + ER ++  DL   R+LC +L            + S D+  ++  ++  ++E E +K++L+ +  + R +ET+L S+R  E    +  Q++ +E+ +L D+L   + K     RE+ +L+ R++ +E + E  +R LS E+FE++RA  EL    LS S +
Sbjct:   59 LSEVQANIRVLTADRDKTRILYHQAQDDIAALRRMVVKPKTSRGPRNSVTAQSILKRLETERDEAVTDLHRMSTERDSLRERLQISQETAISERAHLEQSVEDLQNAVLSLEQERGEQKSRQAQMRDAMMRLEEEVHTLSRKLTASEDELGRLKNECSMLRLSSTHAESALSETQRRLTSRIVELQNT-----LEKNKELDERNDV---------LQKEISSLKEELSALQVTVTE-------LDQHKYSLQDQLEKKHDLLSSANKQLDDKENTIHTLKLRIEDLETTVEILSSPLRASKEIGVNRERDLDVLRRKLLGIEDELASVLKVKDALQRENTQLRDELDRTRLDNQSLKLKLEGEVQEVEDLQRKVENYVADISRVEDLLSSKERECRELQECRWRVTAQSDSWEDH-ARKAESNVTDLQLKLRTSDSEKRRLKDTVGSLESSLQEALSAERSCSADLTQL-------KEELRRAEDERSDIQHDLEKTRELCVKL------------DTSKDV--VQQELEACQSELELLKKQLVSERASARSLETMLTSTREKELQRHLSSQERLTEIQLLRDKLAMADGKASSQSREIAQLRTRSAQIEADLEATRRQLSTERFERERASQELHRLGLSSSLR 659          
BLAST of CEP135 vs. Ensembl Cavefish
Match: tsga10 (testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-061013-482])

HSP 1 Score: 133.65 bits (335), Expect = 1.035e-31
Identity = 155/630 (24.60%), Postives = 318/630 (50.48%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANS-QSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLE------HDLVAAEEELQETRDNLCVA--------EQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLN-QFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYK 2868
            + E+Q+++++LT ++D+   +Y +++ +I  + + ++  +   G  NS  ++ +L R+E ERD    +L R+  ERDSL ER ++S ETA  ++   EQ +EDL N + +   E+ +   R   +R  ++ LE E+  L      +  EL   K  CS L+     +E  L  T+R++ S   +L  +     L++ K LD  +D+         L+ E + L E+   L+ T++E     + L+      HDL+++  +  + ++N            E  +    EI   RE++   LR++     +++    K    L R+N +L +E    +  N+SL+  ++  ++E ++L+ + +NYV+++   EDLL+ +E++  EL   ++++ ++  +   H     + +++  + +L   +++   L+  +  LE  + E     R   + ++ L       KE+++  + ER ++  DL   R+LC +L            + S D+  ++  ++  ++E E +K++L+ +  + R +ET+L S+R  E    +  Q++ +E+ +L D+L   + K     RE+ +L+ R++ +E + E  +R LS E+FE++RA  EL    LS S +
Sbjct:   59 LSEVQANIRVLTADRDKTRILYHQAQDDIAALRRMVVKPKTSRGPRNSVTAQSILKRLETERDEAVTDLHRMSTERDSLRERLQISQETAISERAHLEQSVEDLQNAVLSLEQERGEQKSRQAQMRDAMMRLEEEVHTLSRKLTASEDELGRLKNECSMLRLSSTHAESALSETQRRLTSRIVELQNT-----LEKNKELDERNDV---------LQKEISSLKEELSALQVTVTELDQHKYSLQDQLEKKHDLLSSANKQLDDKENTIHTLKLRIEDLETTVEASKEIGVNRERDLDVLRRKLLGIEDELASVLKVKDALQRENTQLRDELDRTRLDNQSLKLKLEGEVQEVEDLQRKVENYVADISRVEDLLSSKERECRELQECRWRVTAQSDSWEDH-ARKAESNVTDLQLKLRTSDSEKRRLKDTVGSLESSLQEALSAERSCSADLTQL-------KEELRRAEDERSDIQHDLEKTRELCVKL------------DTSKDV--VQQELEACQSELELLKKQLVSERASARSLETMLTSTREKELQRHLSSQERLTEIQLLRDKLAMADGKASSQSREIAQLRTRSAQIEADLEATRRQLSTERFERERASQELHRLGLSSSLR 652          
BLAST of CEP135 vs. Ensembl Sea Lamprey
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:553303])

HSP 1 Score: 85.8853 bits (211), Expect = 2.397e-17
Identity = 74/260 (28.46%), Postives = 139/260 (53.46%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIH--RDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETR 1800
            + EIQ +VK+LT E+D+   +Y++S++E+ R+ +E  V      RA   ++ +L RVE ERD    +L R+  ERDSL +R +++ ETA  ++   EQ++ED+         E+ D+  R  AL+  +  LE E+K       +   EL   K     L+   +++E  +   +R++V+ + +L  +++R A  + KI    +++R +  +++ A LR+  + LD +KD L+  + +    I  LE  L   ++ + + R
Sbjct:  517 IAEIQGNVKVLTAERDKTNSLYQQSQEELARLRREA-VRSPKSARAGLGAQAVLRRVERERDDAIADLRRMTTERDSLRQRLQIAQETAISERARLEQRLEDVEANALTLEGERSDLRARSAALKDSVAGLEEEVKGQARRLAEREDELARHKSELGSLRLLNEQAEEAVSEVQRRLVAKSAELQSTQDRGARLDDKI--GTEEIRCYGRQEEVASLRAAVSDLDREKDGLQEAVDDKTEAIVVLEERLAQKDKSIGDLR 773          
BLAST of CEP135 vs. Ensembl Medaka
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:101157283])

HSP 1 Score: 143.665 bits (361), Expect = 2.193e-34
Identity = 145/608 (23.85%), Postives = 324/608 (53.29%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHR-----MHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ  VK+L+ EKD +  ++++++ ++       +  ++L  QED           L + +V+       L ++  ERD+L+ER K S  T   DK   E++I DL  T++N   E+ ++  ++  L+ R    +++ K L+    ++ S+L ++      LK+Q+   E  +   + +    T++L K+ +++   E+++ +       HR++ A L+   + LD +KD L+  + +   ++  L+ +L   E+ L++ R  +   +  L ++   L +RE+E    R+Q D    ++   ++  GI+ R+N RL ++ + + R N+++  ++++ + E+DE++++  +Y+SEV   E L+A +EQ+  +LL +F++   +      +L+      ++ + EL   + +   L+  +   E E+ +     +  E+++S L   +++ + ++   Q E+   + DL+++R+LC +L+  KE   +++  KS+++E++   + DL +E E +K++L  +   +R +ET++ ++R  E    +   ++ SE+ VL D +   + K      EV +L+ R S L+ E + ++R ++ E+FE++R + E+R
Sbjct:  534 DIQKDVKVLSNEKDHFKALFKQAQHDLQLSSSVDVSADVLKLQED-----------LEKAKVK-------LEQLTTERDALMERLKNSALT---DKQGEERRILDLECTVQNLEQERLNLQSQLCVLKERGKAADDQPKLLQNA--EDLSQLRDEANALRLLKEQM---EQLISDYQHRFSVKTSELQKAHQQIEEFEERLGEFSQQSSKHREEVASLQKAISALDREKDALQDDVDQKTEKLVVLQEELSKKEKTLEDVRQTVKNMDVSLAQLQGALKSREREISSQRRQLDACQEELAALKRDKGIIIRENKRLQDDLTTMTRENQAIHAEMEEALHEKDEMKLRVHSYISEVSRIEKLIATKEQENRDLLERFRMAHSEVEERDQKLQQAAGLNNSIRLELLSSDAERRQLRDTVRRQETEIQQHIQVLQAYETRVSSLAHGMSKLEGELHKEQQEKVSALSDLASVRELCVKLDSGKELTARQLTAKSMELEKLTGELADLRSEVELLKKQLASERLTVRNLETLISTTRQKEFQSHLAASERESELKVLRDMVTMADNKT-----EVSQLRGRLSQLQTEKDVLKRQVTTERFERERVVQEMR 1110          

HSP 2 Score: 57.3806 bits (137), Expect = 8.435e-8
Identity = 63/233 (27.04%), Postives = 125/233 (53.65%), Query Frame = 1
Query:  118 AMEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQIL--IDVEL-----ELTKMQKNLRQME--IEKETSEQNNF-----KLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHK-RHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            ++E R   +N+   +L  +I  L E N +L+ KIE +  K     A  ++L  +N  L  +L+ ++   + ++ EK+  L   D+EL     E+ + QK +  +E  I K   EQ++      +L + L EL+   K +E        L++ L+ +K +L  ++EK+ + E+ALVLE+E+ + +H   G+   + ++++ ++R +EE+RD ++ EA   ++ +R   + PV +
Sbjct:  258 SLEARNISNNKLIAHLNLQIEYLQETNRSLEEKIEGLLEKKKDVSAEMVNLSLKNRELCEELTHIDDLAKHLEMEKEGDLETADMELQEAKEEIQRQQKTIEDLEEVITKTRREQSDGEFERGRLQDELVELKGQNKKMEG-------LVNLLEGEKSKLQDKVEKMMSAEKALVLELEKMRAKHGVCGRE-SSPSRLDAFIRSLEEERDCYRREAENYQQAKR--GSGPVLS 480          
BLAST of CEP135 vs. Ensembl Medaka
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:101157283])

HSP 1 Score: 120.553 bits (301), Expect = 3.611e-27
Identity = 140/608 (23.03%), Postives = 311/608 (51.15%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIH-----RMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ  VK+L+ EKD +  ++++++ ++       +  ++L  QED           L + +V+       L ++  ERD+L+ER K S  T   DK   E++I DL  T++N   E+ ++  ++  L+ R    +++ K L+    ++ S+L ++      LK+Q+   E  +   + +    T++L K+ +++   E+++ +       HR++ A L+   + LD +KD L+  + +   ++  L+ +L   E+ L++ R  +   +  L ++   L +RE+E    R+Q D    ++   ++  GI+ R+N RL ++ + + R N+++  ++++ + E+DE++++  +Y+SEV   E L+A +EQ+  +LL +F++   +      +L+      ++ + EL   + +   L+  +   E E+ +     +  E+++S L   +++ + ++   Q E+   + DL+++R+LC +L+  KE   +++  KS+++E++   + DL +E E                ++ L +S            ++ SE+ VL D +   + K      EV +L+ R S L+ E + ++R ++ E+FE++R + E+R
Sbjct:  501 DIQKDVKVLSNEKDHFKALFKQAQHDLQLSSSVDVSADVLKLQED-----------LEKAKVK-------LEQLTTERDALMERLKNSALT---DKQGEERRILDLECTVQNLEQERLNLQSQLCVLKERGKAADDQPKLLQNA--EDLSQLRDEANALRLLKEQM---EQLISDYQHRFSVKTSELQKAHQQIEEFEERLGEFSQQSSKHREEVASLQKAISALDREKDALQDDVDQKTEKLVVLQEELSKKEKTLEDVRQTVKNMDVSLAQLQGALKSREREISSQRRQLDACQEELAALKRDKGIIIRENKRLQDDLTTMTRENQAIHAEMEEALHEKDEMKLRVHSYISEVSRIEKLIATKEQENRDLLERFRMAHSEVEERDQKLQQAAGLNNSIRLELLSSDAERRQLRDTVRRQETEIQQHIQVLQAYETRVSSLAHGMSKLEGELHKEQQEKVSALSDLASVRELCVKLDSGKELTARQLTAKSMELEKLTGELADLRSEKE---------------FQSHLAAS------------ERESELKVLRDMVTMADNKT-----EVSQLRGRLSQLQTEKDVLKRQVTTERFERERVVQEMR 1050          

HSP 2 Score: 57.7658 bits (138), Expect = 6.617e-8
Identity = 63/233 (27.04%), Postives = 125/233 (53.65%), Query Frame = 1
Query:  118 AMEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQIL--IDVEL-----ELTKMQKNLRQME--IEKETSEQNNF-----KLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHK-RHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            ++E R   +N+   +L  +I  L E N +L+ KIE +  K     A  ++L  +N  L  +L+ ++   + ++ EK+  L   D+EL     E+ + QK +  +E  I K   EQ++      +L + L EL+   K +E        L++ L+ +K +L  ++EK+ + E+ALVLE+E+ + +H   G+   + ++++ ++R +EE+RD ++ EA   ++ +R   + PV +
Sbjct:  258 SLEARNISNNKLIAHLNLQIEYLQETNRSLEEKIEGLLEKKKDVSAEMVNLSLKNRELCEELTHIDDLAKHLEMEKEGDLETADMELQEAKEEIQRQQKTIEDLEEVITKTRREQSDGEFERGRLQDELVELKGQNKKMEG-------LVNLLEGEKSKLQDKVEKMMSAEKALVLELEKMRAKHGVCGRE-SSPSRLDAFIRSLEEERDCYRREAENYQQAKR--GSGPVLS 480          
BLAST of CEP135 vs. Ensembl Medaka
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:101157283])

HSP 1 Score: 120.553 bits (301), Expect = 3.720e-27
Identity = 140/608 (23.03%), Postives = 311/608 (51.15%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIH-----RMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELR 2841
            +IQ  VK+L+ EKD +  ++++++ ++       +  ++L  QED           L + +V+       L ++  ERD+L+ER K S  T   DK   E++I DL  T++N   E+ ++  ++  L+ R    +++ K L+    ++ S+L ++      LK+Q+   E  +   + +    T++L K+ +++   E+++ +       HR++ A L+   + LD +KD L+  + +   ++  L+ +L   E+ L++ R  +   +  L ++   L +RE+E    R+Q D    ++   ++  GI+ R+N RL ++ + + R N+++  ++++ + E+DE++++  +Y+SEV   E L+A +EQ+  +LL +F++   +      +L+      ++ + EL   + +   L+  +   E E+ +     +  E+++S L   +++ + ++   Q E+   + DL+++R+LC +L+  KE   +++  KS+++E++   + DL +E E                ++ L +S            ++ SE+ VL D +   + K      EV +L+ R S L+ E + ++R ++ E+FE++R + E+R
Sbjct:  506 DIQKDVKVLSNEKDHFKALFKQAQHDLQLSSSVDVSADVLKLQED-----------LEKAKVK-------LEQLTTERDALMERLKNSALT---DKQGEERRILDLECTVQNLEQERLNLQSQLCVLKERGKAADDQPKLLQNA--EDLSQLRDEANALRLLKEQM---EQLISDYQHRFSVKTSELQKAHQQIEEFEERLGEFSQQSSKHREEVASLQKAISALDREKDALQDDVDQKTEKLVVLQEELSKKEKTLEDVRQTVKNMDVSLAQLQGALKSREREISSQRRQLDACQEELAALKRDKGIIIRENKRLQDDLTTMTRENQAIHAEMEEALHEKDEMKLRVHSYISEVSRIEKLIATKEQENRDLLERFRMAHSEVEERDQKLQQAAGLNNSIRLELLSSDAERRQLRDTVRRQETEIQQHIQVLQAYETRVSSLAHGMSKLEGELHKEQQEKVSALSDLASVRELCVKLDSGKELTARQLTAKSMELEKLTGELADLRSEKE---------------FQSHLAAS------------ERESELKVLRDMVTMADNKT-----EVSQLRGRLSQLQTEKDVLKRQVTTERFERERVVQEMR 1055          

HSP 2 Score: 57.7658 bits (138), Expect = 6.971e-8
Identity = 63/233 (27.04%), Postives = 125/233 (53.65%), Query Frame = 1
Query:  118 AMEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQIL--IDVEL-----ELTKMQKNLRQME--IEKETSEQNNF-----KLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHK-RHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            ++E R   +N+   +L  +I  L E N +L+ KIE +  K     A  ++L  +N  L  +L+ ++   + ++ EK+  L   D+EL     E+ + QK +  +E  I K   EQ++      +L + L EL+   K +E        L++ L+ +K +L  ++EK+ + E+ALVLE+E+ + +H   G+   + ++++ ++R +EE+RD ++ EA   ++ +R   + PV +
Sbjct:  230 SLEARNISNNKLIAHLNLQIEYLQETNRSLEEKIEGLLEKKKDVSAEMVNLSLKNRELCEELTHIDDLAKHLEMEKEGDLETADMELQEAKEEIQRQQKTIEDLEEVITKTRREQSDGEFERGRLQDELVELKGQNKKMEG-------LVNLLEGEKSKLQDKVEKMMSAEKALVLELEKMRAKHGVCGRE-SSPSRLDAFIRSLEEERDCYRREAENYQQAKR--GSGPVLS 452          
BLAST of CEP135 vs. Ensembl Medaka
Match: cep135 (centrosomal protein 135 [Source:NCBI gene;Acc:101157283])

HSP 1 Score: 114.005 bits (284), Expect = 3.122e-25
Identity = 137/600 (22.83%), Postives = 305/600 (50.83%), Query Frame = 1
Query: 1033 EIQSSVKLLTQEKDRYCQMYEESRKEIHR-----MHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEK 2817
            +IQ  VK+L+ EKD +  ++++++ ++       +  ++L  QED           L + +V+       L ++  ERD+L+ER K S  T   DK   E++I DL  T++N   E+ ++  ++  L+ R    +++ K L+    ++ S+L ++      LK+Q+   E  +   + +    T++L K+ +++   E+++ +       HR++ A L+   + LD +KD L+  + +   ++  L+ +L   E+ L++ R  +   +  L ++   L +RE+E    R+Q D    ++   ++  GI+ R+N RL ++ + + R N+++  ++++ + E+DE++++  +Y+SEV   E L+A +EQ+  +LL +F++   +      +L+      ++ + EL   + +   L+  +   E E+ +     +  E+++S L   +++ + ++   Q E+   + DL+++R+LC +L+  KE   +++  KS+++E++   + DL +E E                ++ L +S            ++ SE+ VL D +   + K      EV +L+ R S L+ E + ++R ++ E+FE+
Sbjct:  534 DIQKDVKVLSNEKDHFKALFKQAQHDLQLSSSVDVSADVLKLQED-----------LEKAKVK-------LEQLTTERDALMERLKNSALT---DKQGEERRILDLECTVQNLEQERLNLQSQLCVLKERGKAADDQPKLLQNA--EDLSQLRDEANALRLLKEQM---EQLISDYQHRFSVKTSELQKAHQQIEEFEERLGEFSQQSSKHREEVASLQKAISALDREKDALQDDVDQKTEKLVVLQEELSKKEKTLEDVRQTVKNMDVSLAQLQGALKSREREISSQRRQLDACQEELAALKRDKGIIIRENKRLQDDLTTMTRENQAIHAEMEEALHEKDEMKLRVHSYISEVSRIEKLIATKEQENRDLLERFRMAHSEVEERDQKLQQAAGLNNSIRLELLSSDAERRQLRDTVRRQETEIQQHIQVLQAYETRVSSLAHGMSKLEGELHKEQQEKVSALSDLASVRELCVKLDSGKELTARQLTAKSMELEKLTGELADLRSEKE---------------FQSHLAAS------------ERESELKVLRDMVTMADNKT-----EVSQLRGRLSQLQTEKDVLKRQVTTERFER 1075          

HSP 2 Score: 57.7658 bits (138), Expect = 6.588e-8
Identity = 63/233 (27.04%), Postives = 125/233 (53.65%), Query Frame = 1
Query:  118 AMEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQIL--IDVEL-----ELTKMQKNLRQME--IEKETSEQNNF-----KLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHK-RHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFN 771
            ++E R   +N+   +L  +I  L E N +L+ KIE +  K     A  ++L  +N  L  +L+ ++   + ++ EK+  L   D+EL     E+ + QK +  +E  I K   EQ++      +L + L EL+   K +E        L++ L+ +K +L  ++EK+ + E+ALVLE+E+ + +H   G+   + ++++ ++R +EE+RD ++ EA   ++ +R   + PV +
Sbjct:  258 SLEARNISNNKLIAHLNLQIEYLQETNRSLEEKIEGLLEKKKDVSAEMVNLSLKNRELCEELTHIDDLAKHLEMEKEGDLETADMELQEAKEEIQRQQKTIEDLEEVITKTRREQSDGEFERGRLQDELVELKGQNKKMEG-------LVNLLEGEKSKLQDKVEKMMSAEKALVLELEKMRAKHGVCGRE-SSPSRLDAFIRSLEEERDCYRREAENYQQAKR--GSGPVLS 480          
BLAST of CEP135 vs. Planmine SMEST
Match: SMESG000077870.1 (SMESG000077870.1)

HSP 1 Score: 1659.43 bits (4296), Expect = 0.000e+0
Identity = 927/927 (100.00%), Postives = 927/927 (100.00%), Query Frame = 1
Query:  121 MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNXXXXXXXXXXXXXXXXXXXXXXXXXXXIESLRQEKXXXXXXXXXXXXXXXXXXXNKTLKKSDEDIVQIXXXXXXXXXXXXXXXXXVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH 2901
            MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNSPSKSPKKQLSKEKKELEREKEDLKQKIESLRQEKNSSPVRNRSPSPTLRSRSPNKTLKKSDEDIVQIRRERDDLRNLLNKLEKRVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGRLERSKEELEKEIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH
Sbjct:    1 MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSLDHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEKETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIEKLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEATLLRELQRKVNASPVFNSPSKSPKKQLSKEKKELEREKEDLKQKIESLRQEKNSSPVRNRSPSPTLRSRSPNKTLKKSDEDIVQIRRERDDLRNLLNKLEKRVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANSQSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGRLERSKEELEKEIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAAH 927          
BLAST of CEP135 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.399e-34
Identity = 158/637 (24.80%), Postives = 335/637 (52.59%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQE---DGGRANSQS---KKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKE-------NRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAA 2898
            + +IQ ++++LTQE+D     Y+  ++E+H + + L+ +++   D G  N  S   + +L R+EVERD   N+L ++  ERDSL ER K   ++A  +K    Q++EDL N I      K+++ ++   LR++I +LE     L        S +E ++    ++   L++ +  +   ER+   L+ +L  SE R++  ++++    ++   ++++  +L+   N LD +KDQ++  + +   ++  +   L   E+ L E R N+   EQQL R++E+   R++E       N QL K   H  ++ ++ + +   L  D   LT E  +++   + +   + D+ +++++L  +  ++       + L  ++++   E+L Q++ LS D    +  ++  + D    + ++  REN +  ++ ++   E+E++  +   + +E ++  L  ++  N +  +    E+ E++++L+A+RDLC RLE SKE +++++ ++ L+ EQ+++   +   ENE+++EE+    E IR +ET++   R  E    +E Q K +E+   N+ L     K+     +++K     ++LE E E+++R L++EKF+ + A  E+R      +Y+  C     A+
Sbjct:  533 LHDIQGNIRVLTQERDMINDCYQGCQREVHELRESLIQSEKPRKDSG-TNQPSLAVQSMLRRLEVERDQSLNDLHKMTTERDSLRERLKTVTDSAISEKARLCQRLEDLENQISRLLEAKEELIDKATVLRNKIGELEEHNHQLAKKNDSLTSVIEKERSVMQEMNSDLQRFQNEVQKKERRESQLSEELKNSENRISNLQERLESQNNETIDYKNENMKLKDIVNELDREKDQMQSDVDDKIEQLKDVHMQLKVKEDALNEIRINMTSLEQQLRRINEVNNHRDQELRALVLHNEQLEKDLRHQVSKFDQLKAENTRLEEDLMCLTREHHKVEAEYRDVHRCLMDVNQDKEQLEQKIMHF-------QKLGNEQKEQNDEMLEQYRQLSLDYEKLQINIQKLEGDNDELRADVNARENVVCRMREQLLITEREISTSQSNIQHLEDQVRSLNQVLETNGQVTENHSLEKHEILQELAAMRDLCARLESSKENVQRQLSSRLLENEQLKSENSEFFKENENLREEIQSLLETIRNLETVMSVGREKEFMNEMEFQQKIAELESENEHLAHLPSKIDQLHHDLKKQAMCCAELEAECEKLRRQLTSEKFKLELANQEIR--RRQKTYQNGCLTDRAAS 1159          
BLAST of CEP135 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 143.665 bits (361), Expect = 2.600e-34
Identity = 158/637 (24.80%), Postives = 335/637 (52.59%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQE---DGGRANSQS---KKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKE-------NRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAA 2898
            + +IQ ++++LTQE+D     Y+  ++E+H + + L+ +++   D G  N  S   + +L R+EVERD   N+L ++  ERDSL ER K   ++A  +K    Q++EDL N I      K+++ ++   LR++I +LE     L        S +E ++    ++   L++ +  +   ER+   L+ +L  SE R++  ++++    ++   ++++  +L+   N LD +KDQ++  + +   ++  +   L   E+ L E R N+   EQQL R++E+   R++E       N QL K   H  ++ ++ + +   L  D   LT E  +++   + +   + D+ +++++L  +  ++       + L  ++++   E+L Q++ LS D    +  ++  + D    + ++  REN +  ++ ++   E+E++  +   + +E ++  L  ++  N +  +    E+ E++++L+A+RDLC RLE SKE +++++ ++ L+ EQ+++   +   ENE+++EE+    E IR +ET++   R  E    +E Q K +E+   N+ L     K+     +++K     ++LE E E+++R L++EKF+ + A  E+R      +Y+  C     A+
Sbjct:  533 LHDIQGNIRVLTQERDMINDCYQGCQREVHELRESLIQSEKPRKDSG-TNQPSLAVQSMLRRLEVERDQSLNDLHKMTTERDSLRERLKTVTDSAISEKARLCQRLEDLENQISRLLEAKEELIDKATVLRNKIGELEEHNHQLAKKNDSLTSVIEKERSVMQEMNSDLQRFQNEVQKKERRESQLSEELKNSENRISNLQERLESQNNETIDYKNENMKLKDIVNELDREKDQMQSDVDDKIEQLKDVHMQLKVKEDALNEIRINMTSLEQQLRRINEVNNHRDQELRALVLHNEQLEKDLRHQVSKFDQLKAENTRLEEDLMCLTREHHKVEAEYRDVHRCLMDVNQDKEQLEQKIMHF-------QKLGNEQKEQNDEMLEQYRQLSLDYEKLQINIQKLEGDNDELRADVNARENVVCRMREQLLITEREISTSQSNIQHLEDQVRSLNQVLETNGQVTENHSLEKHEILQELAAMRDLCARLESSKENVQRQLSSRLLENEQLKSENSEFFKENENLREEIQSLLETIRNLETVMSVGREKEFMNEMEFQQKIAELESENEHLAHLPSKIDQLHHDLKKQAMCCAELEAECEKLRRQLTSEKFKLELANQEIR--RRQKTYQNGCLTDRAAS 1159          
BLAST of CEP135 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 142.895 bits (359), Expect = 3.744e-34
Identity = 158/637 (24.80%), Postives = 335/637 (52.59%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQE---DGGRANSQS---KKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKE-------NRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAA 2898
            + +IQ ++++LTQE+D     Y+  ++E+H + + L+ +++   D G  N  S   + +L R+EVERD   N+L ++  ERDSL ER K   ++A  +K    Q++EDL N I      K+++ ++   LR++I +LE     L        S +E ++    ++   L++ +  +   ER+   L+ +L  SE R++  ++++    ++   ++++  +L+   N LD +KDQ++  + +   ++  +   L   E+ L E R N+   EQQL R++E+   R++E       N QL K   H  ++ ++ + +   L  D   LT E  +++   + +   + D+ +++++L  +  ++       + L  ++++   E+L Q++ LS D    +  ++  + D    + ++  REN +  ++ ++   E+E++  +   + +E ++  L  ++  N +  +    E+ E++++L+A+RDLC RLE SKE +++++ ++ L+ EQ+++   +   ENE+++EE+    E IR +ET++   R  E    +E Q K +E+   N+ L     K+     +++K     ++LE E E+++R L++EKF+ + A  E+R      +Y+  C     A+
Sbjct:  533 LHDIQGNIRVLTQERDMINDCYQGCQREVHELRESLIQSEKPRKDSG-TNQPSLAVQSMLRRLEVERDQSLNDLHKMTTERDSLRERLKTVTDSAISEKARLCQRLEDLENQISRLLEAKEELIDKATVLRNKIGELEEHNHQLAKKNDSLTSVIEKERSVMQEMNSDLQRFQNEVQKKERRESQLSEELKNSENRISNLQERLESQNNETIDYKNENMKLKDIVNELDREKDQMQSDVDDKIEQLKDVHMQLKVKEDALNEIRINMTSLEQQLRRINEVNNHRDQELRALVLHNEQLEKDLRHQVSKFDQLKAENTRLEEDLMCLTREHHKVEAEYRDVHRCLMDVNQDKEQLEQKIMHF-------QKLGNEQKEQNDEMLEQYRQLSLDYEKLQINIQKLEGDNDELRADVNARENVVCRMREQLLITEREISTSQSNIQHLEDQVRSLNQVLETNGQVTENHSLEKHEILQELAAMRDLCARLESSKENVQRQLSSRLLENEQLKSENSEFFKENENLREEIQSLLETIRNLETVMSVGREKEFMNEMEFQQKIAELESENEHLAHLPSKIDQLHHDLKKQAMCCAELEAECEKLRRQLTSEKFKLELANQEIR--RRQKTYQNGCLTDRAAS 1159          
BLAST of CEP135 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 142.895 bits (359), Expect = 4.715e-34
Identity = 158/637 (24.80%), Postives = 335/637 (52.59%), Query Frame = 1
Query: 1027 VGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQE---DGGRANSQS---KKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQKIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSELENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKILDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLVAAEEELQETRDNLCVAEQQLGRVSEILTTREKE-------NRQLRKQNDHNSNQVEEFQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNYVSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCKQELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKEQVKLIQHERDELMEDLSALRDLCGXXXXXXXXXXXXIDNKSLDIEQIRANMDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEVAVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKDRALSELRIHSLSPSYKPSCYLSNGAA 2898
            + +IQ ++++LTQE+D     Y+  ++E+H + + L+ +++   D G  N  S   + +L R+EVERD   N+L ++  ERDSL ER K   ++A  +K    Q++EDL N I      K+++ ++   LR++I +LE     L        S +E ++    ++   L++ +  +   ER+   L+ +L  SE R++  ++++    ++   ++++  +L+   N LD +KDQ++  + +   ++  +   L   E+ L E R N+   EQQL R++E+   R++E       N QL K   H  ++ ++ + +   L  D   LT E  +++   + +   + D+ +++++L  +  ++       + L  ++++   E+L Q++ LS D    +  ++  + D    + ++  REN +  ++ ++   E+E++  +   + +E ++  L  ++  N +  +    E+ E++++L+A+RDLC RLE SKE +++++ ++ L+ EQ+++   +   ENE+++EE+    E IR +ET++   R  E    +E Q K +E+   N+ L     K+     +++K     ++LE E E+++R L++EKF+ + A  E+R      +Y+  C     A+
Sbjct:  533 LHDIQGNIRVLTQERDMINDCYQGCQREVHELRESLIQSEKPRKDSG-TNQPSLAVQSMLRRLEVERDQSLNDLHKMTTERDSLRERLKTVTDSAISEKARLCQRLEDLENQISRLLEAKEELIDKATVLRNKIGELEEHNHQLAKKNDSLTSVIEKERSVMQEMNSDLQRFQNEVQKKERRESQLSEELKNSENRISNLQERLESQNNETIDYKNENMKLKDIVNELDREKDQMQSDVDDKIEQLKDVHMQLKVKEDALNEIRINMTSLEQQLRRINEVNNHRDQELRALVLHNEQLEKDLRHQVSKFDQLKAENTRLEEDLMCLTREHHKVEAEYRDVHRCLMDVNQDKEQLEQKIMHF-------QKLGNEQKEQNDEMLEQYRQLSLDYEKLQINIQKLEGDNDELRADVNARENVVCRMREQLLITEREISTSQSNIQHLEDQVRSLNQVLETNGQVTENHSLEKHEILQELAAMRDLCARLESSKENVQRQLSSRLLENEQLKSENSEFFKENENLREEIQSLLETIRNLETVMSVGREKEFMNEMEFQQKIAELESENEHLAHLPSKIDQLHHDLKKQAMCCAELEAECEKLRRQLTSEKFKLELANQEIR--RRQKTYQNGCLTDRAAS 1159          
The following BLAST results are available for this feature:
BLAST of CEP135 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSGA102.476e-5026.97testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14... [more]
TSGA103.122e-5026.97testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14... [more]
TSGA103.122e-5026.97testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14... [more]
TSGA103.122e-5026.97testis specific 10 [Source:HGNC Symbol;Acc:HGNC:14... [more]
CEP1352.208e-4023.97centrosomal protein 135 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of CEP135 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP135 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cep1353.164e-625.96gene:FBgn0036480 transcript:FBtr0075638[more]
Cep1354.156e-625.96gene:FBgn0036480 transcript:FBtr0333853[more]
back to top
BLAST of CEP135 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep1352.265e-5028.22centrosomal protein 135 [Source:NCBI gene;Acc:5533... [more]
cep1353.254e-5028.22centrosomal protein 135 [Source:NCBI gene;Acc:5533... [more]
cep1359.973e-3726.73centrosomal protein 135 [Source:NCBI gene;Acc:5533... [more]
tsga103.554e-2826.51testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-0610... [more]
tsga103.554e-2826.51testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-0610... [more]
back to top
BLAST of CEP135 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1355.849e-4827.26centrosomal protein 135kDa [Source:NCBI gene;Acc:1... [more]
CEP1351.482e-4427.14centrosomal protein 135kDa [Source:NCBI gene;Acc:1... [more]
tsga102.378e-4325.82testis specific 10 [Source:NCBI gene;Acc:100145206... [more]
tsga102.400e-4325.82testis specific 10 [Source:NCBI gene;Acc:100145206... [more]
CEP1353.990e-4326.87centrosomal protein 135kDa [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of CEP135 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsga108.219e-5026.81testis specific 10 [Source:MGI Symbol;Acc:MGI:2685... [more]
Tsga101.002e-4926.81testis specific 10 [Source:MGI Symbol;Acc:MGI:2685... [more]
Cep1351.149e-4726.22centrosomal protein 135 [Source:MGI Symbol;Acc:MGI... [more]
Cep1351.149e-4726.22centrosomal protein 135 [Source:MGI Symbol;Acc:MGI... [more]
Tsga105.510e-3126.30testis specific 10 [Source:MGI Symbol;Acc:MGI:2685... [more]
back to top
BLAST of CEP135 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZW7|TSG10_HUMAN1.499e-4926.97Testis-specific gene 10 protein OS=Homo sapiens OX... [more]
sp|Q5RG45|CP135_DANRE1.710e-4928.22Centrosomal protein of 135 kDa OS=Danio rerio OX=7... [more]
sp|Q6NY15|TSG10_MOUSE5.749e-4926.81Testis-specific gene 10 protein OS=Mus musculus OX... [more]
sp|Q6P5D4|CP135_MOUSE8.035e-4726.22Centrosomal protein of 135 kDa OS=Mus musculus OX=... [more]
sp|Q9Z220|TSG10_RAT7.803e-4125.69Testis-specific gene 10 protein OS=Rattus norvegic... [more]
back to top
BLAST of CEP135 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203016800.000e+099.78tr|A0A481MTH8|A0A481MTH8_SCHMD CEP135 OS=Schmidtea... [more]
gnl|BL_ORD_ID|182706354.982e-8633.72tr|A0A267GQE4|A0A267GQE4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182747338.295e-8633.72tr|A0A1I8I410|A0A1I8I410_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182602606.103e-8333.72tr|A0A267G3Z8|A0A267G3Z8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182278691.556e-8233.55tr|A0A1I8H6A7|A0A1I8H6A7_9PLAT Uncharacterized pro... [more]
back to top
BLAST of CEP135 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep1351.980e-5027.69centrosomal protein 135 [Source:NCBI gene;Acc:1030... [more]
tsga106.395e-3224.69testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-0610... [more]
tsga101.035e-3124.60testis specific, 10 [Source:ZFIN;Acc:ZDB-GENE-0610... [more]
back to top
BLAST of CEP135 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1352.397e-1728.46centrosomal protein 135 [Source:NCBI gene;Acc:5533... [more]
back to top
BLAST of CEP135 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP135 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP135 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep1352.193e-3423.85centrosomal protein 135 [Source:NCBI gene;Acc:1011... [more]
cep1353.611e-2723.03centrosomal protein 135 [Source:NCBI gene;Acc:1011... [more]
cep1353.720e-2723.03centrosomal protein 135 [Source:NCBI gene;Acc:1011... [more]
cep1353.122e-2522.83centrosomal protein 135 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of CEP135 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077870.10.000e+0100.00SMESG000077870.1[more]
SMESG000070566.11.399e-3424.80SMESG000070566.1[more]
SMESG000070566.12.600e-3424.80SMESG000070566.1[more]
SMESG000070566.13.744e-3424.80SMESG000070566.1[more]
SMESG000070566.14.715e-3424.80SMESG000070566.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010503 ID=SMED30010503|Name=CEP135|organism=Schmidtea mediterranea sexual|type=transcript|length=3100bp
TATGACGAGTAGCCTTGACAACATGACACTTGTCAAGTTATTTAATTTGA
ATTGAACACTTAATTAATTAATATATAAGAAAAAACAATTCTTTGAAACT
TAGCCTTTCTTCCTGAAGCAATGGAATACCGTCTGAGTTATGACAATAGA
GGTGCGAATAATTTACGCAAAGAAATTGCATTGTTAATGGAAGAAAATGA
TAACTTGAAACATAAAATTGAAGAAATGGATATGAAAATGTCGCAAGAAA
GAGCAATAGAATTGTCGTTGGATCACGAAAATTTTCATCTAAAGAATGAT
TTATCATCGGTTGAAAGGTTTAATCGTTCAATGAAACACGAAAAAGATCA
GATTTTAATTGATGTTGAATTAGAGTTAACGAAAATGCAAAAAAATTTAA
GACAAATGGAAATTGAAAAAGAAACATCTGAACAAAATAATTTCAAGTTG
TCAAATAGCTTAACAGAGCTTCAACATTCAACGAAAATGATTGAAAATGA
TCTTCAAGAATCACAGAATTTAATTTCAAGGTTGCAAGATGATAAATTAA
GATTATCTCAGAGAATTGAAAAGTTAACAGCCACTGAAAGGGCATTGGTA
TTGGAAATCGAAAGACATAAGAGACATAGTAAAAGTGGTAAATCTCGAGA
GACTGTCAACCAAGTCGAACAGTACATGAGAGGAATTGAAGAAGATCGAG
ATTATTGGAAAAATGAAGCCACTCTTCTTCGAGAACTTCAACGAAAAGTG
AACGCGTCCCCGGTTTTTAATTCTCCCAGTAAATCACCGAAAAAACAATT
GTCAAAAGAAAAAAAAGAGTTAGAACGAGAAAAAGAAGATTTGAAACAAA
AAATAGAGTCATTGAGACAAGAGAAGAACTCATCTCCAGTGAGAAATCGA
AGCCCATCACCGACATTGAGATCAAGATCGCCAAATAAAACTTTGAAAAA
GTCAGACGAAGACATTGTGCAAATAAGACGTGAAAGAGATGACTTAAGAA
ATCTCCTAAATAAATTAGAAAAACGTGTCGGGGAAATTCAATCAAGTGTC
AAATTGTTAACTCAAGAAAAAGACCGGTATTGCCAAATGTATGAAGAGTC
ACGAAAAGAAATTCATCGAATGCATCAAGAGTTGCTCGTTACTCAAGAGG
ACGGTGGTCGAGCTAATTCCCAGTCGAAAAAACTGTTAAATCGCGTTGAA
GTAGAAAGAGATGGTTTACAAAATGAGCTAGCTAGAGTACAGAATGAAAG
AGATAGTCTTTTAGAACGATTTAAAGTCTCGGTAGAAACCGCCAATCATG
ATAAATACCTTTTTGAACAAAAAATAGAAGACCTATCAAACACTATTAAA
AACAACCGAACCGAAAAGAAAGATATGGCTGAAAGAATGGAAGCCTTACG
TTCGAGAATTCTTGATTTGGAAAATGAATTAAAGAATCTAGAAATAGGTG
CTCGCCAAAATTTCTCTGAGTTAGAGAACAAAAAAGAAGGATGCAGTCAA
CTGAAACAACAACTGAAAAAATCTGAAATGCATTTGGATTCCACTGAAAG
ACAAGTTGTAAGCCTTACAACTCAATTAAATAAATCCGAAGAAAGAGTAG
CACTGCAAGAACAAAAGATATTAGATTTGGTTGATGATTTAAGAATTCAT
CGAGATGATTACGCAAGATTAAGAAGTGAAGCAAATCGTCTGGATGAAGA
CAAAGATCAATTAAAAGGCACTTTAAGTGAAGCAGCGCACAGAATCCATC
AATTAGAACATGATTTAGTGGCCGCCGAAGAAGAACTACAAGAAACCAGA
GATAATCTCTGTGTTGCCGAACAACAACTGGGTAGAGTTTCAGAGATTTT
AACAACAAGAGAAAAGGAGAATAGACAATTGCGAAAGCAAAATGATCACA
ATTCCAATCAGGTTGAAGAATTTCAGAAAAAAATAGGAATTCTTAGTAGA
GATAATGATAGATTAACAAATGAAAAATCTGAGATTCAACGAATAAATAA
AAGTCTTCAAAATGATATACAGGATATTATTGAAGAGAGAGATGAATTAA
GAATTCAAACTCAAAATTATGTAAGTGAAGTGAAAGCTGCCGAAGATCTT
TTAGCACAGAGAGAACAAGATCAAACAGAACTTCTAAACCAATTTCAAAT
TTTATCAGAAGATGCTGCTTTATACAAGCACAGATTGGAAATGTGTCAGA
AAGATTTGTCGACTTGTAAACAAGAACTCGCTGATCGAGAAAACGACATT
GATAATTTACAATCTAGAATTGATGAGTTGGAGAAAGAAGTAACTGAGAA
AAAGTTCTACAATAGAGAAATGGAATCAAAAATAAGTCATTTGGGAGTTA
TTATAAATCAGAATAAAGAGCAAGTGAAATTAATTCAACATGAAAGAGAC
GAATTAATGGAAGATCTGTCTGCTCTAAGAGATCTATGTGGAAGATTAGA
AAGATCAAAGGAAGAACTTGAGAAAGAGATTGACAATAAAAGTTTAGACA
TCGAACAAATACGGGCAAATATGGATGATTTAGAGAATGAAAATGAATCA
ATGAAAGAAGAACTTCTTCAAAAGGATGAAAATATAAGAAAAATTGAAAC
CATATTACAAAGCAGTCGAAACTTGGAACAGAATTGCATGATTGAAATAC
AAGATAAATCATCGGAAGTGGCAGTTTTAAACGATCGACTTCAAACGACG
GAAGAGAAATTACAGCTAGCTGAAAGAGAAGTGCAAAAGCTGAAAAATCG
TAACAGTGATTTGGAACGAGAAACTGAACGAATGCAAAGAAGTTTGTCCA
ATGAAAAATTTGAAAAAGATCGAGCTCTTTCAGAATTGAGAATTCATTCA
TTATCTCCCTCATACAAACCTTCTTGTTATTTATCGAACGGAGCCGCGCA
CCGGAGCTCTTCTCCGTGCCGAACATGTTCTCCATGATTGGTCAATGCCA
ATATTCACATAATTTTCTGCAGTATATCGCCACTAAAAGATATCTATATG
TCCATCAATTGAAAATAATTATATTATTTTGAATATTTTTTATTACTAAA
AATGAATTTACTACTTGTATTGATTTTATAGAGATGATAGACTGTACTTT
back to top

protein sequence of SMED30010503-orf-1

>SMED30010503-orf-1 ID=SMED30010503-orf-1|Name=SMED30010503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=939bp
MEYRLSYDNRGANNLRKEIALLMEENDNLKHKIEEMDMKMSQERAIELSL
DHENFHLKNDLSSVERFNRSMKHEKDQILIDVELELTKMQKNLRQMEIEK
ETSEQNNFKLSNSLTELQHSTKMIENDLQESQNLISRLQDDKLRLSQRIE
KLTATERALVLEIERHKRHSKSGKSRETVNQVEQYMRGIEEDRDYWKNEA
TLLRELQRKVNASPVFNSPSKSPKKQLSKEKKELEREKEDLKQKIESLRQ
EKNSSPVRNRSPSPTLRSRSPNKTLKKSDEDIVQIRRERDDLRNLLNKLE
KRVGEIQSSVKLLTQEKDRYCQMYEESRKEIHRMHQELLVTQEDGGRANS
QSKKLLNRVEVERDGLQNELARVQNERDSLLERFKVSVETANHDKYLFEQ
KIEDLSNTIKNNRTEKKDMAERMEALRSRILDLENELKNLEIGARQNFSE
LENKKEGCSQLKQQLKKSEMHLDSTERQVVSLTTQLNKSEERVALQEQKI
LDLVDDLRIHRDDYARLRSEANRLDEDKDQLKGTLSEAAHRIHQLEHDLV
AAEEELQETRDNLCVAEQQLGRVSEILTTREKENRQLRKQNDHNSNQVEE
FQKKIGILSRDNDRLTNEKSEIQRINKSLQNDIQDIIEERDELRIQTQNY
VSEVKAAEDLLAQREQDQTELLNQFQILSEDAALYKHRLEMCQKDLSTCK
QELADRENDIDNLQSRIDELEKEVTEKKFYNREMESKISHLGVIINQNKE
QVKLIQHERDELMEDLSALRDLCGRLERSKEELEKEIDNKSLDIEQIRAN
MDDLENENESMKEELLQKDENIRKIETILQSSRNLEQNCMIEIQDKSSEV
AVLNDRLQTTEEKLQLAEREVQKLKNRNSDLERETERMQRSLSNEKFEKD
RALSELRIHSLSPSYKPSCYLSNGAAHRSSSPCRTCSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026732Cep135
Vocabulary: biological process
TermDefinition
GO:0007099centriole replication
GO:0010457centriole-centriole cohesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 448..562
NoneNo IPR availableCOILSCoilCoilcoord: 843..891
NoneNo IPR availableCOILSCoilCoilcoord: 121..155
NoneNo IPR availableCOILSCoilCoilcoord: 584..646
NoneNo IPR availableCOILSCoilCoilcoord: 12..39
NoneNo IPR availableCOILSCoilCoilcoord: 349..383
NoneNo IPR availableCOILSCoilCoilcoord: 79..106
NoneNo IPR availableCOILSCoilCoilcoord: 275..316
NoneNo IPR availableCOILSCoilCoilcoord: 224..254
NoneNo IPR availableCOILSCoilCoilcoord: 745..828
NoneNo IPR availableCOILSCoilCoilcoord: 402..443
NoneNo IPR availableCOILSCoilCoilcoord: 654..674
NoneNo IPR availableCOILSCoilCoilcoord: 696..737
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 877..898
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 224..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 213..282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 254..271
NoneNo IPR availablePANTHERPTHR23159CENTROSOMAL PROTEIN 2coord: 15..232
NoneNo IPR availablePANTHERPTHR23159CENTROSOMAL PROTEIN 2coord: 220..918
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 492..738
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 401..507
IPR026732Centrosomal protein of 135kDaPANTHERPTHR23159:SF18CENTROSOMAL PROTEIN OF 135 KDAcoord: 220..918
IPR026732Centrosomal protein of 135kDaPANTHERPTHR23159:SF18CENTROSOMAL PROTEIN OF 135 KDAcoord: 15..232