SMED30010499

Overview
NameSMED30010499
Smed IDSMED30010499
Length (bp)9532
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010499 (SMED30010499) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010499 (SMED30010499) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010499 (SMED30010499) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010499 (SMED30010499) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010499

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig31778newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig31778uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig37769newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig37769uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig33876newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000055070.1 Contig33876uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000061518.1 SMESG000055070.1 Contig33875newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010499SMESG000061518.1 SMESG000055070.1 Contig33875uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30010499SMESG000055070.1 dd_Smed_v6_6915_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30010499SMESG000055070.1 dd_Smed_v6_6915_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30010499SMESG000055070.1 dd_Smed_v6_6915_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010499SMESG000055070.1 dd_Smed_v4_6915_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010499 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001574:4323..49340 -46154
Homology
BLAST of SMED30010499 vs. Ensembl Human
Match: HSPG2 (heparan sulfate proteoglycan 2 [Source:HGNC Symbol;Acc:HGNC:5273])

HSP 1 Score: 206.453 bits (524), Expect = 1.559e-59
Identity = 173/620 (27.90%), Postives = 257/620 (41.45%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMF---NNAAMFVSMCLKCFCSGQTDDCSSAMGY-------YQSPNPKTSTRTKGLLMNFKSQ--------KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQG---AIVCKCTGRERNDPLCDKC 8040
            C   + ACRN  CI  +  C+G +DCEDG DE +      CEPN+F C        +  C    WRCDG+ DC +  DE NC  K  +  C  + F C      IP S  CDE  +C +  DE  C  P+VV P +E+       + ++  C  + VPT  INWR NWG +P     TV   G         L I ++     G YTCEA++ +     +       V  +  C    F   ++AA     CL CFC G T  C S   +       +  P+       KG+ +   +Q          L++  +   + +   S +F+  ++  F   P  FL       G+ ++SY   L+ N+R  L     + +  P V+L     + L       S        G  NQ ++   E E+W  +S       R ++L VL  ++ +LI+  Y +        +  +D  +T+  S G    A  +E+C CP  Y+GLSCE C A + +      +  C   NC      CD   G+C  C     GP+C +CK GF     +  ++ C  C C     +   S+ C  D  GQ    A     TGR      C+ C
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQT-VTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGG-----RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAA-----CLPCFCFGITSVCQSTRRFRDQIRLRFDQPDD-----FKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFL--VHDSFWALPEQFL-------GNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLL-------SRGHTPTQPGALNQRQVQFSE-EHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGR---AHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRR-----CESC 854          

HSP 2 Score: 47.3654 bits (111), Expect = 1.559e-59
Identity = 21/62 (33.87%), Postives = 29/62 (46.77%), Query Frame = -3
Query: 6039 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6212
            C+  G+       C+CK N  G  C+EC+ G F    +    CLKCFC   ++ C  S   R
Sbjct:  879 CDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSR 940          

HSP 3 Score: 76.2554 bits (186), Expect = 7.342e-21
Identity = 84/361 (23.27%), Postives = 133/361 (36.84%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDCSS-----AMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG-------PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQN----QCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            CLKCFC G +  C+S     A  +  S  P   + T     +  ++ I   +  +  +   S  ++ +   Y  F   P+ FL       G  + SY   L+  +     ++   PG       P V+LQ   G ++    +   E     P  F    +   W++ +          A R  +L  L+ I  LLIR  Y            ++D  +  P+  G +  A  +E+C+CP  Y G SC+ C  GY +         C +  C  +   C+ + G C  C     GP+C +C+PG+          DC  C CY        ++ C  D  G               P CD C
Sbjct:  921 CLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGF---SSFHRLLSGPY--FWSLPSRFL-------GDKVTSYGGELRFTV-----TQRSQPGSTPLHGQPLVVLQ---GNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPD-------GQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMD--VAVPEETGQDP-ALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGH--------------PTCDAC 1237          

HSP 4 Score: 47.7506 bits (112), Expect = 7.342e-21
Identity = 23/66 (34.85%), Postives = 31/66 (46.97%), Query Frame = -3
Query: 6039 NCN---SLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6215
            NC+   S+ ++    G+C+CK   +G  CS C P  F         CL CFC   TQ+C  S   R
Sbjct: 1276 NCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSAYTR 1341          

HSP 5 Score: 67.781 bits (164), Expect = 5.038e-10
Identity = 49/188 (26.06%), Postives = 74/188 (39.36%), Query Frame = -2
Query: 6283 AMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLS---SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6813
            A R  +L  L+D+  LLIR  + S          +++     P    N   A  +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C++C    +G  C  C PG+   YG+  +    DC  C C       + S  C  +  G G   C           C++C
Sbjct: 1476 ATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPS---NRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCEL--CECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGY---YGDATAGTPEDCQPCACPLTNPENMFSRTC--ESLGAGGYRCTACEPGYTGQYCEQC 1653          
BLAST of SMED30010499 vs. Ensembl Human
Match: LAMA1 (laminin subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:6481])

HSP 1 Score: 76.6406 bits (187), Expect = 5.721e-16
Identity = 87/354 (24.58%), Postives = 143/354 (40.40%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFK---SQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTG-FEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ-------NQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            C +CFC G +D CSS        N  +      L+   K    Q  L   +  SI   N+   + +   Y  +   P  +L +     G +L+   Y +  +I +     + +    VI++  NG +L    +  +E +   P  +   L +     EN F D   +    R  ++ VL+++ +LLIR  Y S +   +   + ++D   +N   +   + A  +E C CP  YTG SCE CL+GY + D          C  +C  +  EC+ +G C  C    +G  C +C PGF          DC  C C   + +   S  C   L     +VC       +   C++C
Sbjct:  500 CSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDALGGRHQVSIN--NTAVMQRLAPKY--YWAAPEAYLGNKLTAFGGFLK---YTVSYDIPVETVDSNLMSHADVIIKG-NGLTL----STQAEGLSLQP--YEEYLNVVRLVPEN-FQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDL---VVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPC--ECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTC--HLNDGDEVVCDWCAPGYSGAWCERC 831          

HSP 2 Score: 30.4166 bits (67), Expect = 5.721e-16
Identity = 21/58 (36.21%), Postives = 27/58 (46.55%), Query Frame = -3
Query: 6072 DLSENKNCNSLGTENIVDGKC-KCKENYKGPNCSECSPGFFS---FQKKCLKCFCSNK 6233
            D SE  +C+S      V G+C KC  N  G +C  C+ GF+      K C  C C  K
Sbjct:  856 DPSEAGHCDS------VTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVK 907          

HSP 3 Score: 70.0922 bits (170), Expect = 9.770e-11
Identity = 68/280 (24.29%), Postives = 120/280 (42.86%), Query Frame = -3
Query: 5385 GKCKCKENYKGPNCSECSPGFFSFQK----KCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLL-YGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEK------TKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGK----IAPVEMCLCPKGNPGIKCEAC 6179
            G C CKEN  GP C+EC  G F+ +      C  CFCS  +  C E + Y  + +TL S D  L  V+S   + G  E        +  +  + +L      Q    ++  +     +P       L+ YGGK+ ++  + +  L  +  S+  P + I   K GR+   + + +        +  + + M +NF K+      K +  RE F+  L   +++ I   +  G ++  R+ D+++E  +    L       + +E C+CP G  G  C+ C
Sbjct: 1116 GACPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGS-DQPLLRVVSQSNLRGTTEG-------VYYQAPDFLLDAATVRQ----HIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYS--LDGVGTSNFEPQVLI---KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVT-REDFMSVLSDIEYILIKASYGQG-LQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDC 1376          

HSP 4 Score: 67.781 bits (164), Expect = 4.766e-10
Identity = 71/292 (24.32%), Postives = 122/292 (41.78%), Query Frame = -3
Query: 5385 NCNSLGT--ENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGL---VYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESL-----FMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKW-MNDLGKIAPVEMCLCPKGNPGIKCEAC 6215
             CN +G+  +    G C CKEN +G  C  C PGF++ ++K    C +CFC   +  C  S  +    +   S  +  D++ S R+I    +A    +Q+ +N T   ++ +  P         Y+  KLT              +GG + +T  Y  D+  + V S++    ++  K  G   +  +     +  E        + +NF  +      K   DR+  +  L    HL I   +++  +   RL  ++++ A     DL   A VE C CP+G  G  CE+C
Sbjct:  455 GCNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCS-SLSWPVGQVNSMSGWLVTDLI-SPRKIPSQQDALGGRHQVSINNT--AVMQRLAPKYYWAAPEAYLGNKLT-------------AFGGFLKYTVSY--DIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDF----HSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSCESC 723          

HSP 5 Score: 63.929 bits (154), Expect = 6.918e-9
Identity = 80/324 (24.69%), Postives = 122/324 (37.65%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVF-LTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSN---PE-GFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP----INCVECDKN----------GNCNRCTGQRSGPKCLECKPGFVRLYGEKL--SSDCTECNC 7311
            C  CFCSG +  CS    Y ++P    S +    L+   SQ  L  +  + +Y            + Q    +P  + L   F   G  L +Y   LK ++  +  S D      V   N   + L        +VIY +   PE G   + ++++ E    + +S  E    R D ++VLSDI+Y+LI+  Y          + +++              A  +E C CP    G SC+ C  GY +        + P      CV C  N          G C  C    +G  C  C  G+   YG+    +SDC  C C
Sbjct: 1147 CSPCFCSGLSHLCSELEDYVRTPVTLGSDQP---LLRVVSQSNLRGT-TEGVYYQAPDFLLDAATVRQHIRAEPFYWRLPQQF--QGDQLMAYGGKLKYSVAFY--SLDG-----VGTSNFEPQVLIKGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGY---YGKVTGSASDCALCAC 1454          
BLAST of SMED30010499 vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 84.7297 bits (208), Expect = 2.429e-15
Identity = 50/130 (38.46%), Postives = 66/130 (50.77%), Query Frame = -2
Query: 7669 VKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8052
            V D C  N+  C++  CI     C+G  +C+DG DE   TC    C+   FSC   GG+    +C+  +WRCDG+ DC NG DE  C      TC    F C D    I R   CD + +CL+G DE +C
Sbjct:  108 VGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSC---GGR--VNRCIPQFWRCDGQVDCDNGSDEQGC---PPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC 228          

HSP 2 Score: 61.2326 bits (147), Expect = 3.470e-8
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-------LNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 8040
            CS ++  C +  CI     C+  +DC DG DE       C P  F C++         C+   W CD + DC +G DE       L   + D + C    F C     +   S+W CD  P+C +  DE+NC
Sbjct:  194 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNS-------STCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECI--HSSWRCDGGPDCKDKSDEENC 316          
BLAST of SMED30010499 vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 84.3445 bits (207), Expect = 3.386e-15
Identity = 50/130 (38.46%), Postives = 66/130 (50.77%), Query Frame = -2
Query: 7669 VKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8052
            V D C  N+  C++  CI     C+G  +C+DG DE   TC    C+   FSC   GG+    +C+  +WRCDG+ DC NG DE  C      TC    F C D    I R   CD + +CL+G DE +C
Sbjct:   23 VGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSC---GGRV--NRCIPQFWRCDGQVDCDNGSDEQGC---PPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC 143          

HSP 2 Score: 60.4622 bits (145), Expect = 5.915e-8
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-------LNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 8040
            CS ++  C +  CI     C+  +DC DG DE       C P  F C++         C+   W CD + DC +G DE       L   + D + C    F C     +   S+W CD  P+C +  DE+NC
Sbjct:  109 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNS-------STCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECI--HSSWRCDGGPDCKDKSDEENC 231          
BLAST of SMED30010499 vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 83.9593 bits (206), Expect = 4.451e-15
Identity = 50/130 (38.46%), Postives = 66/130 (50.77%), Query Frame = -2
Query: 7669 VKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8052
            V D C  N+  C++  CI     C+G  +C+DG DE   TC    C+   FSC   GG+    +C+  +WRCDG+ DC NG DE  C      TC    F C D    I R   CD + +CL+G DE +C
Sbjct:   23 VGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSC---GGRV--NRCIPQFWRCDGQVDCDNGSDEQGC---PPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC 143          

HSP 2 Score: 59.6918 bits (143), Expect = 1.013e-7
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-------LNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 8040
            CS ++  C +  CI     C+  +DC DG DE       C P  F C++         C+   W CD + DC +G DE       L   + D + C    F C     +   S+W CD  P+C +  DE+NC
Sbjct:  109 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNS-------STCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECI--HSSWRCDGGPDCKDKSDEENC 231          
BLAST of SMED30010499 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 171.785 bits (434), Expect = 5.769e-42
Identity = 201/736 (27.31%), Postives = 292/736 (39.67%), Query Frame = -2
Query: 6418 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYY------------------------QSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+ G+Y                        Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSS-GHYRTKVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDG---QQATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 713          

HSP 2 Score: 60.4622 bits (145), Expect = 2.890e-8
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = -3
Query: 6039 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYR 448          
BLAST of SMED30010499 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 161.384 bits (407), Expect = 4.184e-39
Identity = 182/706 (25.78%), Postives = 276/706 (39.09%), Query Frame = -2
Query: 6460 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITN--PDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PIN-----------CVECDKNGNCNRCTGQRSGPKCLECKP 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+  Y        +   +G+ ++   ++ ++ +   S +     ++         +   P  FL       G  + +Y   ++  I   G S      P V+L+      ++   N    +   +P     +   + +E+ N         +A R D+L VL+D+   LIR  + ++QT     + + +  +    PD +     A  +E+C CP  Y G SCE C  GYE++     +  C PI                   G C +C     GP C  C P
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFL-------GDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNG-------AAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGL-----ALEVEQCVCPPGYLGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQC-QCKASVIGPNCDRCAP 705          

HSP 2 Score: 77.411 bits (189), Expect = 1.674e-13
Identity = 88/342 (25.73%), Postives = 132/342 (38.60%), Query Frame = -2
Query: 6418 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS------------AMG-----------YYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 7356
            C    F  A      C+ CFCSG T  CS+            A G             Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:  703 CAPNSFGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 1002          

HSP 3 Score: 54.299 bits (129), Expect = 1.808e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = -3
Query: 6003 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIK 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR  +  + + D +
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAE 460          

HSP 4 Score: 53.5286 bits (127), Expect = 3.100e-6
Identity = 61/266 (22.93%), Postives = 107/266 (40.23%), Query Frame = -3
Query: 5412 VDGKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEY----NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKG 6185
              G+C+CK +  GPNC  C+P  F       + C+ CFCS  TQ+C  S  YR ++++++ A    D +    +++     Q  + Q     +   I  +      G   +  KL    + D +      YGG + +TF++    N+D   D++       I ++ K     +       + K +E+ +   +      G++      RE  +  L     L I   + N    D +L    +E A+        A VE C+CP G
Sbjct:  685 AQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCSAS-SYRRTSVSIDYARGDRDQL----ELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQT-LYWKLPEKFLGDKV----TSYGGTLEYTFKFSGNGNSDQSADVILRGND--IALQYKHREPFYADRENKVQIKIIETSWQRVD------GQQAT----REHLLMTLADLDTLLIKSTY-NDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPG 927          
BLAST of SMED30010499 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 162.155 bits (409), Expect = 4.200e-39
Identity = 184/706 (26.06%), Postives = 280/706 (39.66%), Query Frame = -2
Query: 6460 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITN--PDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PIN-----------CVECDKNGNCNRCTGQRSGPKCLECKP 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+  Y        +   +G+ ++   ++ ++ +   S +     ++         +   P  FL       G  + +Y   ++  I   G S      P V+L+  N   L     +   V+ S+     + ++I++   E  + +     +A R D+L VL+D+   LIR  + ++QT     + + +  +    PD +     A  +E+C CP  Y G SCE C  GYE++     +  C PI                   G C +C     GP C  C P
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFL-------GDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKG-NQNILVHRVRNQEHVLRSD-----SPVRITVETYETNY-EQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGL-----ALEVEQCVCPPGYLGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQC-QCKASVIGPNCDRCAP 705          

HSP 2 Score: 77.0258 bits (188), Expect = 2.577e-13
Identity = 88/342 (25.73%), Postives = 132/342 (38.60%), Query Frame = -2
Query: 6418 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS------------AMG-----------YYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 7356
            C    F  A      C+ CFCSG T  CS+            A G             Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:  703 CAPNSFGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 1002          

HSP 3 Score: 60.8474 bits (146), Expect = 2.260e-8
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = -3
Query: 6009 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSAD 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR  +  + + D
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGD 458          

HSP 4 Score: 55.0694 bits (131), Expect = 1.157e-6
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = -3
Query: 6012 GKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSA 6179
            G+C+CK +  GPNC  C+P  F       + C+ CFCS  TQ+C  S  YR ++++++ A
Sbjct:  687 GQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCSAS-SYRRTSVSIDYA 745          
BLAST of SMED30010499 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 162.155 bits (409), Expect = 4.432e-39
Identity = 184/706 (26.06%), Postives = 280/706 (39.66%), Query Frame = -2
Query: 6460 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITN--PDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PIN-----------CVECDKNGNCNRCTGQRSGPKCLECKP 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+  Y        +   +G+ ++   ++ ++ +   S +     ++         +   P  FL       G  + +Y   ++  I   G S      P V+L+  N   L     +   V+ S+     + ++I++   E  + +     +A R D+L VL+D+   LIR  + ++QT     + + +  +    PD +     A  +E+C CP  Y G SCE C  GYE++     +  C PI                   G C +C     GP C  C P
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFL-------GDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKG-NQNILVHRVRNQEHVLRSD-----SPVRITVETYETNY-EQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGL-----ALEVEQCVCPPGYLGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQC-QCKASVIGPNCDRCAP 705          

HSP 2 Score: 77.0258 bits (188), Expect = 2.877e-13
Identity = 88/342 (25.73%), Postives = 132/342 (38.60%), Query Frame = -2
Query: 6418 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS------------AMG-----------YYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 7356
            C    F  A      C+ CFCSG T  CS+            A G             Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:  703 CAPNSFGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 1002          

HSP 3 Score: 60.8474 bits (146), Expect = 2.344e-8
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = -3
Query: 6009 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSAD 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR  +  + + D
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGD 458          

HSP 4 Score: 55.0694 bits (131), Expect = 1.222e-6
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = -3
Query: 6012 GKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSA 6179
            G+C+CK +  GPNC  C+P  F       + C+ CFCS  TQ+C  S  YR ++++++ A
Sbjct:  687 GQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCSAS-SYRRTSVSIDYA 745          
BLAST of SMED30010499 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 162.155 bits (409), Expect = 4.500e-39
Identity = 184/706 (26.06%), Postives = 280/706 (39.66%), Query Frame = -2
Query: 6460 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITN--PDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PIN-----------CVECDKNGNCNRCTGQRSGPKCLECKP 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+  Y        +   +G+ ++   ++ ++ +   S +     ++         +   P  FL       G  + +Y   ++  I   G S      P V+L+  N   L     +   V+ S+     + ++I++   E  + +     +A R D+L VL+D+   LIR  + ++QT     + + +  +    PD +     A  +E+C CP  Y G SCE C  GYE++     +  C PI                   G C +C     GP C  C P
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFL-------GDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKG-NQNILVHRVRNQEHVLRSD-----SPVRITVETYETNY-EQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGL-----ALEVEQCVCPPGYLGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQC-QCKASVIGPNCDRCAP 705          

HSP 2 Score: 77.0258 bits (188), Expect = 2.638e-13
Identity = 88/342 (25.73%), Postives = 132/342 (38.60%), Query Frame = -2
Query: 6418 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS------------AMG-----------YYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 7356
            C    F  A      C+ CFCSG T  CS+            A G             Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:  703 CAPNSFGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 1002          

HSP 3 Score: 60.8474 bits (146), Expect = 2.053e-8
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = -3
Query: 6009 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSAD 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR  +  + + D
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGD 458          

HSP 4 Score: 55.4546 bits (132), Expect = 1.069e-6
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = -3
Query: 6012 GKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSA 6179
            G+C+CK +  GPNC  C+P  F       + C+ CFCS  TQ+C  S  YR ++++++ A
Sbjct:  687 GQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCSAS-SYRRTSVSIDYA 745          
BLAST of SMED30010499 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342810)

HSP 1 Score: 183.726 bits (465), Expect = 1.803e-45
Identity = 165/623 (26.48%), Postives = 254/623 (40.77%), Query Frame = -2
Query: 6538 LLVTPTEMIVRPGSSARFLCQLIG-ASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDF---------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA---QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTL----CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSA-MGYYQSPNPKTSTRTKGLLMNFKSQKIL-EVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISL----WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYY-SNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVKKCPINC 8301
            L   P   I++      F C+  G A   V W R   +        R G     L I N   ++    V E V     I    +  +                C+  Q  C N  CID++  C+G  DC D  DE+  +C+   +C+PNQF C        + KCV   WRCDGENDCG+  DE +C  +     C  + F C      IP+S  CD  P+C +G DE  C  P  + P  ++  ++     + L C     PT TI WR NWG +P +     +         T  L   +M P  +G Y+CE ++T+     +    VT + +    CE   FN  A     C++CFC G    C SA +  Y    P  S R   + ++   Q ++ E +  + +  +          ++      P + L +D+   G+ L+SY   L+  +   G  +  + GP VI+        Y         + + P G  N++ I      W+K +          A R +I+ +L+++  +LIR+ Y  S     +  N  +D   T    +G+   A  +EKC CP  Y G SCE C +GY +         CV   P +C
Sbjct: 1003 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQ--SCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEY-EVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYM--GNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGNRFTLTYR--------VRTQP-GQNNRVSIPFVPGGWQKPDG-------RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGS---ASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSC 1581          

HSP 2 Score: 80.4925 bits (197), Expect = 3.539e-14
Identity = 78/321 (24.30%), Postives = 133/321 (41.43%), Query Frame = -2
Query: 6451 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKG-----LLMNF--KSQKILEVSYAKSIYDVNSKSYKFVGKMYQD----FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKN--------GNCNRCTGQRSGPKCLECKPGFV 7356
            C+   F+  +   + C++CFCSG   DC S+  +Y+     T  R++      L+ N+   +   + VS A         +  F+G   Q     +   P  FL +     G  L     Y  +   +   +      P V++++  G+ L       S+V+ S    +  ++K S W++ +       E  A R  +L  LSDI  + I+  Y ++         T+D  +  P ++G    A  +E+C CP  Y GLSCE+C  GY ++ +          C EC+ +        G+C  C+    GP C  C  G+V
Sbjct: 1687 CKSKSFHLNSFTYTGCIECFCSGVGLDCDSST-WYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMA-----AEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNS----APDVVIKS--GEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGD-------EVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLD--VATPTNLGTP-RAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPC-ECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYV 1984          

HSP 3 Score: 68.5514 bits (166), Expect = 1.372e-10
Identity = 77/307 (25.08%), Postives = 116/307 (37.79%), Query Frame = -2
Query: 6469 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWL--ESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK--ISLWEKENWF-IDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPI---NCVECD--KNGNCN-RCTGQRSGPKCLE 7356
            C    +  +A     C +C+CSG    C SA  Y Q            + ++F     L    + ++ D  +        MY         +L   + + GS L  + +SY  +++  L  ES  +      I+   NG  L W          S P+G  NQ +  + L E E W   D      A R D + VLSD++++LIR             N  ++  +T         +A  IE C CP+ Y G SCE C   + ++    C   CP    N   CD    G    RC  +  G +C E
Sbjct: 2047 CRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQL-----------IPVDFILNAPLITDESGAVQDTENLIPDISRNMY---TYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIW----------SRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTT--RTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSC-SLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCRE 2326          

HSP 4 Score: 65.855 bits (159), Expect = 9.746e-10
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = -2
Query: 7624 DFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYV 8046
            D C  ++  C +S C+  ++ CNGI +C+DG DE    C  C  + + C+T        +CVA+  RC+G  DC +G DE +C ++    C  +  AC  N T + R   CD   +CL+G DE  C       P Q    +
Sbjct:  581 DHCLESEFEC-DSYCLPRDQLCNGIPNCQDGSDER--NCTFCREDAYLCNT-------GECVADNQRCNGIADCADGSDERHCARI---YCPPNKLAC--NGTCVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVI 706          

HSP 5 Score: 62.003 bits (149), Expect = 1.234e-8
Identity = 45/143 (31.47%), Postives = 63/143 (44.06%), Query Frame = -2
Query: 7675 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC----------------IKLDKN----TCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK 8043
            FC  +   C    C+ +N+ CNGI DC DG DE       C PN+ +C+          CV+   +CDG  DC +GYDE+ C                 KL  N    +C    + C  N+  I  S  C+E  +C +G DE+
Sbjct:  618 FCREDAYLCNTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACNGT--------CVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQC-ANLECIDSSLQCNEIKDCSDGSDEE 751          

HSP 6 Score: 62.003 bits (149), Expect = 1.522e-8
Identity = 42/139 (30.22%), Postives = 63/139 (45.32%), Query Frame = -2
Query: 7669 LIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC---IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGE-DEKNC 8073
            + + T +    C  N+  C N  CID  K CN + DC +G DE     A C   ++ C          +C++   +CDG +DC +G DE +C   +   + TC    F C D ++ I     CD   +C N   DE+ C
Sbjct:   25 VARGTYLSYGECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD------GTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYTCPKGKFTCRD-LSCISIVHRCDGRADCPNDRSDEEGC 156          

HSP 7 Score: 60.8474 bits (146), Expect = 3.182e-8
Identity = 53/172 (30.81%), Postives = 68/172 (39.53%), Query Frame = -2
Query: 7639 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC----------AQCEPNQFSCHT---------------------VGGK---PPHQ----KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8040
            C  ++  C N  CID +  CN IKDC DG DEE++ C          + C P QF C                       VG     P HQ    +C     RCD    C +G DE NC       C  + F C +N   +  SA C+    C +  DE NC   +  +PNQ
Sbjct:  719 CRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQ 882          

HSP 8 Score: 55.8398 bits (133), Expect = 9.156e-7
Identity = 129/574 (22.47%), Postives = 194/574 (33.80%), Query Frame = -3
Query: 4785 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKI-SFTFEYNTDLLKDLVFSDVTPF-----IEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKW-RIGKEGKLLEDRETFIRALMTAQHLSIG----FPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLP---------DIVCG-----RC-------------------DSPDCADCKEG----TYKYDFVLNKNFS---TCQIG-----IEMMTKGR------------------------IIYVNKDESIRIPCTAKSHRGGIAIHKW-------NKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVN--SVSNASEEFFIIVEEKPPRLAVEI-----SVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSS 6212
            C   G  +    +C CK N  G  C +C PG +      Q  C +C+CS    +C+ +  YR          I +D +L+   I        T+    V  TEN+I     P+      ++  +   T    + KY  L G  + +  F Y   L   L+      +     I +       +W+    NE  +       ED   +W R  +E      R  F+  L   QH+ I      P  +  + +V L                I   E+C CP G  G  CE+C  + Y +        P         D+V G     RC                   D P   D   G     +++D   N+  S   T QI      I  MTK R                        I+ + K E   +P             +W       N   E++ L    E  E +  NL L    +Q+SD G+Y+C+AVN  + S   +   I + +K      EI      VT  + V  ++   V     P   +V W  V DG  DA+ T +
Sbjct: 2020 CQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYR--------QLIPVDFILNAPLI--------TDESGAVQDTENLI-----PD------ISRNMYTYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDE--QWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDI---ELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTSPIIEDPPQICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRDTNDPTDIGTEDPVLTQIIVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYKENSRLP---ENVEVQGGNLYL--YDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAP---RVTWARV-DGHADAQSTRT 2552          

HSP 9 Score: 53.1434 bits (126), Expect = 7.195e-6
Identity = 60/253 (23.72%), Postives = 93/253 (36.76%), Query Frame = -2
Query: 7411 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNT--------------------------CLGSHFACDDNVTLIPRSAWCDENPNC-LNGEDEKNC--------------RHP-EVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALS 8040
            C  NQ  C N  C+  +  CNG  +C D  DE       +C PNQF C++        +CV++  RC+G  DC +  DE NC                                 C  + F C +N   I     C+   +C  +G DE +C              R P ++ +     + ++  +  +  +C       + + W    GR P    FT  + G+        L I N+  + AG Y CEA+ 
Sbjct:  838 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKC-ENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR-PLPPGFT-DRNGR--------LEIPNIRVEDAGTYVCEAVG 1072          
BLAST of SMED30010499 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342808)

HSP 1 Score: 183.341 bits (464), Expect = 2.556e-45
Identity = 165/623 (26.48%), Postives = 254/623 (40.77%), Query Frame = -2
Query: 6538 LLVTPTEMIVRPGSSARFLCQLIG-ASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDF---------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA---QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTL----CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSA-MGYYQSPNPKTSTRTKGLLMNFKSQKIL-EVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISL----WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYY-SNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVKKCPINC 8301
            L   P   I++      F C+  G A   V W R   +        R G     L I N   ++    V E V     I    +  +                C+  Q  C N  CID++  C+G  DC D  DE+  +C+   +C+PNQF C        + KCV   WRCDGENDCG+  DE +C  +     C  + F C      IP+S  CD  P+C +G DE  C  P  + P  ++  ++     + L C     PT TI WR NWG +P +     +         T  L   +M P  +G Y+CE ++T+     +    VT + +    CE   FN  A     C++CFC G    C SA +  Y    P  S R   + ++   Q ++ E +  + +  +          ++      P + L +D+   G+ L+SY   L+  +   G  +  + GP VI+        Y         + + P G  N++ I      W+K +          A R +I+ +L+++  +LIR+ Y  S     +  N  +D   T    +G+   A  +EKC CP  Y G SCE C +GY +         CV   P +C
Sbjct: 1300 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQ--SCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEY-EVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYM--GNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGNRFTLTYR--------VRTQP-GQNNRVSIPFVPGGWQKPDG-------RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGS---ASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSC 1878          

HSP 2 Score: 80.4925 bits (197), Expect = 3.647e-14
Identity = 78/321 (24.30%), Postives = 133/321 (41.43%), Query Frame = -2
Query: 6451 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKG-----LLMNF--KSQKILEVSYAKSIYDVNSKSYKFVGKMYQD----FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKN--------GNCNRCTGQRSGPKCLECKPGFV 7356
            C+   F+  +   + C++CFCSG   DC S+  +Y+     T  R++      L+ N+   +   + VS A         +  F+G   Q     +   P  FL +     G  L     Y  +   +   +      P V++++  G+ L       S+V+ S    +  ++K S W++ +       E  A R  +L  LSDI  + I+  Y ++         T+D  +  P ++G    A  +E+C CP  Y GLSCE+C  GY ++ +          C EC+ +        G+C  C+    GP C  C  G+V
Sbjct: 1984 CKSKSFHLNSFTYTGCIECFCSGVGLDCDSST-WYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMA-----AEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNS----APDVVIKS--GEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGD-------EVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLD--VATPTNLGT-PRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPC-ECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYV 2281          

HSP 3 Score: 68.5514 bits (166), Expect = 1.412e-10
Identity = 77/307 (25.08%), Postives = 116/307 (37.79%), Query Frame = -2
Query: 6469 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWL--ESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK--ISLWEKENWF-IDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPI---NCVECD--KNGNCN-RCTGQRSGPKCLE 7356
            C    +  +A     C +C+CSG    C SA  Y Q            + ++F     L    + ++ D  +        MY         +L   + + GS L  + +SY  +++  L  ES  +      I+   NG  L W          S P+G  NQ +  + L E E W   D      A R D + VLSD++++LIR             N  ++  +T         +A  IE C CP+ Y G SCE C   + ++    C   CP    N   CD    G    RC  +  G +C E
Sbjct: 2344 CRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQL-----------IPVDFILNAPLITDESGAVQDTENLIPDISRNMY---TYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIW----------SRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTT--RTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSC-SLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCRE 2623          

HSP 4 Score: 67.781 bits (164), Expect = 2.334e-10
Identity = 121/511 (23.68%), Postives = 191/511 (37.38%), Query Frame = -3
Query: 4791 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIIL-VKRNP---NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKW-RIGKEGKLLEDRETFIRALMTAQHLSIG----FPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLP---------DIVCG-----RCDSPDCAD-CKE-GTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSH-RGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVN--SVSNASEEFFIIVEEKPPRLAVEI-----SVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKET 6212
            C   G  +    +C CK N  G  C +C PG +      Q  C +C+CS    +C+ +  YR          I +D +L+   I        T+    V  TEN+I  + RN         +     L  S + + +      YGG++S++      +++     +    I +       +W+    NE  +       ED   +W R  +E      R  F+  L   QH+ I      P  +  + +V L                I   E+C CP G  G  CE+C  + Y +        P         D+V G     RC +    D C+E  T     +  ++    QI I  + K  I  V    S+ + C+ +        I  W K  E++ L    E  E +  NL L    +Q+SD G+Y+C+AVN  + S   +   I + +K      EI      VT  + V  ++   V     P   +V W  V DG  DA+ T
Sbjct: 2317 CQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYR--------QLIPVDFILNAPLI--------TDESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQL----FSYGGRLSYSL-----IVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDE--QWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDI---ELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQI-IVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYK--ENSRL---PENVEVQGGNLYL--YDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAP---RVTWARV-DGHADAQST 2785          

HSP 5 Score: 65.855 bits (159), Expect = 8.847e-10
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = -2
Query: 7624 DFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYV 8046
            D C  ++  C +S C+  ++ CNGI +C+DG DE    C  C  + + C+T        +CVA+  RC+G  DC +G DE +C ++    C  +  AC  N T + R   CD   +CL+G DE  C       P Q    +
Sbjct:  955 DHCLESEFEC-DSYCLPRDQLCNGIPNCQDGSDER--NCTFCREDAYLCNT-------GECVADNQRCNGIADCADGSDERHCARI---YCPPNKLAC--NGTCVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVI 1080          

HSP 6 Score: 62.3882 bits (150), Expect = 1.120e-8
Identity = 45/143 (31.47%), Postives = 63/143 (44.06%), Query Frame = -2
Query: 7675 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC----------------IKLDKN----TCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK 8043
            FC  +   C    C+ +N+ CNGI DC DG DE       C PN+ +C+          CV+   +CDG  DC +GYDE+ C                 KL  N    +C    + C  N+  I  S  C+E  +C +G DE+
Sbjct:  992 FCREDAYLCNTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACNGT--------CVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQC-ANLECIDSSLQCNEIKDCSDGSDEE 1125          

HSP 7 Score: 61.2326 bits (147), Expect = 2.361e-8
Identity = 42/130 (32.31%), Postives = 56/130 (43.08%), Query Frame = -2
Query: 7657 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC--IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPE 8040
            C  N+  C N  CID  K CN + DC +G DE     A C   ++ C          +C++   +CDG +DC +G DE +C     D   C    F C      IP    CD   +C +  DE NC   E
Sbjct:  492 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD------GTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTG-ECIPMRQVCDNIYDCNDYSDEVNCVEGE 614          

HSP 8 Score: 60.8474 bits (146), Expect = 2.655e-8
Identity = 53/172 (30.81%), Postives = 68/172 (39.53%), Query Frame = -2
Query: 7639 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC----------AQCEPNQFSCHT---------------------VGGK---PPHQ----KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8040
            C  ++  C N  CID +  CN IKDC DG DEE++ C          + C P QF C                       VG     P HQ    +C     RCD    C +G DE NC       C  + F C +N   +  SA C+    C +  DE NC   +  +PNQ
Sbjct: 1093 CRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQ 1256          

HSP 9 Score: 56.6102 bits (135), Expect = 6.408e-7
Identity = 55/211 (26.07%), Postives = 80/211 (37.91%), Query Frame = -2
Query: 7411 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALS 8040
            C  NQ  C N  C+  +  CNG  +C D  DE       +C PNQF C++        +CV++  RC+G  DC +  DE NC             A D N          D  PN LN             +     + ++  +  +  +C       + + W    GR P    FT  + G+        L I N+  + AG Y CEA+ 
Sbjct: 1212 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNC-------------AADSN----------DRRPNQLN-------------LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR-PLPPGFT-DRNGR--------LEIPNIRVEDAGTYVCEAVG 1369          
BLAST of SMED30010499 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342816)

HSP 1 Score: 183.341 bits (464), Expect = 2.739e-45
Identity = 165/623 (26.48%), Postives = 254/623 (40.77%), Query Frame = -2
Query: 6538 LLVTPTEMIVRPGSSARFLCQLIG-ASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDF---------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA---QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTL----CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSA-MGYYQSPNPKTSTRTKGLLMNFKSQKIL-EVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISL----WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYY-SNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVKKCPINC 8301
            L   P   I++      F C+  G A   V W R   +        R G     L I N   ++    V E V     I    +  +                C+  Q  C N  CID++  C+G  DC D  DE+  +C+   +C+PNQF C        + KCV   WRCDGENDCG+  DE +C  +     C  + F C      IP+S  CD  P+C +G DE  C  P  + P  ++  ++     + L C     PT TI WR NWG +P +     +         T  L   +M P  +G Y+CE ++T+     +    VT + +    CE   FN  A     C++CFC G    C SA +  Y    P  S R   + ++   Q ++ E +  + +  +          ++      P + L +D+   G+ L+SY   L+  +   G  +  + GP VI+        Y         + + P G  N++ I      W+K +          A R +I+ +L+++  +LIR+ Y  S     +  N  +D   T    +G+   A  +EKC CP  Y G SCE C +GY +         CV   P +C
Sbjct: 1188 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQ--SCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEY-EVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYM--GNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGNRFTLTYR--------VRTQP-GQNNRVSIPFVPGGWQKPDG-------RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGS---ASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSC 1766          

HSP 2 Score: 80.4925 bits (197), Expect = 3.375e-14
Identity = 78/321 (24.30%), Postives = 133/321 (41.43%), Query Frame = -2
Query: 6451 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKG-----LLMNF--KSQKILEVSYAKSIYDVNSKSYKFVGKMYQD----FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKN--------GNCNRCTGQRSGPKCLECKPGFV 7356
            C+   F+  +   + C++CFCSG   DC S+  +Y+     T  R++      L+ N+   +   + VS A         +  F+G   Q     +   P  FL +     G  L     Y  +   +   +      P V++++  G+ L       S+V+ S    +  ++K S W++ +       E  A R  +L  LSDI  + I+  Y ++         T+D  +  P ++G    A  +E+C CP  Y GLSCE+C  GY ++ +          C EC+ +        G+C  C+    GP C  C  G+V
Sbjct: 1872 CKSKSFHLNSFTYTGCIECFCSGVGLDCDSST-WYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMA-----AEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNS----APDVVIKS--GEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGD-------EVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLD--VATPTNLGT-PRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPC-ECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYV 2169          

HSP 3 Score: 68.5514 bits (166), Expect = 1.352e-10
Identity = 77/307 (25.08%), Postives = 116/307 (37.79%), Query Frame = -2
Query: 6469 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWL--ESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK--ISLWEKENWF-IDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP---INCVECD--KNGNCN-RCTGQRSGPKCLE 7356
            C    +  +A     C +C+CSG    C SA  Y Q            + ++F     L    + ++ D  +        MY         +L   + + GS L  + +SY  +++  L  ES  +      I+   NG  L W          S P+G  NQ +  + L E E W   D      A R D + VLSD++++LIR             N  ++  +T         +A  IE C CP+ Y G SCE C   + ++    C   CP    N   CD    G    RC  +  G +C E
Sbjct: 2232 CRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQL-----------IPVDFILNAPLITDESGAVQDTENLIPDISRNMY---TYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIW----------SRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTT--RTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSC-SLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCRE 2511          

HSP 4 Score: 68.1662 bits (165), Expect = 1.694e-10
Identity = 121/511 (23.68%), Postives = 191/511 (37.38%), Query Frame = -3
Query: 4791 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIIL-VKRNP---NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKW-RIGKEGKLLEDRETFIRALMTAQHLSIG----FPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLP---------DIVCG-----RCDSPDCAD-CKE-GTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSH-RGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVN--SVSNASEEFFIIVEEKPPRLAVEI-----SVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKET 6212
            C   G  +    +C CK N  G  C +C PG +      Q  C +C+CS    +C+ +  YR          I +D +L+   I        T+    V  TEN+I  + RN         +     L  S + + +      YGG++S++      +++     +    I +       +W+    NE  +       ED   +W R  +E      R  F+  L   QH+ I      P  +  + +V L                I   E+C CP G  G  CE+C  + Y +        P         D+V G     RC +    D C+E  T     +  ++    QI I  + K  I  V    S+ + C+ +        I  W K  E++ L    E  E +  NL L    +Q+SD G+Y+C+AVN  + S   +   I + +K      EI      VT  + V  ++   V     P   +V W  V DG  DA+ T
Sbjct: 2205 CQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYR--------QLIPVDFILNAPLI--------TDESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQL----FSYGGRLSYSL-----IVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDE--QWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDI---ELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQI-IVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYK--ENSRL---PENVEVQGGNLYL--YDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAP---RVTWARV-DGHADAQST 2673          

HSP 5 Score: 61.2326 bits (147), Expect = 2.205e-8
Identity = 42/130 (32.31%), Postives = 56/130 (43.08%), Query Frame = -2
Query: 7657 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC--IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPE 8040
            C  N+  C N  CID  K CN + DC +G DE     A C   ++ C          +C++   +CDG +DC +G DE +C     D   C    F C      IP    CD   +C +  DE NC   E
Sbjct:  492 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD------GTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTG-ECIPMRQVCDNIYDCNDYSDEVNCVEGE 614          

HSP 6 Score: 61.2326 bits (147), Expect = 2.585e-8
Identity = 53/172 (30.81%), Postives = 68/172 (39.53%), Query Frame = -2
Query: 7639 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC----------AQCEPNQFSCHT---------------------VGGK---PPHQ----KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8040
            C  ++  C N  CID +  CN IKDC DG DEE++ C          + C P QF C                       VG     P HQ    +C     RCD    C +G DE NC       C  + F C +N   +  SA C+    C +  DE NC   +  +PNQ
Sbjct:  981 CRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQ 1144          

HSP 7 Score: 56.6102 bits (135), Expect = 5.691e-7
Identity = 55/211 (26.07%), Postives = 80/211 (37.91%), Query Frame = -2
Query: 7411 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALS 8040
            C  NQ  C N  C+  +  CNG  +C D  DE       +C PNQF C++        +CV++  RC+G  DC +  DE NC             A D N          D  PN LN             +     + ++  +  +  +C       + + W    GR P    FT  + G+        L I N+  + AG Y CEA+ 
Sbjct: 1100 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNC-------------AADSN----------DRRPNQLN-------------LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR-PLPPGFT-DRNGR--------LEIPNIRVEDAGTYVCEAVG 1257          
BLAST of SMED30010499 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342814)

HSP 1 Score: 183.341 bits (464), Expect = 2.877e-45
Identity = 165/623 (26.48%), Postives = 254/623 (40.77%), Query Frame = -2
Query: 6538 LLVTPTEMIVRPGSSARFLCQLIG-ASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDF---------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA---QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTL----CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSA-MGYYQSPNPKTSTRTKGLLMNFKSQKIL-EVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISL----WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYY-SNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVKKCPINC 8301
            L   P   I++      F C+  G A   V W R   +        R G     L I N   ++    V E V     I    +  +                C+  Q  C N  CID++  C+G  DC D  DE+  +C+   +C+PNQF C        + KCV   WRCDGENDCG+  DE +C  +     C  + F C      IP+S  CD  P+C +G DE  C  P  + P  ++  ++     + L C     PT TI WR NWG +P +     +         T  L   +M P  +G Y+CE ++T+     +    VT + +    CE   FN  A     C++CFC G    C SA +  Y    P  S R   + ++   Q ++ E +  + +  +          ++      P + L +D+   G+ L+SY   L+  +   G  +  + GP VI+        Y         + + P G  N++ I      W+K +          A R +I+ +L+++  +LIR+ Y  S     +  N  +D   T    +G+   A  +EKC CP  Y G SCE C +GY +         CV   P +C
Sbjct:  776 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQ--SCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEY-EVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYM--GNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGNRFTLTYR--------VRTQP-GQNNRVSIPFVPGGWQKPDG-------RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGS---ASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSC 1354          

HSP 2 Score: 80.4925 bits (197), Expect = 3.233e-14
Identity = 78/321 (24.30%), Postives = 133/321 (41.43%), Query Frame = -2
Query: 6451 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKG-----LLMNF--KSQKILEVSYAKSIYDVNSKSYKFVGKMYQD----FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKN--------GNCNRCTGQRSGPKCLECKPGFV 7356
            C+   F+  +   + C++CFCSG   DC S+  +Y+     T  R++      L+ N+   +   + VS A         +  F+G   Q     +   P  FL +     G  L     Y  +   +   +      P V++++  G+ L       S+V+ S    +  ++K S W++ +       E  A R  +L  LSDI  + I+  Y ++         T+D  +  P ++G    A  +E+C CP  Y GLSCE+C  GY ++ +          C EC+ +        G+C  C+    GP C  C  G+V
Sbjct: 1460 CKSKSFHLNSFTYTGCIECFCSGVGLDCDSST-WYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMA-----AEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNS----APDVVIKS--GEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGD-------EVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLD--VATPTNLGTP-RAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPC-ECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYV 1757          

HSP 3 Score: 68.9366 bits (167), Expect = 1.125e-10
Identity = 121/511 (23.68%), Postives = 191/511 (37.38%), Query Frame = -3
Query: 4791 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIIL-VKRNP---NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKW-RIGKEGKLLEDRETFIRALMTAQHLSIG----FPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLP---------DIVCG-----RCDSPDCAD-CKE-GTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSH-RGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVN--SVSNASEEFFIIVEEKPPRLAVEI-----SVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKET 6212
            C   G  +    +C CK N  G  C +C PG +      Q  C +C+CS    +C+ +  YR          I +D +L+   I        T+    V  TEN+I  + RN         +     L  S + + +      YGG++S++      +++     +    I +       +W+    NE  +       ED   +W R  +E      R  F+  L   QH+ I      P  +  + +V L                I   E+C CP G  G  CE+C  + Y +        P         D+V G     RC +    D C+E  T     +  ++    QI I  + K  I  V    S+ + C+ +        I  W K  E++ L    E  E +  NL L    +Q+SD G+Y+C+AVN  + S   +   I + +K      EI      VT  + V  ++   V     P   +V W  V DG  DA+ T
Sbjct: 1793 CQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYR--------QLIPVDFILNAPLI--------TDESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQL----FSYGGRLSYSL-----IVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDE--QWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDI---ELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQI-IVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYK--ENSRL---PENVEVQGGNLYL--YDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAP---RVTWARV-DGHADAQST 2261          

HSP 4 Score: 68.5514 bits (166), Expect = 1.459e-10
Identity = 77/307 (25.08%), Postives = 116/307 (37.79%), Query Frame = -2
Query: 6469 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWL--ESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK--ISLWEKENWF-IDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP---INCVECD--KNGNCN-RCTGQRSGPKCLE 7356
            C    +  +A     C +C+CSG    C SA  Y Q            + ++F     L    + ++ D  +        MY         +L   + + GS L  + +SY  +++  L  ES  +      I+   NG  L W          S P+G  NQ +  + L E E W   D      A R D + VLSD++++LIR             N  ++  +T         +A  IE C CP+ Y G SCE C   + ++    C   CP    N   CD    G    RC  +  G +C E
Sbjct: 1820 CRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQL-----------IPVDFILNAPLITDESGAVQDTENLIPDISRNMY---TYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIW----------SRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTT--RTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSC-SLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCRE 2099          

HSP 5 Score: 62.7734 bits (151), Expect = 7.619e-9
Identity = 43/128 (33.59%), Postives = 59/128 (46.09%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFD--EEINTCAQC--EPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C  N+  C N  CID  K CN + DC +G D  EE ++  Q   E  +F+CH       ++ C++    CDG  DCG   DE + +      C G  + C      IP+S  CD  P C +  DE  C
Sbjct:  492 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECHSPPQTCLENIEFACH-------NRDCISIESVCDGIPDCGRNEDEDDAL----CKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESAC 608          

HSP 6 Score: 56.9954 bits (136), Expect = 3.815e-7
Identity = 55/211 (26.07%), Postives = 80/211 (37.91%), Query Frame = -2
Query: 7411 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALS 8040
            C  NQ  C N  C+  +  CNG  +C D  DE       +C PNQF C++        +CV++  RC+G  DC +  DE NC             A D N          D  PN LN             +     + ++  +  +  +C       + + W    GR P    FT  + G+        L I N+  + AG Y CEA+ 
Sbjct:  688 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNC-------------AADSN----------DRRPNQLN-------------LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR-PLPPGFT-DRNGR--------LEIPNIRVEDAGTYVCEAVG 845          
BLAST of SMED30010499 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342819)

HSP 1 Score: 183.341 bits (464), Expect = 2.983e-45
Identity = 165/623 (26.48%), Postives = 254/623 (40.77%), Query Frame = -2
Query: 6538 LLVTPTEMIVRPGSSARFLCQLIG-ASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDF---------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA---QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTL----CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSA-MGYYQSPNPKTSTRTKGLLMNFKSQKIL-EVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISL----WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYY-SNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVKKCPINC 8301
            L   P   I++      F C+  G A   V W R   +        R G     L I N   ++    V E V     I    +  +                C+  Q  C N  CID++  C+G  DC D  DE+  +C+   +C+PNQF C        + KCV   WRCDGENDCG+  DE +C  +     C  + F C      IP+S  CD  P+C +G DE  C  P  + P  ++  ++     + L C     PT TI WR NWG +P +     +         T  L   +M P  +G Y+CE ++T+     +    VT + +    CE   FN  A     C++CFC G    C SA +  Y    P  S R   + ++   Q ++ E +  + +  +          ++      P + L +D+   G+ L+SY   L+  +   G  +  + GP VI+        Y         + + P G  N++ I      W+K +          A R +I+ +L+++  +LIR+ Y  S     +  N  +D   T    +G+   A  +EKC CP  Y G SCE C +GY +         CV   P +C
Sbjct: 1340 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNG----RLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQ--SCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEY-EVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYM--GNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGNRFTLTYR--------VRTQP-GQNNRVSIPFVPGGWQKPDG-------RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGS---ASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIPDSC 1918          

HSP 2 Score: 80.4925 bits (197), Expect = 3.776e-14
Identity = 78/321 (24.30%), Postives = 133/321 (41.43%), Query Frame = -2
Query: 6451 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKG-----LLMNF--KSQKILEVSYAKSIYDVNSKSYKFVGKMYQD----FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKN--------GNCNRCTGQRSGPKCLECKPGFV 7356
            C+   F+  +   + C++CFCSG   DC S+  +Y+     T  R++      L+ N+   +   + VS A         +  F+G   Q     +   P  FL +     G  L     Y  +   +   +      P V++++  G+ L       S+V+ S    +  ++K S W++ +       E  A R  +L  LSDI  + I+  Y ++         T+D  +  P ++G    A  +E+C CP  Y GLSCE+C  GY ++ +          C EC+ +        G+C  C+    GP C  C  G+V
Sbjct: 2024 CKSKSFHLNSFTYTGCIECFCSGVGLDCDSST-WYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMA-----AEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNS----APDVVIKS--GEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGD-------EVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLD--VATPTNLGT-PRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPC-ECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYV 2321          

HSP 3 Score: 68.5514 bits (166), Expect = 1.356e-10
Identity = 77/307 (25.08%), Postives = 116/307 (37.79%), Query Frame = -2
Query: 6469 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWL--ESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK--ISLWEKENWF-IDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPI---NCVECD--KNGNCN-RCTGQRSGPKCLE 7356
            C    +  +A     C +C+CSG    C SA  Y Q            + ++F     L    + ++ D  +        MY         +L   + + GS L  + +SY  +++  L  ES  +      I+   NG  L W          S P+G  NQ +  + L E E W   D      A R D + VLSD++++LIR             N  ++  +T         +A  IE C CP+ Y G SCE C   + ++    C   CP    N   CD    G    RC  +  G +C E
Sbjct: 2384 CRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQL-----------IPVDFILNAPLITDESGAVQDTENLIPDISRNMY---TYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIW----------SRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTT--RTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSC-SLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCRE 2663          

HSP 4 Score: 67.781 bits (164), Expect = 2.131e-10
Identity = 121/513 (23.59%), Postives = 192/513 (37.43%), Query Frame = -3
Query: 4785 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIIL-VKRNP---NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKW-RIGKEGKLLEDRETFIRALMTAQHLSIG----FPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLP---------DIVCG-----RCDSPDCAD-CKE-GTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSH-RGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVN--SVSNASEEFFIIVEEKPPRLAVEI-----SVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSS 6212
            C   G  +    +C CK N  G  C +C PG +      Q  C +C+CS    +C+ +  YR          I +D +L+   I        T+    V  TEN+I  + RN         +     L  S + + +      YGG++S++      +++     +    I +       +W+    NE  +       ED   +W R  +E      R  F+  L   QH+ I      P  +  + +V L                I   E+C CP G  G  CE+C  + Y +        P         D+V G     RC +    D C+E  T     +  ++    QI I  + K  I  V    S+ + C+ +        I  W K  E++ L    E  E +  NL L    +Q+SD G+Y+C+AVN  + S   +   I + +K      EI      VT  + V  ++   V     P   +V W  V DG  DA+ T +
Sbjct: 2357 CQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYR--------QLIPVDFILNAPLI--------TDESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQL----FSYGGRLSYSL-----IVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDE--QWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDI---ELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQI-IVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYK--ENSRL---PENVEVQGGNLYL--YDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAP---RVTWARV-DGHADAQSTRT 2827          

HSP 5 Score: 65.855 bits (159), Expect = 8.930e-10
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = -2
Query: 7624 DFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYV 8046
            D C  ++  C +S C+  ++ CNGI +C+DG DE    C  C  + + C+T        +CVA+  RC+G  DC +G DE +C ++    C  +  AC  N T + R   CD   +CL+G DE  C       P Q    +
Sbjct:  995 DHCLESEFEC-DSYCLPRDQLCNGIPNCQDGSDER--NCTFCREDAYLCNT-------GECVADNQRCNGIADCADGSDERHCARI---YCPPNKLAC--NGTCVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVI 1120          

HSP 6 Score: 62.3882 bits (150), Expect = 1.103e-8
Identity = 45/143 (31.47%), Postives = 63/143 (44.06%), Query Frame = -2
Query: 7675 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC----------------IKLDKN----TCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK 8043
            FC  +   C    C+ +N+ CNGI DC DG DE       C PN+ +C+          CV+   +CDG  DC +GYDE+ C                 KL  N    +C    + C  N+  I  S  C+E  +C +G DE+
Sbjct: 1032 FCREDAYLCNTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACNGT--------CVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQC-ANLECIDSSLQCNEIKDCSDGSDEE 1165          

HSP 7 Score: 61.2326 bits (147), Expect = 2.305e-8
Identity = 42/130 (32.31%), Postives = 56/130 (43.08%), Query Frame = -2
Query: 7657 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC--IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPE 8040
            C  N+  C N  CID  K CN + DC +G DE     A C   ++ C          +C++   +CDG +DC +G DE +C     D   C    F C      IP    CD   +C +  DE NC   E
Sbjct:  532 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD------GTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTG-ECIPMRQVCDNIYDCNDYSDEVNCVEGE 654          

HSP 8 Score: 61.2326 bits (147), Expect = 2.591e-8
Identity = 53/172 (30.81%), Postives = 68/172 (39.53%), Query Frame = -2
Query: 7639 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC----------AQCEPNQFSCHT---------------------VGGK---PPHQ----KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8040
            C  ++  C N  CID +  CN IKDC DG DEE++ C          + C P QF C                       VG     P HQ    +C     RCD    C +G DE NC       C  + F C +N   +  SA C+    C +  DE NC   +  +PNQ
Sbjct: 1133 CRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQ 1296          

HSP 9 Score: 56.6102 bits (135), Expect = 6.360e-7
Identity = 55/211 (26.07%), Postives = 80/211 (37.91%), Query Frame = -2
Query: 7411 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALS 8040
            C  NQ  C N  C+  +  CNG  +C D  DE       +C PNQF C++        +CV++  RC+G  DC +  DE NC             A D N          D  PN LN             +     + ++  +  +  +C       + + W    GR P    FT  + G+        L I N+  + AG Y CEA+ 
Sbjct: 1252 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNC-------------AADSN----------DRRPNQLN-------------LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR-PLPPGFT-DRNGR--------LEIPNIRVEDAGTYVCEAVG 1409          
BLAST of SMED30010499 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 206.068 bits (523), Expect = 5.945e-62
Identity = 168/616 (27.27%), Postives = 263/616 (42.69%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFT-VHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEK--PMFNNAAMFVS------------MCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCK--CTGRERNDPLCDKC 8040
            C  +Q  C+N  CI     C+G  DC DG DE    T + CEPN+F C        + +C    WRCDG+NDC +  DE+NC  K     C    F C  +   IP S  CDE P+C +  DE  C  P V +  +E+      + +++  C  + VP   I WR NWG +P     T + + G+        LTI ++     G YTCEA++ K  +   + I     +L +K  P+ +++   ++             C+ CFC G T  C S   Y      + +     KG+ ++F S+  L    + +   +N ++ +F         +D + F +      G+ ++SY  YLK  +    +     P   P V+L     K +Y       E  + +    +N  +I   E ENW  + +   +  R D++  L++++ + IR  Y +        + ++D         GN    PR +E+C CP  Y+GLSCE C  G+E+        C    C  +   CD  +G+C  C  +  G +C +CKPGF          DC  C C     +   S+ C  D   Q     C+   TGR      C+KC
Sbjct:  264 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGD-TVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLV---FAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQSTGRYRNQITLRFTEEEDFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIY----RRGEPTFPD---TFNSREIRFTE-ENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGN----PREVEECRCPAGYSGLSCESCSPGFERVPGPYLGICAGCNCNGHASACDPVSGHCLSCQHKTEGAQCEKCKPGFFGDPSRGQYDDCKPCPCPYTETSRRFSDTCFLDHDNQATCDACREGYTGRR-----CEKC 843          

HSP 2 Score: 55.0694 bits (131), Expect = 5.945e-62
Identity = 76/329 (23.10%), Postives = 126/329 (38.30%), Query Frame = -3
Query: 5301 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEYNT-------DLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVK----DVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6212
            C++ GT N +   C CK N  G  C EC  G F       + CL+CFC   T++C  S        T +   ++  V   N Q+  +  A NT       RT +  + +R   ++  VY +     + + +DI  + L           YGG++ +   Y         D   D+V      F+E  S+       +        T+   F E     WR   +G+    RE  + AL       I   + +   +    ++++ D+ + H+       +   VE C CP+G  G  C+ C+ VGY          P +  G C+  +C
Sbjct:  868 CDNRGTINPISKPCYCKSNVAGALCDECKTGAFHLTADNPEGCLQCFCMGVTKQCASS--------TWSRDQVRGGV---NGQLFTLSNAANT-------RTISEGITQRGSTEV--VYRSF----TNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQGSGIFLEHYSQ-------IKPLPRVPATITVTFRES---AWRRA-DGQPCT-REHLLMALADINVFMIRATYADNMAETSLSNIQM-DIAVPHSTGNE---RAMEVEECACPQGYSGPSCQDCD-VGYTRT-------PGLYLGTCEKCEC 1148          

HSP 3 Score: 73.559 bits (179), Expect = 1.458e-27
Identity = 92/372 (24.73%), Postives = 142/372 (38.17%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKC----TGRERNDPLCDKC 7356
            C+   F+  A     CL+CFC G T  C+S+           + +   L     ++ I E    +   +V  +S+  +      +V+  N          G  + +Y   LK  +R    ++  +    P V+LQ   G  ++       + +   P       + S W + +            R  +L  L+DI   +IR  Y  N       N  +D  I  P S GN   A  +E+C CP  Y+G SC+ C  GY +        C K +C  +   CD + G+C  C     G +C  C  G+   YG   + D   C  C C  Q +N   S  C   L   G  VC+C    TGR      C++C
Sbjct:  895 CKTGAFHLTADNPEGCLQCFCMGVTKQCASSTWSRDQVRGGVNGQLFTLSNAANTRTISEGITQRGSTEVVYRSFTNIHNDIFYWVLPQN--------FRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQ---GSGIFLEHYSQIKPLPRVPATITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMD--IAVPHSTGNE-RAMEVEECACPQGYSGPSCQDCDVGYTRTPGLYLGTCEKCECHGHASSCDSETGDCLNCLHNTIGRRCENCISGY---YGNPKTGDPQACRPCPCLGQTSNQPSS--CY--LGSDGQPVCECPAGYTGRR-----CERC 1233          

HSP 4 Score: 72.4034 bits (176), Expect = 1.458e-27
Identity = 76/292 (26.03%), Postives = 112/292 (38.36%), Query Frame = -3
Query: 5385 CNSLGTENIVD-GKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVN-RTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEY----NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFME------DNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6212
            C+  G+E     G C+CK N +GP CS C  G F      +  CL CFC   TQ+C  S  YR    T+ S        L NRQ          +N   V   TE   L   N N +G      +L  +   D +      YGGK+ +T  Y        ++D     +   I + +++   +W       +++  E +F E      D  P  R      L +  +  IRA   + H  +     +G   DV + + T         L +   VE C CP G  G+ C+ C
Sbjct: 1259 CDQSGSEGCSGTGVCRCKMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQ-----RTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQGDKVGA----YGGKLKYTISYVPGPRGSPIEDADVQIIGNDITLVARQ---IWQRGHGARESQDFEIVFREEHWQRPDGMPATREHLMMVLADLDDILIRA---SYHTEMRSSSISGVHMDVAVPEYT--------SLAQALEVEQCQCPPGYSGLSCQDC 1527          

HSP 5 Score: 67.3958 bits (163), Expect = 3.658e-10
Identity = 85/385 (22.08%), Postives = 132/385 (34.29%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGY------------YQSPNPKTSTRTKGLLMNFK---SQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEV---IYSNPEGFYNQLKISL-WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C++  F+ +      CL CFC G T  C+S+  Y            YQ        RT  +   F    S +  ++SY    Y      Y  + K YQ                 G  + +Y   LK  I         +PGP+     +    +    ND + V   I+    G        + + +E+W         A R  ++ VL+D+  +LIR  Y++           +D  +    S+   +    +E+C CP  Y+GLSC+ C +GY +      +  C     EC+        + G C  C     G  C +C  GF          DC  C C         S  C  +  G G   C           C++C
Sbjct: 1287 CKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQ-----------------GDKVGAYGGKLKYTISY-------VPGPRG--SPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHW--QRPDGMPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQAL---EVEQCQCPPGYSGLSCQDCASGYTRTGGGLYLGHC--EPCECNGHSDTCHPETGICTNCQHNTKGELCEQCVDGFFGDPTAGTPEDCQPCACPGTDPENQFSRTC--ESLGNGGYQCTACQPGYLGQYCERC 1636          

HSP 6 Score: 55.4546 bits (132), Expect = 1.874e-6
Identity = 66/267 (24.72%), Postives = 115/267 (43.07%), Query Frame = -3
Query: 5361 CSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLN---SADIK-LDVVLSNRQISGVYEAQNTNNQLLVNRTENIILV---KRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEI--ESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIE-HAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENV 6131
            C  G FS    C+ CFC   T++C+ + +YR + +TL      D K ++V   +R   G+ +  ++   L+   TE   LV   +R  +Q     +  +   + V          YGG + F   Y+  L +      V P + +    +KF       +F +   + E  F E+N+        G+ +  R+  +  L   + + I   +DN  +  V L D++++   K  +  G    VE C CP G  G+ CE+C+  G+E V
Sbjct:  496 CRDGHFSVGGHCMPCFCFGITKKCQSTGRYR-NQITLRFTEEEDFKGVNVSFPSR--PGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDS--------YGGYLKFKVSYS--LQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFPDTFNSREIRFTEENWEH----SNGRAVT-RDDLMMTLANLESIHIRTIYDN-RMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCESCSP-GFERV 742          
BLAST of SMED30010499 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 205.682 bits (522), Expect = 7.437e-62
Identity = 168/616 (27.27%), Postives = 263/616 (42.69%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFT-VHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEK--PMFNNAAMFVS------------MCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCK--CTGRERNDPLCDKC 8040
            C  +Q  C+N  CI     C+G  DC DG DE    T + CEPN+F C        + +C    WRCDG+NDC +  DE+NC  K     C    F C  +   IP S  CDE P+C +  DE  C  P V +  +E+      + +++  C  + VP   I WR NWG +P     T + + G+        LTI ++     G YTCEA++ K  +   + I     +L +K  P+ +++   ++             C+ CFC G T  C S   Y      + +     KG+ ++F S+  L    + +   +N ++ +F         +D + F +      G+ ++SY  YLK  +    +     P   P V+L     K +Y       E  + +    +N  +I   E ENW  + +   +  R D++  L++++ + IR  Y +        + ++D         GN    PR +E+C CP  Y+GLSCE C  G+E+        C    C  +   CD  +G+C  C  +  G +C +CKPGF          DC  C C     +   S+ C  D   Q     C+   TGR      C+KC
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGD-TVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLV---FAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQSTGRYRNQITLRFTEEEDFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIY----RRGEPTFPD---TFNSREIRFTE-ENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGN----PREVEECRCPAGYSGLSCESCSPGFERVPGPYLGICAGCNCNGHASACDPVSGHCLSCQHKTEGAQCEKCKPGFFGDPSRGQYDDCKPCPCPYTETSRRFSDTCFLDHDNQATCDACREGYTGRR-----CEKC 778          

HSP 2 Score: 55.4546 bits (132), Expect = 7.437e-62
Identity = 76/329 (23.10%), Postives = 126/329 (38.30%), Query Frame = -3
Query: 5301 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEYNT-------DLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVK----DVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6212
            C++ GT N +   C CK N  G  C EC  G F       + CL+CFC   T++C  S        T +   ++  V   N Q+  +  A NT       RT +  + +R   ++  VY +     + + +DI  + L           YGG++ +   Y         D   D+V      F+E  S+       +        T+   F E     WR   +G+    RE  + AL       I   + +   +    ++++ D+ + H+       +   VE C CP+G  G  C+ C+ VGY          P +  G C+  +C
Sbjct:  803 CDNRGTINPISKPCYCKSNVAGALCDECKTGAFHLTADNPEGCLQCFCMGVTKQCASS--------TWSRDQVRGGV---NGQLFTLSNAANT-------RTISEGITQRGSTEV--VYRSF----TNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQGSGIFLEHYSQ-------IKPLPRVPATITVTFRES---AWRRA-DGQPCT-REHLLMALADINVFMIRATYADNMAETSLSNIQM-DIAVPHSTGNE---RAMEVEECACPQGYSGPSCQDCD-VGYTRT-------PGLYLGTCEKCEC 1083          

HSP 3 Score: 73.559 bits (179), Expect = 1.610e-27
Identity = 92/372 (24.73%), Postives = 142/372 (38.17%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKC----TGRERNDPLCDKC 7356
            C+   F+  A     CL+CFC G T  C+S+           + +   L     ++ I E    +   +V  +S+  +      +V+  N          G  + +Y   LK  +R    ++  +    P V+LQ   G  ++       + +   P       + S W + +            R  +L  L+DI   +IR  Y  N       N  +D  I  P S GN   A  +E+C CP  Y+G SC+ C  GY +        C K +C  +   CD + G+C  C     G +C  C  G+   YG   + D   C  C C  Q +N   S  C   L   G  VC+C    TGR      C++C
Sbjct:  830 CKTGAFHLTADNPEGCLQCFCMGVTKQCASSTWSRDQVRGGVNGQLFTLSNAANTRTISEGITQRGSTEVVYRSFTNIHNDIFYWVLPQN--------FRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQ---GSGIFLEHYSQIKPLPRVPATITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMD--IAVPHSTGNE-RAMEVEECACPQGYSGPSCQDCDVGYTRTPGLYLGTCEKCECHGHASSCDSETGDCLNCLHNTIGRRCENCISGY---YGNPKTGDPQACRPCPCLGQTSNQPSS--CY--LGSDGQPVCECPAGYTGRR-----CERC 1168          

HSP 4 Score: 72.4034 bits (176), Expect = 1.610e-27
Identity = 76/292 (26.03%), Postives = 112/292 (38.36%), Query Frame = -3
Query: 5385 CNSLGTENIVD-GKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVN-RTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEY----NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFME------DNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6212
            C+  G+E     G C+CK N +GP CS C  G F      +  CL CFC   TQ+C  S  YR    T+ S        L NRQ          +N   V   TE   L   N N +G      +L  +   D +      YGGK+ +T  Y        ++D     +   I + +++   +W       +++  E +F E      D  P  R      L +  +  IRA   + H  +     +G   DV + + T         L +   VE C CP G  G+ C+ C
Sbjct: 1194 CDQSGSEGCSGTGVCRCKMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQ-----RTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQGDKVGA----YGGKLKYTISYVPGPRGSPIEDADVQIIGNDITLVARQ---IWQRGHGARESQDFEIVFREEHWQRPDGMPATREHLMMVLADLDDILIRA---SYHTEMRSSSISGVHMDVAVPEYT--------SLAQALEVEQCQCPPGYSGLSCQDC 1462          

HSP 5 Score: 67.3958 bits (163), Expect = 4.007e-10
Identity = 85/385 (22.08%), Postives = 132/385 (34.29%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGY------------YQSPNPKTSTRTKGLLMNFK---SQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEV---IYSNPEGFYNQLKISL-WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C++  F+ +      CL CFC G T  C+S+  Y            YQ        RT  +   F    S +  ++SY    Y      Y  + K YQ                 G  + +Y   LK  I         +PGP+     +    +    ND + V   I+    G        + + +E+W         A R  ++ VL+D+  +LIR  Y++           +D  +    S+   +    +E+C CP  Y+GLSC+ C +GY +      +  C     EC+        + G C  C     G  C +C  GF          DC  C C         S  C  +  G G   C           C++C
Sbjct: 1222 CKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQ-----------------GDKVGAYGGKLKYTISY-------VPGPRG--SPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHW--QRPDGMPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQAL---EVEQCQCPPGYSGLSCQDCASGYTRTGGGLYLGHC--EPCECNGHSDTCHPETGICTNCQHNTKGELCEQCVDGFFGDPTAGTPEDCQPCACPGTDPENQFSRTC--ESLGNGGYQCTACQPGYLGQYCERC 1571          

HSP 6 Score: 55.4546 bits (132), Expect = 1.665e-6
Identity = 66/267 (24.72%), Postives = 115/267 (43.07%), Query Frame = -3
Query: 5361 CSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLN---SADIK-LDVVLSNRQISGVYEAQNTNNQLLVNRTENIILV---KRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEI--ESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIE-HAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENV 6131
            C  G FS    C+ CFC   T++C+ + +YR + +TL      D K ++V   +R   G+ +  ++   L+   TE   LV   +R  +Q     +  +   + V          YGG + F   Y+  L +      V P + +    +KF       +F +   + E  F E+N+        G+ +  R+  +  L   + + I   +DN  +  V L D++++   K  +  G    VE C CP G  G+ CE+C+  G+E V
Sbjct:  431 CRDGHFSVGGHCMPCFCFGITKKCQSTGRYR-NQITLRFTEEEDFKGVNVSFPSR--PGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDS--------YGGYLKFKVSYS--LQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFPDTFNSREIRFTEENWEH----SNGRAVT-RDDLMMTLANLESIHIRTIYDN-RMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCESCSP-GFERV 677          
BLAST of SMED30010499 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 205.682 bits (522), Expect = 8.147e-62
Identity = 168/616 (27.27%), Postives = 263/616 (42.69%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFT-VHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEK--PMFNNAAMFVS------------MCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCK--CTGRERNDPLCDKC 8040
            C  +Q  C+N  CI     C+G  DC DG DE    T + CEPN+F C        + +C    WRCDG+NDC +  DE+NC  K     C    F C  +   IP S  CDE P+C +  DE  C  P V +  +E+      + +++  C  + VP   I WR NWG +P     T + + G+        LTI ++     G YTCEA++ K  +   + I     +L +K  P+ +++   ++             C+ CFC G T  C S   Y      + +     KG+ ++F S+  L    + +   +N ++ +F         +D + F +      G+ ++SY  YLK  +    +     P   P V+L     K +Y       E  + +    +N  +I   E ENW  + +   +  R D++  L++++ + IR  Y +        + ++D         GN    PR +E+C CP  Y+GLSCE C  G+E+        C    C  +   CD  +G+C  C  +  G +C +CKPGF          DC  C C     +   S+ C  D   Q     C+   TGR      C+KC
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGD-TVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLV---FAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQSTGRYRNQITLRFTEEEDFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIY----RRGEPTFPD---TFNSREIRFTE-ENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGN----PREVEECRCPAGYSGLSCESCSPGFERVPGPYLGICAGCNCNGHASACDPVSGHCLSCQHKTEGAQCEKCKPGFFGDPSRGQYDDCKPCPCPYTETSRRFSDTCFLDHDNQATCDACREGYTGRR-----CEKC 778          

HSP 2 Score: 55.4546 bits (132), Expect = 8.147e-62
Identity = 76/329 (23.10%), Postives = 126/329 (38.30%), Query Frame = -3
Query: 5301 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEYNT-------DLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVK----DVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6212
            C++ GT N +   C CK N  G  C EC  G F       + CL+CFC   T++C  S        T +   ++  V   N Q+  +  A NT       RT +  + +R   ++  VY +     + + +DI  + L           YGG++ +   Y         D   D+V      F+E  S+       +        T+   F E     WR   +G+    RE  + AL       I   + +   +    ++++ D+ + H+       +   VE C CP+G  G  C+ C+ VGY          P +  G C+  +C
Sbjct:  803 CDNRGTINPISKPCYCKSNVAGALCDECKTGAFHLTADNPEGCLQCFCMGVTKQCASS--------TWSRDQVRGGV---NGQLFTLSNAANT-------RTISEGITQRGSTEV--VYRSF----TNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQGSGIFLEHYSQ-------IKPLPRVPATITVTFRES---AWRRA-DGQPCT-REHLLMALADINVFMIRATYADNMAETSLSNIQM-DIAVPHSTGNE---RAMEVEECACPQGYSGPSCQDCD-VGYTRT-------PGLYLGTCEKCEC 1083          

HSP 3 Score: 73.1738 bits (178), Expect = 1.520e-27
Identity = 92/372 (24.73%), Postives = 142/372 (38.17%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKC----TGRERNDPLCDKC 7356
            C+   F+  A     CL+CFC G T  C+S+           + +   L     ++ I E    +   +V  +S+  +      +V+  N          G  + +Y   LK  +R    ++  +    P V+LQ   G  ++       + +   P       + S W + +            R  +L  L+DI   +IR  Y  N       N  +D  I  P S GN   A  +E+C CP  Y+G SC+ C  GY +        C K +C  +   CD + G+C  C     G +C  C  G+   YG   + D   C  C C  Q +N   S  C   L   G  VC+C    TGR      C++C
Sbjct:  830 CKTGAFHLTADNPEGCLQCFCMGVTKQCASSTWSRDQVRGGVNGQLFTLSNAANTRTISEGITQRGSTEVVYRSFTNIHNDIFYWVLPQN--------FRGDKVTAYGGELKYRVRYEPHARSMVIDGQPDVVLQ---GSGIFLEHYSQIKPLPRVPATITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMD--IAVPHSTGNE-RAMEVEECACPQGYSGPSCQDCDVGYTRTPGLYLGTCEKCECHGHASSCDSETGDCLNCLHNTIGRRCENCISGY---YGNPKTGDPQACRPCPCLGQTSNQPSS--CY--LGSDGQPVCECPAGYTGRR-----CERC 1168          

HSP 4 Score: 72.7886 bits (177), Expect = 1.520e-27
Identity = 76/292 (26.03%), Postives = 112/292 (38.36%), Query Frame = -3
Query: 5385 CNSLGTENIVD-GKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVN-RTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEY----NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFME------DNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6212
            C+  G+E     G C+CK N +GP CS C  G F      +  CL CFC   TQ+C  S  YR    T+ S        L NRQ          +N   V   TE   L   N N +G      +L  +   D +      YGGK+ +T  Y        ++D     +   I + +++   +W       +++  E +F E      D  P  R      L +  +  IRA   + H  +     +G   DV + + T         L +   VE C CP G  G+ C+ C
Sbjct: 1194 CDQSGSEGCSGTGVCRCKMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQ-----RTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQGDKVGA----YGGKLKYTISYVPGPRGSPIEDADVQIIGNDITLVARQ---IWQRGHGARESQDFEIVFREEHWQRPDGMPATREHLMMVLADLDDILIRA---SYHTEMRSSSISGVHMDVAVPEYT--------SLAQALEVEQCQCPPGYSGLSCQDC 1462          

HSP 5 Score: 67.0106 bits (162), Expect = 4.938e-10
Identity = 85/385 (22.08%), Postives = 132/385 (34.29%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGY------------YQSPNPKTSTRTKGLLMNFK---SQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEV---IYSNPEGFYNQLKISL-WEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C++  F+ +      CL CFC G T  C+S+  Y            YQ        RT  +   F    S +  ++SY    Y      Y  + K YQ                 G  + +Y   LK  I         +PGP+     +    +    ND + V   I+    G        + + +E+W         A R  ++ VL+D+  +LIR  Y++           +D  +    S+   +    +E+C CP  Y+GLSC+ C +GY +      +  C     EC+        + G C  C     G  C +C  GF          DC  C C         S  C  +  G G   C           C++C
Sbjct: 1222 CKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNYLGQEPHYWQLPKAYQ-----------------GDKVGAYGGKLKYTISY-------VPGPRG--SPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHW--QRPDGMPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQAL---EVEQCQCPPGYSGLSCQDCASGYTRTGGGLYLGHC--EPCECNGHSDTCHPETGICTNCQHNTKGELCEQCVDGFFGDPTAGTPEDCQPCACPGTDPENQFSRTC--ESLGNGGYQCTACQPGYLGQYCERC 1571          

HSP 6 Score: 55.4546 bits (132), Expect = 1.623e-6
Identity = 66/267 (24.72%), Postives = 115/267 (43.07%), Query Frame = -3
Query: 5361 CSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLN---SADIK-LDVVLSNRQISGVYEAQNTNNQLLVNRTENIILV---KRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEI--ESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIE-HAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENV 6131
            C  G FS    C+ CFC   T++C+ + +YR + +TL      D K ++V   +R   G+ +  ++   L+   TE   LV   +R  +Q     +  +   + V          YGG + F   Y+  L +      V P + +    +KF       +F +   + E  F E+N+        G+ +  R+  +  L   + + I   +DN  +  V L D++++   K  +  G    VE C CP G  G+ CE+C+  G+E V
Sbjct:  431 CRDGHFSVGGHCMPCFCFGITKKCQSTGRYR-NQITLRFTEEEDFKGVNVSFPSR--PGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDS--------YGGYLKFKVSYS--LQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFPDTFNSREIRFTEENWEH----SNGRAVT-RDDLMMTLANLESIHIRTIYDN-RMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCESCSP-GFERV 677          
BLAST of SMED30010499 vs. Ensembl Zebrafish
Match: lama1 (laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-1])

HSP 1 Score: 79.337 bits (194), Expect = 2.705e-16
Identity = 86/381 (22.57%), Postives = 156/381 (40.94%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKI----SLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQ-------------CVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYG--EKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C+   F  +A+  + C  CFC G +D C    G  ++P    S+     L+   SQ  L+ +  + +Y  + +    V ++ +  ++    +       +G+ L SY   L   +  F +    +    P+V+L+  + + L         VIY++     N ++     +L E +  + +S  + +    D ++VLS+++Y++I+  Y S        N +++  +   +       A  +E C CP  Y GLSC++C  GY +   ++             CV  +C  +   CD   G C  C    +G  C  C  G+   YG  +   SDC+ C C   L     S+ C+  L G G   C           C++C
Sbjct: 1134 CKSGSFGLSALNPAGCSPCFCFGLSDVCEELSGLVRAPIVLGSSPA---LLRVVSQSDLQGTL-EGVYYSDDEMLLDVDQLNKLSLLTGPYYWRLPQKYNGNKLLSYGGRLSYTLTFFAQDGVGLANQEPQVLLRGGHLRKL---------VIYTDASAPANGIRSTQEHALTEHKWKYFNSVSDEAVSHADFMSVLSNLEYVIIKASYGSGLQQSRISNISMETALEADELPEGGDVARLVEICECPPGYAGLSCQECAPGYYRQAVSELNMKGRNRPLIQPCVPCRCSNHSQSCDLHTGQCLGCQHNTAGEHCHVCAAGY---YGKVQGSVSDCSLCTC--PLRGQSFSSTCV--LEGAGDFRCDRCEEGYEGRYCERC 1494          

HSP 2 Score: 28.8758 bits (63), Expect = 2.705e-16
Identity = 9/31 (29.03%), Postives = 16/31 (51.61%), Query Frame = -3
Query: 6087 GKCKCKENYKGPNCSECSPGFFSFQKKCLKC 6179
            G+C+CK   +G  C +C        ++C+ C
Sbjct: 1529 GRCECKPGVRGHLCDQCEERHVLVHEQCVSC 1559          

HSP 3 Score: 78.9518 bits (193), Expect = 1.308e-13
Identity = 87/358 (24.30%), Postives = 144/358 (40.22%), Query Frame = -2
Query: 6328 LCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLT--SDFGMDGSWLESYSYYLKINIRLFGESKDDIPGP-----KVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNI--YAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVC 7359
            LC++  +N  A     C +CFC G +D C S+  +  S          G+L       I   S+   + D N      +     D   DP+   T  +      + L SY  +L  ++  +  S++++         VI++  NG++L       S  +  N    +   ++ +      FIDS    S  R +++ VL+D+  L +R +   +  G       + HV        +++   +  +E C CP  Y+G SCE C+ G+ +         C+  +C  +  ECD NG C  C    +GP C +C PGF     E    DC  C+C   L +   S  C   L   G  +C
Sbjct:  490 LCKQGFYNLQASNPEGCTECFCFGVSDVCESSTWFSSS-----VVHRDGVLHRLHQTSI---SFWSPVSDEN----LIISNRSTD--ADPSSVWTWAAPEPFLNNKLTSYGSFLNYSV-AYDTSEENVDKTLRSHFSVIIEG-NGRTLRQA---QSARLLLNA---HTHQRVFVQMLPQIFIDSHSGRSVQRDELMTVLADVAALRVRAELEDSAEG----TLRLSHVSLGVGDSNSDVSKISLDVEHCECPWGYSGTSCELCIPGFYRVGGILFGGNCLPCECNDHATECDINGECLGCAHNTTGPHCDQCLPGFYGDASEGTPDDCQRCSCPLTLASNNFSPTCQ--LQAPGEFIC 819          

HSP 4 Score: 51.2174 bits (121), Expect = 2.321e-11
Identity = 69/294 (23.47%), Postives = 124/294 (42.18%), Query Frame = -3
Query: 5355 GKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEA-QNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLL-YGGKISFTFEYNTDLLKDLV-FSDVTPFIEIESKKFGRL--WTVLS--FNEKTKTMESLFMEDNFPKWR----IGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDL---GKIAP-VEMCLCPKGNPGIKCEACNKVGYENVIN 6179
            G+C CK+N  G  C EC  G F         C  CFC   +  C+E      + + L S+   L VV S   + G  E    +++++L+           + +Q+  + +        +P   +   LL YGG++S+T  +     +D V  ++  P + +      +L  +T  S   N    T E    E    KW+    +  E     D   F+  L   +++ I   + +G ++  R+ ++++E A   ++L   G +A  VE+C CP G  G+ C+ C    Y   ++
Sbjct: 1118 GQCSCKDNVGGRGCDECKSGSFGLSALNPAGCSPCFCFGLSDVCEELSGLVRAPIVLGSSPALLRVV-SQSDLQGTLEGVYYSDDEMLL-----------DVDQLNKLSLLTGPYYWRLPQKYNGNKLLSYGGRLSYTLTF---FAQDGVGLANQEPQVLLRGGHLRKLVIYTDASAPANGIRSTQEHALTEH---KWKYFNSVSDEAVSHAD---FMSVLSNLEYVIIKASYGSG-LQQSRISNISMETALEADELPEGGDVARLVEICECPPGYAGLSCQECAPGYYRQAVS 1389          

HSP 5 Score: 40.0466 bits (92), Expect = 2.321e-11
Identity = 40/131 (30.53%), Postives = 51/131 (38.93%), Query Frame = -2
Query: 6283 KCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQ------RSGPKCLECKPGFVRLYGEKLSSDCTECNCYS----QLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6645
            +C C T  TG  C++C  GY    +N C       C     +GNCN  TG+        G KC +C  G    +G    S C  CNC +         L S  C+  L   G    +C    RN P C  C
Sbjct:  971 RCQCITGVTGDKCDRCHHGYYNFKENGCTA-----CDCAHTHGNCNDQTGECICPPHTHGLKCEQCDEGH---WGHDGVSGCKVCNCSAVGSSSSQCDLSSGQCVCALQFSGLTCDRCALGYRNFPQCSAC 1093          

HSP 6 Score: 46.2098 bits (108), Expect = 1.535e-8
Identity = 44/143 (30.77%), Postives = 60/143 (41.96%), Query Frame = -2
Query: 6241 CPTPYTGLSCEKCLAGY--EKNDQNQCVKKC-------PINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSS-DCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCK 6636
            C   YTG  C++C  GY  E     Q    C       P     CD + G C +C G  +GP C  C+ G+   YG+ +   +C  C CYS   N  +S IC   +TGQ    C+C         CD+C +    I     C+
Sbjct:  822 CQPGYTGDKCQRCADGYFGEPAVPGQRCSPCECNGNVDPSEAGRCDTHTGECLKCVGHTAGPHCERCRDGY---YGDAIQEKNCQACGCYS---NGSLSTIC-NLITGQ----CECK-HNVVGKTCDRCQEGYHGINSGEGCR 952          

HSP 7 Score: 35.039 bits (79), Expect = 1.535e-8
Identity = 12/44 (27.27%), Postives = 23/44 (52.27%), Query Frame = -3
Query: 6054 DGKCKCKENYKGPNCSECSPGFFSFQKK-CLKCFCSNKTQECKE 6182
            +G+C+C     G  C  C  G+++F++  C  C C++    C +
Sbjct:  969 EGRCQCITGVTGDKCDRCHHGYYNFKENGCTACDCAHTHGNCND 1012          
BLAST of SMED30010499 vs. Ensembl Zebrafish
Match: lrp1ba (low density lipoprotein receptor-related protein 1Ba [Source:ZFIN;Acc:ZDB-GENE-050208-608])

HSP 1 Score: 86.6557 bits (213), Expect = 5.854e-16
Identity = 52/130 (40.00%), Postives = 62/130 (47.69%), Query Frame = -2
Query: 7678 TLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8061
            T +    C +NQ AC  + CI +   C+G  DC DG DE    C  A C P  FSC      P    CV+  W CDGE DC +G DEL       NTC  S F C  N   IPR   CD + +C +  DE
Sbjct: 2659 TELTNSSCLWNQFACSKNKCISKQWLCDGEDDCGDGLDESQEICGSASCSPGLFSC------PGSYACVSRNWLCDGERDCPDGSDELALAGSPNNTCTDSTFQC-RNQNCIPRRFVCDHDDDCGDASDE 2781          

HSP 2 Score: 62.3882 bits (150), Expect = 1.291e-8
Identity = 39/131 (29.77%), Postives = 56/131 (42.75%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-------EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS  Q  C +  CI E+  C+G  DC D  DE        I+    C   +F C   G       C+   WRCDG+ DC +G DE  C    +     + F C  +   + +   CD + +C +  DE+ C
Sbjct:  983 CSVAQFQCSSGKCIPEHWMCDGDNDCGDLSDENATCSRTAISAINDCSEKEFHCRGDG------TCIPEIWRCDGDKDCEDGSDEFACEGAKRMCDPKAKFTCKVSGKCVSKDWVCDGDIDCEDQSDEEGC 1107          

HSP 3 Score: 58.5362 bits (140), Expect = 1.905e-7
Identity = 43/158 (27.22%), Postives = 61/158 (38.61%), Query Frame = -2
Query: 7678 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPP----------------------------------HQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8043
             C  +Q  C N+ CI +   C+G  DC    DE   TC+   C+P QF C      P                                   + KC++  W CD E+DCG+G DE+ C+    + C  + F C      IP    CD + +C +  DE
Sbjct:  862 ICPADQFKCLNNRCIPKRWLCDGTDDCGSNEDESNRTCSAQTCQPGQFPCANGRCIPENWRCDRDDDCGDQSDESSSCDFPTCEPLTQFGCTNGKCISVKWHCDSEDDCGDGSDEVGCV----HACSVAQFQCSSG-KCIPEHWMCDGDNDCGDLSDE 1014          
BLAST of SMED30010499 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 209.92 bits (533), Expect = 1.605e-60
Identity = 174/605 (28.76%), Postives = 253/605 (41.82%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFN---NAAMFV---SMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQ-KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C  ++  C N  CI  +  C+G KDC+DG DE    T + CEPN+F C        + +C    WRCDG+NDCG+G DELNC  K   +TC    F C    T IP S  CD+  +C +  DE  C  P+V+ P +E+      + ++   C  + VPT  I WR NWG +P   +  V  T ++ +     L I ++     G YTCEA++     AK     +    L  KP        + +V   + C+ CFC G T  C     Y      +       KG+     S   I  +S  +   D + + ++ V    +   +D    L   F   G+ ++SY   L   +R  L     + +  P VIL   NG+ L +       V  S      NQ KI   E ENW  +S    S  R D+L  L +++ ++I+  Y +        +  +D        +G  +    +E+C CP  Y G SCE C A +E+      +  C   NC      CD  +G C  C     GP+C +CK GF       +S  C  C C         S+ C  D+ GQ              P CD C
Sbjct:  252 CRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIP--TSSRVSMTSENGH---GTLIIRDVKEADQGAYTCEAIN-----AKGMVFGIPDGVLILKPHRGPCPEGSFYVENSARCIPCFCFGVTKVCQQTGRYRNQIRLRFDVPEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFLSIDSFWTLPGQF--LGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVG-NGRKLIY------RVQTSTQPSIVNQRKIQFTE-ENWQHESG--ASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAV---GVEECRCPGGYAGPSCEVCAAQFERVPGGPFLGTCSGCNCNGHASSCDPVSGYCLNCQHNTEGPQCNKCKAGFFGDPTRGVSDACRPCPCPHTDPRRRFSDTCFMDVDGQ--------------PTCDSC 809          

HSP 2 Score: 47.3654 bits (111), Expect = 1.605e-60
Identity = 68/293 (23.21%), Postives = 109/293 (37.20%), Query Frame = -3
Query: 5385 GKCK----CKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNR-QISGVYEAQNTNNQLLVNRT--ENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFP----KWRI--GKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6179
            G+C+     + + +G  C+EC  G F   +K    CLKCFC   T++C  S                      NR Q+SG Y    T +     RT  E+I    R   Q  L +         VP D++ + L           YGG++ +T  +        +F    P + ++          L  +  T+T     +    P     WR   G++      RE  + AL     L I   +    V + R+ ++ ++ A  +  D  +   VE C+CP G  G  C+ C
Sbjct:  834 GRCEPPLLSQSHVEGNFCNECKSGTFYLSEKNPDGCLKCFCMGITRQCSSS--------------------FWNRDQVSGCYRVPFTISNAGSTRTLSESI----RVTGQSELTFSNF----LNVPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQ--PDVVLQGNGI-----FLEHSANTRTAPGFPITITVPFRERAWRRADGQDAT----REHLLMALADIDLLMIRASYAERMV-ETRISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQVC 1086          

HSP 3 Score: 62.3882 bits (150), Expect = 2.031e-8
Identity = 72/325 (22.15%), Postives = 120/325 (36.92%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQ---SPNPKTSTRTKGLLMNFKSQKI---LEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYS----YYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSN------PEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PINC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            CL CFC G T  C+S+  + +   +P    + +   L+   +S +I     V  ++    +   S+  +G+         + +     G  G  + SY     Y L  N  + G +  D               +    ND + V Y +       + F    + S W++ +          A R  ++  L+D+  +L+R  Y ++         +++   T   S  N   A  +E+C CP  Y GLSC+ C  GY +      +  C P  C      C  + G C+ C     G  C +C PGF          DC  C C
Sbjct: 1233 CLPCFCMGVTQQCTSSTYHRKLISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQE--------SYYWQLPEGYQGDKVASYGGKLRYTLTYNAGIRGSALPD-------------ADVQITGNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDG-------QPATREHLMMALADLDEILVRASYSTDMLSSSITGVSME---TAGPSYTNLPQALEVEECRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEPCYCNGHSESCHPETGACSNCLHNTVGESCDQCAPGFYGDASAGTPEDCQPCAC 1526          

HSP 4 Score: 57.7658 bits (138), Expect = 4.257e-7
Identity = 62/284 (21.83%), Postives = 105/284 (36.97%), Query Frame = -3
Query: 5385 KCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTEN--------IILVKRNP-------NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6176
            +C+CK N +G +C  C P  F    +    CL CFC   TQ+C  S  +R                   + IS  +   N  N  LVNR  +        + + +  P       +Q+G      +L      D +      YGGK+ +T  YN       +     P  +++    G   T++++    +  ES   E  F +    +       RE  + AL     + +   +    +    +  +++E A     +L +   VE C CP G  G+ C+ C
Sbjct: 1203 QCECKPNVEGASCGTCRPHHFYLSTENPDGCLPCFCMGVTQQCTSSTYHR-------------------KLISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQESYYWQLPEGYQGDKVAS----YGGKLRYTLTYNAG-----IRGSALPDADVQIT--GNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDGQPATREHLMMALADLDEILVRASYSTDMLSS-SITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLSCQDC 1455          
BLAST of SMED30010499 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 211.846 bits (538), Expect = 1.840e-58
Identity = 174/605 (28.76%), Postives = 250/605 (41.32%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFN---NAAMFV---SMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQ-KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C  ++  C N  CI  +  C+G KDC+DG DE    T + CEPN+F C        + +C    WRCDG+NDCG+G DELNC  K   +TC    F C    T IP S  CD+  +C +  DE  C  P+V+ P +E+      + ++   C  + VPT  I WR NWG +P   +   H T          L I ++     G YTCEA++     AK     +    L  KP        + +V   + C+ CFC G T  C     Y      +       KG+     S   I  +S  +   D + + ++ V    +   +D    L   F   G+ ++SY   L   +R  L     + +  P VIL   NG+ L +       V  S      NQ KI   E ENW  +S    S  R D+L  L +++ ++I+  Y +        +  +D        +G  +    +E+C CP  Y G SCE C A +E+      +  C   NC      CD  +G C  C     GP+C +CK GF       +S  C  C C         S+ C  D+ GQ              P CD C
Sbjct:  195 CRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIPTSSSENGHGT----------LIIRDVKEADQGAYTCEAIN-----AKGMVFGIPDGVLILKPHRGPCPEGSFYVENSARCIPCFCFGVTKVCQQTGRYRNQIRLRFDVPEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFLSIDSFWTLPGQF--LGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVG-NGRKLIY------RVQTSTQPSIVNQRKIQFTE-ENWQHESG--ASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAV---GVEECRCPGGYAGPSCEVCAAQFERVPGGPFLGTCSGCNCNGHASSCDPVSGYCLNCQHNTEGPQCNKCKAGFFGDPTRGVSDACRPCPCPHTDPRRRFSDTCFMDVDGQ--------------PTCDSC 747          

HSP 2 Score: 38.5058 bits (88), Expect = 1.840e-58
Identity = 18/51 (35.29%), Postives = 27/51 (52.94%), Query Frame = -3
Query: 6051 GKCK----CKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKES 6179
            G+C+     + + +G  C+EC  G F   +K    CLKCFC   T++C  S
Sbjct:  772 GRCEPPLLSQSHVEGNFCNECKSGTFYLSEKNPDGCLKCFCMGITRQCSSS 822          

HSP 3 Score: 62.3882 bits (150), Expect = 1.763e-8
Identity = 72/325 (22.15%), Postives = 120/325 (36.92%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQ---SPNPKTSTRTKGLLMNFKSQKI---LEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYS----YYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSN------PEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PINC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            CL CFC G T  C+S+  + +   +P    + +   L+   +S +I     V  ++    +   S+  +G+         + +     G  G  + SY     Y L  N  + G +  D               +    ND + V Y +       + F    + S W++ +          A R  ++  L+D+  +L+R  Y ++         +++   T   S  N   A  +E+C CP  Y GLSC+ C  GY +      +  C P  C      C  + G C+ C     G  C +C PGF          DC  C C
Sbjct: 1137 CLPCFCMGVTQQCTSSTYHRKLISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQE--------SYYWQLPEGYQGDKVASYGGKLRYTLTYNAGIRGSALPD-------------ADVQITGNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDG-------QPATREHLMMALADLDEILVRASYSTDMLSSSITGVSME---TAGPSYTNLPQALEVEECRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEPCYCNGHSESCHPETGACSNCLHNTVGESCDQCAPGFYGDASAGTPEDCQPCAC 1430          
BLAST of SMED30010499 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 207.994 bits (528), Expect = 2.231e-58
Identity = 174/605 (28.76%), Postives = 254/605 (41.98%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFN---NAAMFV---SMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRT--KGLLMNFKSQ-KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C  ++  C N  CI  +  C+G KDC+DG DE    T + CEPN+F C        + +C    WRCDG+NDCG+G DELNC  K   +TC    F C    T IP S  CD+  +C +  DE  C  P+V+ P +E+      + ++   C  + VPT  I WR NWG +P   +  V  T ++ +     L I ++     G YTCEA++     AK     +    L  KP        + +V   + C+ CFC G T  C     Y      +       KG+     S   I  +S  +   D + + ++ V    +   +D   F T      G+ ++SY   L   +R  L     + +  P VIL   NG+ L +       V  S      NQ KI   E ENW  +S    S  R D+L  L +++ ++I+  Y +        +  +D        +G  +    +E+C CP  Y G SCE C A +E+      +  C   NC      CD  +G C  C     GP+C +CK GF       +S  C  C C     +   S+ C  D+ GQ              P CD C
Sbjct:  219 CRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIP--TSSRVSMTSENGH---GTLIIRDVKEADQGAYTCEAIN-----AKGMVFGIPDGVLILKPHRGPCPEGSFYVENSARCIPCFCFGVTKVCQQTGRYRNQIRLRFDVPEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFLSID--SFWTLPGQFLGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVG-NGRKLIY------RVQTSTQPSIVNQRKIQFTE-ENWQHESG--ASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAV---GVEECRCPGGYAGPSCEVCAAQFERVPGGPFLGTCSGCNCNGHASSCDPVSGYCLNCQHNTEGPQCNKCKAGFFGDPTRGVSDACRPCPC--PHTDPRFSDTCFMDVDGQ--------------PTCDSC 774          

HSP 2 Score: 41.9726 bits (97), Expect = 2.231e-58
Identity = 68/293 (23.21%), Postives = 109/293 (37.20%), Query Frame = -3
Query: 5385 GKCK----CKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNR-QISGVYEAQNTNNQLLVNRT--ENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFP----KWRI--GKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6179
            G+C+     + + +G  C+EC  G F   +K    CLKCFC   T++C  S                      NR Q+SG Y    T +     RT  E+I    R   Q  L +         VP D++ + L           YGG++ +T  +        +F    P + ++          L  +  T+T     +    P     WR   G++      RE  + AL     L I   +    V + R+ ++ ++ A  +  D  +   VE C+CP G  G  C+ C
Sbjct:  799 GRCEPPLLSQSHVEGNFCNECKSGTFYLSEKNPDGCLKCFCMGITRQCSSS--------------------FWNRDQVSG-YRVPFTISNAGSTRTLSESI----RVTGQSELTFSNF----LNVPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQ--PDVVLQGNGI-----FLEHSANTRTAPGFPITITVPFRERAWRRADGQDAT----REHLLMALADIDLLMIRASYAERMV-ETRISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQVC 1050          

HSP 3 Score: 62.3882 bits (150), Expect = 1.822e-8
Identity = 72/325 (22.15%), Postives = 120/325 (36.92%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQ---SPNPKTSTRTKGLLMNFKSQKI---LEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYS----YYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSN------PEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PINC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            CL CFC G T  C+S+  + +   +P    + +   L+   +S +I     V  ++    +   S+  +G+         + +     G  G  + SY     Y L  N  + G +  D               +    ND + V Y +       + F    + S W++ +          A R  ++  L+D+  +L+R  Y ++         +++   T   S  N   A  +E+C CP  Y GLSC+ C  GY +      +  C P  C      C  + G C+ C     G  C +C PGF          DC  C C
Sbjct: 1183 CLPCFCMGVTQQCTSSTYHRKLISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQE--------SYYWQLPEGYQGDKVASYGGKLRYTLTYNAGIRGSALPD-------------ADVQITGNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDG-------QPATREHLMMALADLDEILVRASYSTDMLSSSITGVSME---TAGPSYTNLPQALEVEECRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEPCYCNGHSESCHPETGACSNCLHNTVGESCDQCAPGFYGDASAGTPEDCQPCAC 1476          

HSP 4 Score: 56.9954 bits (136), Expect = 8.365e-7
Identity = 62/284 (21.83%), Postives = 105/284 (36.97%), Query Frame = -3
Query: 5385 KCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTEN--------IILVKRNP-------NQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6176
            +C+CK N +G +C  C P  F    +    CL CFC   TQ+C  S  +R                   + IS  +   N  N  LVNR  +        + + +  P       +Q+G      +L      D +      YGGK+ +T  YN       +     P  +++    G   T++++    +  ES   E  F +    +       RE  + AL     + +   +    +    +  +++E A     +L +   VE C CP G  G+ C+ C
Sbjct: 1153 QCECKPNVEGASCGTCRPHHFYLSTENPDGCLPCFCMGVTQQCTSSTYHR-------------------KLISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQESYYWQLPEGYQGDKVAS----YGGKLRYTLTYNAG-----IRGSALPDADVQIT--GNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDGQPATREHLMMALADLDEILVRASYSTDMLSS-SITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLSCQDC 1405          
BLAST of SMED30010499 vs. Ensembl Xenopus
Match: LAMA5 (laminin subunit alpha 5 [Source:NCBI gene;Acc:100145762])

HSP 1 Score: 71.2478 bits (173), Expect = 2.009e-14
Identity = 78/316 (24.68%), Postives = 134/316 (42.41%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKI-LEVSYAKSIYDVNSKSYKFVGKMYQDFVVD-PNVFLTSDFGMDGSWLESYSYYLK--INIRLFGESKDDIP---GPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PINCV----EC-DKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            C +CFC G TD C +A  +      + S     +L+    Q++ + V   + + D N +    V  +YQ+F    P  +L       G  + SY  +L+  ++ +     + +IP    P +IL+       +  T         + E ++ ++ +     E  F+         R +++ VL++++ LLIR     + +        +D  I +  S+G  + AP +E C CP  Y G SC++C  GY ++ +   + KC P NC     +C    G C +C     G +C  CK GFV       S  C  C C
Sbjct: 1559 CTRCFCFGATDRCHTASKH----RAEFSDMNGWVLVGGDRQEVEISVRPEEGLVDANLED---VPDVYQEFYWHAPRSYL-------GDRVSSYGGFLRYELHSKAIRGDQPNIPVERRPDIILKGNQMSIAHLQTR-----YPMSGEHYHGRIHLV----EGNFVHVQTYNPVSREELMMVLANLEQLLIRALNSQSSSSVSLRRVFLD--IGHESSVG--VRAPEVELCMCPANYRGDSCQECAPGYYRDTKGLFLGKCVPCNCGGHSDQCLPGTGACVKCQHNTEGDRCERCKDGFVSNGTVDGSLQCVSCPC 1847          

HSP 2 Score: 31.187 bits (69), Expect = 2.009e-14
Identity = 26/85 (30.59%), Postives = 40/85 (47.06%), Query Frame = -3
Query: 6060 CVINAYRNLCQLLMNETAKKRDLSENKNCNSLGTE-NIVDGKCK-CKENYKGPNCSECSPGFFS---FQKKCLKCFCSN-KTQEC 6296
            C    Y N   +++  + K  D + N + N L ++ + + G C  C  N  G +C  C+PGF+      K C +C CS   TQ C
Sbjct: 1883 CAPGFYGN--PMVIGSSCKPCDCNGNTDSNMLFSDCDPLFGTCSSCMFNTAGTHCEVCAPGFYGDAVRAKNCTRCDCSPCGTQSC 1965          
BLAST of SMED30010499 vs. Ensembl Xenopus
Match: rabggtb (Rab geranylgeranyltransferase subunit beta [Source:Xenbase;Acc:XB-GENE-953600])

HSP 1 Score: 78.5666 bits (192), Expect = 2.561e-13
Identity = 48/132 (36.36%), Postives = 74/132 (56.06%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNCRHP 8040
            CS +Q  C ++ CI  +  C+G  DC D  DE + + CA   C P +F+C  +  +PP ++C+   W CDG+ DC + YDE  NC    + +C  S FAC + + +  RS + CD   +C +G DE+ C +P
Sbjct: 2892 CSSDQFRCDDARCIPASWICDGDNDCGDMSDEDQRHNCANRSCAPTEFTC--INNRPPERRCIPQSWVCDGDADCSDAYDEHQNCT---RRSCSSSEFACANGLCV--RSNFRCDRRNDCGDGSDERGCIYP 3016          

HSP 2 Score: 73.559 bits (179), Expect = 8.497e-12
Identity = 42/123 (34.15%), Postives = 62/123 (50.41%), Query Frame = -2
Query: 7672 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKN 8040
            C   Q  C +  CID +  C+G KDC DG DE +     C  ++F C +        +C++  ++CDG  DC +  DELNC       C  + F C  +   IP +  CD +P+C++G DE N
Sbjct: 1142 CEPGQFQCPDHRCIDPSYVCDGDKDCVDGSDE-MGCTYNCSYSEFKCAS------GDQCISTGYQCDGVFDCNDHSDELNCPTRPAGMCHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEHN 1257          

HSP 3 Score: 67.3958 bits (163), Expect = 5.241e-10
Identity = 42/127 (33.07%), Postives = 57/127 (44.88%), Query Frame = -2
Query: 7639 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8019
            C N  C+     C+G+ DC D  DE     A C     +C +      + +C+   WRCD  NDC +  DE NC      +C  + F C +N   IPR   CD + +C +G DE NC       P Q
Sbjct: 1026 CANGKCVPVYDRCDGVDDCHDNSDE-----ANCGTRNNTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQNN-RCIPRIWLCDTDNDCGDGSDELNCNFTSTCEPGQ 1146          

HSP 4 Score: 67.0106 bits (162), Expect = 6.910e-10
Identity = 45/126 (35.71%), Postives = 61/126 (48.41%), Query Frame = -2
Query: 7660 CR-NSICIDENKFCNGIKDCEDGFDEEINTCAQCEP-NQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR----HP 8019
            CR N  C+     CNG  DC D  DE+      C+P   F C        + +C+   W+CDG+NDC +G DE NC   +   C  S F C DN+  IP    CD + +C +  DE++C     HP
Sbjct: 3672 CRTNYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCD-------NHRCIPLRWKCDGDNDCNDGSDERNCSPRE---CTESEFRC-DNLRCIPGRWICDHDNDCEDNSDERDCEIRTCHP 3786          

HSP 5 Score: 65.0846 bits (157), Expect = 2.800e-9
Identity = 45/126 (35.71%), Postives = 61/126 (48.41%), Query Frame = -2
Query: 7663 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH 8040
            CS     C N  CI  N  C+   DC D  DE+   C    P   SC +      + +C+   W CD +NDCG+G DELNC     +TC    F C D+  + P S  CD + +C++G DE  C +
Sbjct: 1060 CSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQ--NCPTQGPR--SCSSTSFTCQNNRCIPRIWLCDTDNDCGDGSDELNCNF--TSTCEPGQFQCPDHRCIDP-SYVCDGDKDCVDGSDEMGCTY 1178          

HSP 6 Score: 64.6994 bits (156), Expect = 4.364e-9
Identity = 46/139 (33.09%), Postives = 65/139 (46.76%), Query Frame = -2
Query: 7636 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDE---EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQE 8040
            CS+++  C +   CI     C+G+ DC D  DE          C  N+F C + G       C+ + W CDG  DC +G DE N   +   +C  S F CD N   I RS  CD + +C +  DEK+C  P    P+ +
Sbjct: 1180 CSYSEFKCASGDQCISTGYQCDGVFDCNDHSDELNCPTRPAGMCHQNEFQCQSDGA------CIPSNWECDGHPDCIDGSDEHNTCPV--RSCPPSMFRCD-NGNCIYRSWICDGDNDCRDMSDEKDCPTPPFRCPSWQ 1309          

HSP 7 Score: 63.929 bits (154), Expect = 6.804e-9
Identity = 41/124 (33.06%), Postives = 60/124 (48.39%), Query Frame = -2
Query: 7678 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8043
            +C   Q  C +  C      CN   DC DG DE+   CA  QC+ +Q+ C        +++C+   W+CD E+DCG+  DE +       TC    F C +N   IP+S  CD + +C +  DE
Sbjct: 3538 YCRVGQFQCNDGNCTSSYFMCNSYPDCPDGSDEDQILCANHQCDTHQWQC-------ANKRCIPESWQCDQEDDCGDNSDE-DSAHCSTRTCNPGQFRC-NNGRCIPQSWKCDVDDDCGDHSDE 3652          

HSP 8 Score: 62.7734 bits (151), Expect = 1.398e-8
Identity = 47/144 (32.64%), Postives = 64/144 (44.44%), Query Frame = -2
Query: 7678 VYECVHNNLLIKATLIVKDFCSFNQRACR-NSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8100
            V++C  ++  +         C  N+  C+ +  CI  N  C+G  DC DG DE  NTC    C P+ F C        +  C+   W CDG+NDC +  DE +C       C    + C  N   I  S  CD  P+C NG DE
Sbjct: 1203 VFDCNDHSDELNCPTRPAGMCHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEH-NTCPVRSCPPSMFRCD-------NGNCIYRSWICDGDNDCRDMSDEKDC-PTPPFRCPSWQWQCPGNTICINVSKVCDNTPDCPNGADE 1337          

HSP 9 Score: 62.003 bits (149), Expect = 2.493e-8
Identity = 45/127 (35.43%), Postives = 56/127 (44.09%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            CS  Q  C +  CI     C+ +KDC DG DE    C      + SC +         C     RCDG  DC +  DE NC +     CL S F C      IPR   CD + +C +  DEKNC +P
Sbjct:  104 CSAQQFTCSSGQCIPRAYRCDRMKDCTDGADER--NCLYPVCTELSCGS-------GACYNRSQRCDGIVDCRDSSDESNCTQ----RCLSSQFQCPSG-ECIPRDFLCDHDDDCGDESDEKNCTYP 216          

HSP 10 Score: 58.5362 bits (140), Expect = 2.538e-7
Identity = 46/130 (35.38%), Postives = 60/130 (46.15%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCI--KLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNG--EDEKNC 8040
            C   +  C N  CI E   C+   DC DG DE    CA   C    F+C        + +CV  ++RCD  NDCG+  DEL C+    D NT     F C +N   I R+  C+   NC +    DE+NC
Sbjct: 2686 CENGKFTCLNGRCIPERHKCDNDNDCRDGSDELERVCAFHTCPSTSFTCG-------NGRCVPYHYRCDHYNDCGDNSDELGCLFRTCDPNT----EFTC-NNGRCISRAYVCNGVNNCFDNGTSDERNC 2803          

HSP 11 Score: 58.5362 bits (140), Expect = 2.854e-7
Identity = 39/136 (28.68%), Postives = 61/136 (44.85%), Query Frame = -2
Query: 7663 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDD--------NVTLIPRSAWCDENPNCLNGEDEKNCRH 8040
            C  +Q  C N  CI E+  C+   DC D  DE+   C+   C P QF C+       + +C+   W+CD ++DCG+  DE          C+G  + CD+        N   +P  + C+   +C +  DE+ C  
Sbjct: 3580 CDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSAHCSTRTCNPGQFRCN-------NGRCIPQSWKCDVDDDCGDHSDEP------FQECMGPAYRCDNHTDFDCRTNYRCVPMWSVCNGYDDCRDNSDEQGCEQ 3702          

HSP 12 Score: 56.6102 bits (135), Expect = 9.535e-7
Identity = 42/129 (32.56%), Postives = 55/129 (42.64%), Query Frame = -2
Query: 7663 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH 8040
            C      CR++ ICI     C+G  DC D  DE    C    C  ++F C +        +C+  +W CD   DC +G DE         TC    F CDD    IP S  CD + +C +  DE   RH
Sbjct: 2808 CQPGYTKCRSTNICIPRTYLCDGDNDCGDMSDESPTHCVTLTCTESEFRCSS-------GRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSSDQFRCDD-ARCIPASWICDGDNDCGDMSDEDQ-RH 2927          

HSP 13 Score: 55.8398 bits (133), Expect = 1.911e-6
Identity = 40/130 (30.77%), Postives = 58/130 (44.62%), Query Frame = -2
Query: 7669 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPN-QFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8043
            +C  +   C+N +CI     C+G  DC DG DEE+  C    CEP  +F C        + +CV  +  C+G +DC +G DE    C       C    + C  N   +P    CD+  +C +  DE  C
Sbjct: 3827 YCPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHCLDIPCEPPFRFRCG-------NNRCVYRHEICNGVDDCSDGSDETEEQCEPPTPRPCTDEEYKC-GNHFCVPLHYVCDDYDDCGDHSDEAGC 3948          

HSP 14 Score: 55.8398 bits (133), Expect = 2.078e-6
Identity = 42/125 (33.60%), Postives = 61/125 (48.80%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL-NCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS ++ AC N +C+  N  C+   DC DG DE    C      Q       G+     C++  + CDG+NDCG+  DEL +     + TC   +F C DN   I + + C+ N +C +  DEK C
Sbjct: 2979 CSSSEFACANGLCVRSNFRCDRRNDCGDGSDER--GCIYPTCQQQQFTCQNGR-----CISKAFVCDGDNDCGDESDELEHTCTTSEATCNPHYFKC-DNWICIAQGSVCNGNDDCGDNSDEKAC 3095          

HSP 15 Score: 55.8398 bits (133), Expect = 2.113e-6
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = -2
Query: 7675 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNT--CLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEK 8040
            C+ ++  C N  CI     C+   DCED  DE       C P  F C++         C+A  +RCDG  DC +  DE  C     N   C  S F C ++V + P   W CD + +C +G DE+
Sbjct: 3745 CTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDCEIRTCHPGYFQCNS-------GHCIAERFRCDGTADCLDVSDEAACPTRYPNGTYCPASMFECKNHVCIQP--YWRCDGDNDCGDGSDEE 3860          

HSP 16 Score: 54.299 bits (129), Expect = 5.136e-6
Identity = 42/122 (34.43%), Postives = 55/122 (45.08%), Query Frame = -2
Query: 7660 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGED--EKNCRHP 8019
            C +  CI E   C+G  DC D  DE    C    PN   C     +  +  C+  YWRCDG+NDCG+G DE     LD        F C +N   + R   C+   +C +G D  E+ C  P
Sbjct: 3791 CNSGHCIAERFRCDGTADCLDVSDEA--ACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHCLDIPCEPPFRFRCGNN-RCVYRHEICNGVDDCSDGSDETEEQCEPP 3909          
BLAST of SMED30010499 vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 204.142 bits (518), Expect = 1.976e-59
Identity = 170/619 (27.46%), Postives = 260/619 (42.00%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ---CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMF---NNAAMFVSMCLKCFCSGQTDDCSSAMGY-------YQSPNPKTSTRTKGLLMNFKSQ--------KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C   + +C +  CI  +  C+G +DC DG DE    CA    CEPN+F+C        +  C    WRCDG+ DC +  DE NC +K     C  +HF C      IP S  CDE  +C +  DE  C  P+VV P Q++        +++  C    VPT  INWR NWG +P     T+   G         L I ++     G YTCEA++++     +       V  +  C    F   ++A+     CL CFC G T+ C S++ +       +  PN       KG+ +   SQ          L++  A   + +   S +F+  ++  F   P  FL       G+ ++SY  +L+  +R  L     + +  P VIL    G  L+      S        G  NQ ++ L E E+W  +S       R ++L  L+ ++ +L++  Y +        +  +D  +T+    G    A  +E+C CP  Y+GLSCE C A + +      +  C   NC      CD   G+C  C     GP+C +CKPGF     +  ++ C  C C     +   S+ C  D  GQ    C           C+ C
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDEL--GCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQ-TVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGG-----RGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSAS-----CLPCFCFGVTNVCQSSLRFRDQIRLSFDQPND-----FKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFL--VHDAFWALPKQFL-------GNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGA-GYRLH------SRGHTPTHPGTLNQRQVQLSE-EHWVHESG--RPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGR---AHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQA--TCDACAPGYTGRRCESC 854          

HSP 2 Score: 48.9062 bits (115), Expect = 1.976e-59
Identity = 23/62 (37.10%), Postives = 31/62 (50.00%), Query Frame = -3
Query: 6039 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6212
            C+  G+       C+CK N  G  C+ECS G F   K+    CLKCFC   +++C  S   R
Sbjct:  879 CDERGSLGTSGETCRCKNNVVGRLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSR 940          

HSP 3 Score: 72.4034 bits (176), Expect = 3.225e-13
Identity = 84/365 (23.01%), Postives = 131/365 (35.89%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDC-------SSAMGYYQSPN-------PKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINI--RLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            CLKCFC G +  C       +  +G  + P+         T T ++G+     S    E+S++ S +++ S+ Y                F +      G  + SY   L+  +  R    S      P V+LQ  N    +  + D S      P  F    +   W++ +          A R  +L  L+ I  LLI+  Y            ++D  +  P++ G +  A  +E+C CP  Y G SC+ C  GY +      +  C   NC      C+ + G C  C     G  C +C+PG+          DC  C CY        ++ C  D  G               P CD C
Sbjct:  921 CLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAGTHTTSEGV----SSPAPGELSFS-SFHNLLSEPY----------------FWSLPASFRGDKVTSYGGELRFTVTQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSP---GQPSNFIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRVSGISMD--VAVPENTGQD-SAREVEQCTCPPGYRGPSCQDCDTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQRGTPQDCQPCPCYGAPAAGQAAHTCFLDTDGH--------------PTCDSC 1237          

HSP 4 Score: 25.409 bits (54), Expect = 3.225e-13
Identity = 6/18 (33.33%), Postives = 11/18 (61.11%), Query Frame = -3
Query: 6114 CKENYKGPNCSECSPGFF 6167
            C   + G +C  C+PG++
Sbjct: 1237 CSPGHSGRHCERCAPGYY 1254          

HSP 5 Score: 65.855 bits (159), Expect = 1.215e-9
Identity = 49/191 (25.65%), Postives = 75/191 (39.27%), Query Frame = -2
Query: 6283 AMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR---IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLS---SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6813
            A R  +L  L+D+  LL+R  + S          +++     P S       PR   +E+C CP  Y GLSC+ C  GY +      + +C +   EC+        + G C+RC    +G  C  C  G+   YG+  +    DC  C C       + S  C  +  G G   C           C++C
Sbjct: 1476 ATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSS------GPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQCEL--CECNGHSDLCHPETGACSRCQHNTAGEFCELCATGY---YGDATAGTPEDCQPCACPLTNPENMFSRTC--ESLGAGGYRCTACEPGYTGQYCEQC 1653          
BLAST of SMED30010499 vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 204.142 bits (518), Expect = 1.976e-59
Identity = 170/619 (27.46%), Postives = 260/619 (42.00%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ---CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMF---NNAAMFVSMCLKCFCSGQTDDCSSAMGY-------YQSPNPKTSTRTKGLLMNFKSQ--------KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C   + +C +  CI  +  C+G +DC DG DE    CA    CEPN+F+C        +  C    WRCDG+ DC +  DE NC +K     C  +HF C      IP S  CDE  +C +  DE  C  P+VV P Q++        +++  C    VPT  INWR NWG +P     T+   G         L I ++     G YTCEA++++     +       V  +  C    F   ++A+     CL CFC G T+ C S++ +       +  PN       KG+ +   SQ          L++  A   + +   S +F+  ++  F   P  FL       G+ ++SY  +L+  +R  L     + +  P VIL    G  L+      S        G  NQ ++ L E E+W  +S       R ++L  L+ ++ +L++  Y +        +  +D  +T+    G    A  +E+C CP  Y+GLSCE C A + +      +  C   NC      CD   G+C  C     GP+C +CKPGF     +  ++ C  C C     +   S+ C  D  GQ    C           C+ C
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDEL--GCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQ-TVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGG-----RGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSAS-----CLPCFCFGVTNVCQSSLRFRDQIRLSFDQPND-----FKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFL--VHDAFWALPKQFL-------GNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGA-GYRLH------SRGHTPTHPGTLNQRQVQLSE-EHWVHESG--RPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGR---AHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQA--TCDACAPGYTGRRCESC 854          

HSP 2 Score: 48.9062 bits (115), Expect = 1.976e-59
Identity = 23/62 (37.10%), Postives = 31/62 (50.00%), Query Frame = -3
Query: 6039 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6212
            C+  G+       C+CK N  G  C+ECS G F   K+    CLKCFC   +++C  S   R
Sbjct:  879 CDERGSLGTSGETCRCKNNVVGRLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSR 940          

HSP 3 Score: 72.4034 bits (176), Expect = 3.226e-13
Identity = 84/365 (23.01%), Postives = 131/365 (35.89%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDC-------SSAMGYYQSPN-------PKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINI--RLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            CLKCFC G +  C       +  +G  + P+         T T ++G+     S    E+S++ S +++ S+ Y                F +      G  + SY   L+  +  R    S      P V+LQ  N    +  + D S      P  F    +   W++ +          A R  +L  L+ I  LLI+  Y            ++D  +  P++ G +  A  +E+C CP  Y G SC+ C  GY +      +  C   NC      C+ + G C  C     G  C +C+PG+          DC  C CY        ++ C  D  G               P CD C
Sbjct:  921 CLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAGTHTTSEGV----SSPAPGELSFS-SFHNLLSEPY----------------FWSLPASFRGDKVTSYGGELRFTVTQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSP---GQPSNFIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRVSGISMD--VAVPENTGQD-SAREVEQCTCPPGYRGPSCQDCDTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQRGTPQDCQPCPCYGAPAAGQAAHTCFLDTDGH--------------PTCDSC 1237          

HSP 4 Score: 25.409 bits (54), Expect = 3.226e-13
Identity = 6/18 (33.33%), Postives = 11/18 (61.11%), Query Frame = -3
Query: 6114 CKENYKGPNCSECSPGFF 6167
            C   + G +C  C+PG++
Sbjct: 1237 CSPGHSGRHCERCAPGYY 1254          

HSP 5 Score: 65.855 bits (159), Expect = 1.215e-9
Identity = 49/191 (25.65%), Postives = 75/191 (39.27%), Query Frame = -2
Query: 6283 AMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR---IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLS---SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6813
            A R  +L  L+D+  LL+R  + S          +++     P S       PR   +E+C CP  Y GLSC+ C  GY +      + +C +   EC+        + G C+RC    +G  C  C  G+   YG+  +    DC  C C       + S  C  +  G G   C           C++C
Sbjct: 1476 ATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSS------GPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQCEL--CECNGHSDLCHPETGACSRCQHNTAGEFCELCATGY---YGDATAGTPEDCQPCACPLTNPENMFSRTC--ESLGAGGYRCTACEPGYTGQYCEQC 1653          
BLAST of SMED30010499 vs. Ensembl Mouse
Match: Ldlr (low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:96765])

HSP 1 Score: 86.2705 bits (212), Expect = 5.760e-16
Identity = 51/130 (39.23%), Postives = 69/130 (53.08%), Query Frame = -2
Query: 7666 KDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR 8049
            +D CS N+  CR+  CI     C+G  +C DG DE   TC    C+ NQFSC   GG+    +C+ + WRCDG+ DC N  DE  C      TC    F C D   + P+   CD + +CL+G DE +C+
Sbjct:   24 EDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSC---GGRV--SRCIPDSWRCDGQVDCENDSDEQGCP---PKTCSQDDFRCQDGKCISPQFV-CDGDRDCLDGSDEAHCQ 144          

HSP 2 Score: 59.3066 bits (142), Expect = 1.002e-7
Identity = 42/132 (31.82%), Postives = 59/132 (44.70%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NCIKLD------KNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS +   C++  CI     C+G +DC DG DE       C P  F C++         C+ + W CDG+ DC +G DE   NC   D       + C    F C  +   I RS  CD   +C +  DE++C
Sbjct:  109 CSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNS-------SICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSS-ECIHRSWVCDGEADCKDKSDEEHC 232          

HSP 3 Score: 53.5286 bits (127), Expect = 5.133e-6
Identity = 45/150 (30.00%), Postives = 68/150 (45.33%), Query Frame = -2
Query: 7624 ATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSH-FACDDNVTLIPRSAWCDENPNCLNGEDE--KNCRHPEVVIPNQETTYV 8064
            A+  V   CS  +  C +S CI  +  C+G  DC+D  DEE    A C P++F C           C+    +CD E+DC +  DEL C+ + +  C G + F C      I     CD   +C +  DE  K C+  E +  N   +++
Sbjct:  190 ASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQC-------ADGSCIHGSRQCDREHDCKDMSDELGCVNVTQ--CDGPNKFKCHSG-ECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHI 329          
BLAST of SMED30010499 vs. Ensembl Mouse
Match: Ldlr (low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:96765])

HSP 1 Score: 86.2705 bits (212), Expect = 5.954e-16
Identity = 51/130 (39.23%), Postives = 69/130 (53.08%), Query Frame = -2
Query: 7666 KDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR 8049
            +D CS N+  CR+  CI     C+G  +C DG DE   TC    C+ NQFSC   GG+    +C+ + WRCDG+ DC N  DE  C      TC    F C D   + P+   CD + +CL+G DE +C+
Sbjct:   24 EDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSC---GGRV--SRCIPDSWRCDGQVDCENDSDEQGCP---PKTCSQDDFRCQDGKCISPQFV-CDGDRDCLDGSDEAHCQ 144          

HSP 2 Score: 59.3066 bits (142), Expect = 9.685e-8
Identity = 42/132 (31.82%), Postives = 59/132 (44.70%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NCIKLD------KNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS +   C++  CI     C+G +DC DG DE       C P  F C++         C+ + W CDG+ DC +G DE   NC   D       + C    F C  +   I RS  CD   +C +  DE++C
Sbjct:  109 CSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNS-------SICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSS-ECIHRSWVCDGEADCKDKSDEEHC 232          

HSP 3 Score: 53.5286 bits (127), Expect = 5.199e-6
Identity = 45/150 (30.00%), Postives = 68/150 (45.33%), Query Frame = -2
Query: 7624 ATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSH-FACDDNVTLIPRSAWCDENPNCLNGEDE--KNCRHPEVVIPNQETTYV 8064
            A+  V   CS  +  C +S CI  +  C+G  DC+D  DEE    A C P++F C           C+    +CD E+DC +  DEL C+ + +  C G + F C      I     CD   +C +  DE  K C+  E +  N   +++
Sbjct:  190 ASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQC-------ADGSCIHGSRQCDREHDCKDMSDELGCVNVTQ--CDGPNKFKCHSG-ECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHI 329          
BLAST of SMED30010499 vs. Ensembl Mouse
Match: Lama1 (laminin, alpha 1 [Source:MGI Symbol;Acc:MGI:99892])

HSP 1 Score: 78.9518 bits (193), Expect = 9.045e-16
Identity = 91/368 (24.73%), Postives = 155/368 (42.12%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS-AMGYYQSPNPKTSTRTKGLLMN-FKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNP-EGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ-------NQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C+   +N        C +CFC G +  C S      Q  N      T  +  N  +SQ+ + +   + I   N+   + +   Y  +   P  +L +     G +L+   Y +  +I +     D +    +I++  NG ++    +  +E +   P E ++N +++     EN F D        R  ++ VL+++ +LLIR  Y S +      + +V   I +P+++   + A  +E C CP  YTG SCE CL GY + D          C  +C  +  ECD +G C+ CT   +G  C +C PGF          DC  C C   +++   S  C   LT    +VC       +   C++C
Sbjct:  492 CKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDV-LGGHRQISINNTAVMQRLTSTY--YWAAPEAYLGNKLTAFGGFLK---YTVSYDIPVETVDSDLMSHADIIIKG-NGLTI----STRAEGLSLQPYEEYFNVVRLV---PEN-FRDFDTRREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLD-SVSLDIASPNAIDLAV-AADVEHCECPQGYTGTSCEACLPGYYRVDGILFGGICQPC--ECHGHASECDIHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTC--HLTDGEEVVCDQCAPGYSGSWCERC 838          

HSP 2 Score: 27.335 bits (59), Expect = 9.045e-16
Identity = 19/55 (34.55%), Postives = 25/55 (45.45%), Query Frame = -3
Query: 6081 DLSENKNCNSLGTENIVDGKC-KCKENYKGPNCSECSPGFFS---FQKKCLKCFC 6233
            D  E  +C+S      V G+C KC  N  G +C  C+ GF+      K C  C C
Sbjct:  863 DPLEAGHCDS------VTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDC 911          

HSP 3 Score: 69.3218 bits (168), Expect = 1.020e-10
Identity = 72/294 (24.49%), Postives = 126/294 (42.86%), Query Frame = -3
Query: 5385 NCNSLGT--ENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNR-----QISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLF-----MEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKW-MNDLGKIAPVEMCLCPKGNPGIKCEAC 6215
            +C ++G+  E+     C CK+N +G NC  C PGF++ +++    C +CFC   +  C +S  +  S +T  S  +  D++ +N+      + G +   + NN  ++ R  +              Y+  KLT              +GG + +T  Y  D+  + V SD+    +I  K  G   +  +     +  E  F     + +NF  +   +E     DR+  +  L    HL I   +++  +   RL  ++++ A     DL   A VE C CP+G  G  CEAC
Sbjct:  462 DCRTVGSLNEDPCIEPCLCKKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVC-DSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPE-----AYLGNKLT-------------AFGGFLKYTVSY--DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE----IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQGYTGTSCEAC 730          

HSP 4 Score: 59.6918 bits (143), Expect = 9.718e-8
Identity = 63/276 (22.83%), Postives = 116/276 (42.03%), Query Frame = -3
Query: 5385 GKCKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLF---MEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDL---GKIA-PVEMCLCPKGNPGIKCEAC 6179
            G C CKEN  GP CS+C  G F+ +    + C  CFC   +Q C E + Y  + +TL S D  L  V+S   + G  E       +     + ++  +     I       +L      D +    L YGGK+ ++  + + L      S+  P + I+  +  +    +        +   +   M++ F K+      K +   + F+  L    ++ I   +  G ++  R+ ++++E  +   +L   G+ A  +E+C+CP G  G  C+ C
Sbjct: 1123 GTCSCKENAVGPQCSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLAS-DQPLLHVVSQSNLKGTIEG------VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQL----LAYGGKLQYSVAFYSTLGTGT--SNYEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSD-FMSVLSNIDYILIKASYGQG-LQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDC 1383          

HSP 5 Score: 58.9214 bits (141), Expect = 1.649e-7
Identity = 76/326 (23.31%), Postives = 123/326 (37.73%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVF-LTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSN---PEGFYNQLKISLWEKENW-FIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP----INCVECDKN----------GNCNRCTGQRSGPKCLECKPGFVRLYGE--KLSSDCTECNC 7311
            C  CFC G +  CS   GY ++     S +    L++  SQ  L+ +  + ++     +      + Q    +P  + L   F   G  L +Y   L+ ++  +           P+V+++    +           VIY +   PE    Q      ++E W + +S  E      D ++VLS+I Y+LI+  Y          N +++      +       A  +E C CP    G SC+ C  GY +    +   + P      CV C+ N          G C  C    SG  C  C  G+   YG+   L  DCT C C
Sbjct: 1154 CSPCFCFGLSQLCSELEGYVRTLITLASDQP---LLHVVSQSNLKGTI-EGVHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQF--QGDQLLAYGGKLQYSVAFYSTLGTGTSNYEPQVLIKGGRARK---------HVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSVLSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCELCASGY---YGKVTGLPGDCTPCTC 1461          

HSP 6 Score: 39.6614 bits (91), Expect = 3.953e-7
Identity = 42/135 (31.11%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 6280 NCPTPYTGLSCEKCLAGYEKNDQ---NQCVK-KC-----PINCVECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSS-DCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKC----TGRERNDPLCDKCL 6639
             C   Y+G  CE+C  GY  N       CV   C     P+    CD   G C +C     G  C  C  GF   YG+ +++ +C  C+C+    N  +S IC  + TG    +C C    TG++     CD+CL
Sbjct:  825 QCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGF---YGDAVTAKNCRACDCH---ENGSLSGICHLE-TG----LCDCKPHVTGQQ-----CDQCL 943          

HSP 7 Score: 36.965 bits (84), Expect = 3.953e-7
Identity = 15/42 (35.71%), Postives = 21/42 (50.00%), Query Frame = -3
Query: 6060 DGKCKCKENYKGPNCSECSPGFFSFQ-KKCLKCFCSNKTQEC 6182
            +G+C C     G  C  CS GF++FQ   C  C C++    C
Sbjct:  973 EGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNC 1014          
BLAST of SMED30010499 vs. UniProt/SwissProt
Match: sp|P98160|PGBM_HUMAN (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4)

HSP 1 Score: 206.453 bits (524), Expect = 6.918e-59
Identity = 173/620 (27.90%), Postives = 257/620 (41.45%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMF---NNAAMFVSMCLKCFCSGQTDDCSSAMGY-------YQSPNPKTSTRTKGLLMNFKSQ--------KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQG---AIVCKCTGRERNDPLCDKC 8040
            C   + ACRN  CI  +  C+G +DCEDG DE +      CEPN+F C        +  C    WRCDG+ DC +  DE NC  K  +  C  + F C      IP S  CDE  +C +  DE  C  P+VV P +E+       + ++  C  + VPT  INWR NWG +P     TV   G         L I ++     G YTCEA++ +     +       V  +  C    F   ++AA     CL CFC G T  C S   +       +  P+       KG+ +   +Q          L++  +   + +   S +F+  ++  F   P  FL       G+ ++SY   L+ N+R  L     + +  P V+L     + L       S        G  NQ ++   E E+W  +S       R ++L VL  ++ +LI+  Y +        +  +D  +T+  S G    A  +E+C CP  Y+GLSCE C A + +      +  C   NC      CD   G+C  C     GP+C +CK GF     +  ++ C  C C     +   S+ C  D  GQ    A     TGR      C+ C
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQT-VTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGG-----RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAA-----CLPCFCFGITSVCQSTRRFRDQIRLRFDQPDD-----FKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFL--VHDSFWALPEQFL-------GNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLL-------SRGHTPTQPGALNQRQVQFSE-EHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGR---AHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRR-----CESC 854          

HSP 2 Score: 47.3654 bits (111), Expect = 6.918e-59
Identity = 21/62 (33.87%), Postives = 29/62 (46.77%), Query Frame = -3
Query: 6039 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6212
            C+  G+       C+CK N  G  C+EC+ G F    +    CLKCFC   ++ C  S   R
Sbjct:  879 CDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSR 940          

HSP 3 Score: 76.2554 bits (186), Expect = 3.258e-20
Identity = 84/361 (23.27%), Postives = 133/361 (36.84%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDCSS-----AMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG-------PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQN----QCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            CLKCFC G +  C+S     A  +  S  P   + T     +  ++ I   +  +  +   S  ++ +   Y  F   P+ FL       G  + SY   L+  +     ++   PG       P V+LQ   G ++    +   E     P  F    +   W++ +          A R  +L  L+ I  LLIR  Y            ++D  +  P+  G +  A  +E+C+CP  Y G SC+ C  GY +         C +  C  +   C+ + G C  C     GP+C +C+PG+          DC  C CY        ++ C  D  G               P CD C
Sbjct:  921 CLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGF---SSFHRLLSGPY--FWSLPSRFL-------GDKVTSYGGELRFTV-----TQRSQPGSTPLHGQPLVVLQ---GNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPD-------GQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMD--VAVPEETGQDP-ALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGH--------------PTCDAC 1237          

HSP 4 Score: 47.7506 bits (112), Expect = 3.258e-20
Identity = 23/66 (34.85%), Postives = 31/66 (46.97%), Query Frame = -3
Query: 6039 NCN---SLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6215
            NC+   S+ ++    G+C+CK   +G  CS C P  F         CL CFC   TQ+C  S   R
Sbjct: 1276 NCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSAYTR 1341          

HSP 5 Score: 67.781 bits (164), Expect = 2.419e-9
Identity = 49/188 (26.06%), Postives = 74/188 (39.36%), Query Frame = -2
Query: 6283 AMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLS---SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6813
            A R  +L  L+D+  LLIR  + S          +++     P    N   A  +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C++C    +G  C  C PG+   YG+  +    DC  C C       + S  C  +  G G   C           C++C
Sbjct: 1476 ATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPS---NRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCEL--CECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGY---YGDATAGTPEDCQPCACPLTNPENMFSRTC--ESLGAGGYRCTACEPGYTGQYCEQC 1653          
BLAST of SMED30010499 vs. UniProt/SwissProt
Match: sp|Q05793|PGBM_MOUSE (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 4.857e-58
Identity = 170/619 (27.46%), Postives = 260/619 (42.00%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ---CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMF---NNAAMFVSMCLKCFCSGQTDDCSSAMGY-------YQSPNPKTSTRTKGLLMNFKSQ--------KILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 8040
            C   + +C +  CI  +  C+G +DC DG DE    CA    CEPN+F+C        +  C    WRCDG+ DC +  DE NC +K     C  +HF C      IP S  CDE  +C +  DE  C  P+VV P Q++        +++  C    VPT  INWR NWG +P     T+   G         L I ++     G YTCEA++++     +       V  +  C    F   ++A+     CL CFC G T+ C S++ +       +  PN       KG+ +   SQ          L++  A   + +   S +F+  ++  F   P  FL       G+ ++SY  +L+  +R  L     + +  P VIL    G  L+      S        G  NQ ++ L E E+W  +S       R ++L  L+ ++ +L++  Y +        +  +D  +T+    G    A  +E+C CP  Y+GLSCE C A + +      +  C   NC      CD   G+C  C     GP+C +CKPGF     +  ++ C  C C     +   S+ C  D  GQ    C           C+ C
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDEL--GCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQ-TVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGG-----RGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSAS-----CLPCFCFGVTNVCQSSLRFRDQIRLSFDQPND-----FKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFL--VHDAFWALPKQFL-------GNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGA-GYRLH------SRGHTPTHPGTLNQRQVQLSE-EHWVHESG--RPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGR---AHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQA--TCDACAPGYTGRRCESC 854          

HSP 2 Score: 48.9062 bits (115), Expect = 4.857e-58
Identity = 23/62 (37.10%), Postives = 31/62 (50.00%), Query Frame = -3
Query: 6039 CNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYR 6212
            C+  G+       C+CK N  G  C+ECS G F   K+    CLKCFC   +++C  S   R
Sbjct:  879 CDERGSLGTSGETCRCKNNVVGRLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSR 940          

HSP 3 Score: 72.0182 bits (175), Expect = 2.565e-12
Identity = 84/365 (23.01%), Postives = 131/365 (35.89%), Query Frame = -2
Query: 6283 CLKCFCSGQTDDC-------SSAMGYYQSPN-------PKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINI--RLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7311
            CLKCFC G +  C       +  +G  + P+         T T ++G+     S    E+S++ S +++ S+ Y                F +      G  + SY   L+  +  R    S      P V+LQ  N    +  + D S      P  F    +   W++ +          A R  +L  L+ I  LLI+  Y            ++D  +  P++ G +  A  +E+C CP  Y G SC+ C  GY +      +  C   NC      C+ + G C  C     G  C +C+PG+          DC  C CY        ++ C  D  G               P CD C
Sbjct:  921 CLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAGTHTTSEGV----SSPAPGELSFS-SFHNLLSEPY----------------FWSLPASFRGDKVTSYGGELRFTVMQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSP---GQPSNFIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRLSGISMD--VAVPENTGQD-SAREVEQCTCPPGYRGPSCQDCDTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQRGTPQDCQPCPCYGAPAAGQAAHTCFLDTDGH--------------PTCDSC 1237          

HSP 4 Score: 25.409 bits (54), Expect = 2.565e-12
Identity = 6/18 (33.33%), Postives = 11/18 (61.11%), Query Frame = -3
Query: 6114 CKENYKGPNCSECSPGFF 6167
            C   + G +C  C+PG++
Sbjct: 1237 CSPGHSGRHCERCAPGYY 1254          

HSP 5 Score: 65.855 bits (159), Expect = 9.602e-9
Identity = 49/191 (25.65%), Postives = 75/191 (39.27%), Query Frame = -2
Query: 6283 AMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR---IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLS---SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6813
            A R  +L  L+D+  LL+R  + S          +++     P S       PR   +E+C CP  Y GLSC+ C  GY +      + +C +   EC+        + G C+RC    +G  C  C  G+   YG+  +    DC  C C       + S  C  +  G G   C           C++C
Sbjct: 1476 ATREHLLMALADLDELLVRATFSSVPRAASISAVSLEGAQPGPSS------GPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQCEL--CECNGHSDLCHPETGACSRCQHNTAGEFCELCATGY---YGDATAGTPEDCQPCACPLTNPENMFSRTC--ESLGAGGYRCTACEPGYTGQYCEQC 1653          
BLAST of SMED30010499 vs. UniProt/SwissProt
Match: sp|Q06561|UNC52_CAEEL (Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 1.109e-37
Identity = 184/706 (26.06%), Postives = 280/706 (39.66%), Query Frame = -2
Query: 6460 LLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGG-------ETQALLIVNTATKEMNGTVYECVH----NNLLIKATLIVKDF--------------CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRL---PQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTK-RAMAKD--------------------------------YTIFVTSKTLCE-------------KP-MFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITN--PDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PIN-----------CVECDKNGNCNRCTGQRSGPKCLECKP 8301
            + V P+E  VR G    F C+          R  D   +     +RVGG       ++   L +N       GT Y CV     N +  +ATL V  +              C  +++AC N+ C+  +  C+G  DC D  DE         CEPN+F C+       + KCV   W CDG++DCG+  DELNC  K   + C  + F C D    +P S  CD   +C +G DE  C  P VV P Q T   V   ++ SL C+ V+VP   INWR NWG +   P+ L  +    G         LTI++  P   G YTCEA++ K R +A                                   T +  +   CE             KP  F+ +      CLKCFC G ++DC S+  Y        +   +G+ ++   ++ ++ +   S +     ++         +   P  FL       G  + +Y   ++  I   G S      P V+L+  N   L     +   V+ S+     + ++I++   E  + +     +A R D+L VL+D+   LIR  + ++QT     + + +  +    PD +     A  +E+C CP  Y G SCE C  GYE++     +  C PI                   G C +C     GP C  C P
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT-YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYG--------TLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFL-------GDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKG-NQNILVHRVRNQEHVLRSD-----SPVRITVETYETNY-EQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGL-----ALEVEQCVCPPGYLGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQC-QCKASVIGPNCDRCAP 705          

HSP 2 Score: 77.0258 bits (188), Expect = 4.153e-12
Identity = 88/342 (25.73%), Postives = 132/342 (38.60%), Query Frame = -2
Query: 6418 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSS------------AMG-----------YYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDC 7356
            C    F  A      C+ CFCSG T  CS+            A G             Q  +P+T     G  + F+S    E +  +++Y      +K            P  FL       G  + SY   L+   +  G    D     VIL+  N  +L +    + E  Y++ E   N+++I + E     +D      A R  +L  L+D+  LLI+  Y  + T  +  +A ++      +  G  + A  +E+C CP  Y G SCE C  GY +         C K +C  +  +CDK  G C  C     G +C  CKPGFV        +DC
Sbjct:  703 CAPNSFGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRS---FEEARGQTLY------WKL-----------PEKFL-------GDKVTSYGGTLEYTFKFSGNGNSDQSA-DVILRG-NDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA----EPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDC 1002          

HSP 3 Score: 60.8474 bits (146), Expect = 3.114e-7
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = -3
Query: 6009 GKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSAD 6179
            G C+CK    GPNC +C PG F   +K    CLKCFC   + +C+ S  YR  +  + + D
Sbjct:  398 GTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGD 458          
BLAST of SMED30010499 vs. UniProt/SwissProt
Match: sp|P35952|LDLR_RAT (Low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Ldlr PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.144e-15
Identity = 51/129 (39.53%), Postives = 68/129 (52.71%), Query Frame = -2
Query: 7669 KDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8049
            +D C  N+  CR+  CI     C+G ++C DG DE   TC    C   +FSC   GG+    +C+ + WRCDG  DC NG DEL+C      TC    F C D    I R   CD++ +CL+G DE +C
Sbjct:   24 EDSCGKNEFQCRDGKCIVSKWVCDGSRECPDGSDESPETCMSVTCRSGEFSC---GGRV--SRCIPDSWRCDGRTDCENGSDELDC---SPKTCSLDEFRCQDG-KCISRQFVCDQDWDCLDGSDEAHC 143          
BLAST of SMED30010499 vs. UniProt/SwissProt
Match: sp|C0HL13|LRP2_PIG (Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.348e-15
Identity = 49/131 (37.40%), Postives = 70/131 (53.44%), Query Frame = -2
Query: 7639 CRNSICIDENKFCNGIKDCEDGFDE----EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8019
            C N  C+  +  C+G+ DC D  DE      NT   C P+ F+C   GG+     C+ +YWRCD  NDC +G DE NC    + +C   +F CD+++  IP++  CD + +C +G DEK C   E   P Q
Sbjct: 1033 CNNGRCVPLHYRCDGVDDCHDNSDEVQCGAFNT--SCAPSAFACGHGGGE-----CIPSYWRCDNHNDCVDGSDEQNCSSQAQTSCRADYFTCDNHM-CIPKNWLCDTDNDCGDGSDEKRCDLGETCSPTQ 1155          

HSP 2 Score: 82.4185 bits (202), Expect = 8.617e-14
Identity = 51/127 (40.16%), Postives = 62/127 (48.82%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C  N+  C N  CI E+  C+G +DC DG DE     + C   QF C           C+  YW CDGE DC NG DE       + TC   HF C  N   IP    CD + +CL+G DE NCR+P
Sbjct:   28 CLGNEFRCSNGHCITESWRCDGTRDCLDGSDEIGCPPSTCGSTQFHCEN------EDVCIPLYWVCDGEEDCSNGADEHQRCPPGR-TCSSHHFTC-TNGECIPVEYRCDHSTDCLDGTDEINCRYP 146          

HSP 3 Score: 80.4925 bits (197), Expect = 3.611e-13
Identity = 49/121 (40.50%), Postives = 62/121 (51.24%), Query Frame = -2
Query: 7678 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            CS  Q  C N  CID    C+G KDC DG DE       C  +QF C  VG      KC++N +RCDG +DC +  DE++C       C    F C ++   IP S  CD +P+CL G DE
Sbjct: 1151 CSPTQFHCPNHRCIDLAFVCDGDKDCADGSDESA-CVINCTDSQFKC--VGSN----KCISNTYRCDGVSDCSDHSDEIDCPTRPPGMCRQDEFQCREDGICIPDSWECDGHPDCLTGSDE 1264          

HSP 4 Score: 74.3294 bits (181), Expect = 2.723e-11
Identity = 47/123 (38.21%), Postives = 61/123 (49.59%), Query Frame = -2
Query: 7660 NSICIDENKFCNGIKDCEDGFDEEINTCAQCEPN-QFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR----HP 8013
            N  CI +   CNG  DC D  DE+      C+P+ +F C        +  C+   WRCDG NDCG+  DE NC+      C  S F CDD  T IP    CD+N +C +  DE++C     HP
Sbjct: 3687 NYRCIPKWAVCNGFDDCRDNSDEQNCESLTCKPSGEFRC-------TNHHCIPLRWRCDGHNDCGDNSDEENCV---PRQCSESEFRCDDQ-TCIPSRWICDQNNDCGDNSDERDCEVMTCHP 3798          

HSP 5 Score: 73.9442 bits (180), Expect = 2.937e-11
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE-INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            CS ++  C N+ CI     C+G  DC D  DE+  + C     + ++ H V   PP ++C+   W CDG+ DC + YDE  NC    +  C G+ F C  N   IP    CD   +C +  DE+NC++P
Sbjct: 2903 CSSDEFKCDNNRCIQMEWICDGDNDCGDMSDEDGRHHCENHNCSSYAFHCVNSAPPSRRCIPLSWVCDGDADCSDAYDEHQNCT---RRNCSGTEFRC-SNGLCIPNWFRCDRRNDCGDYSDERNCKYP 3027          

HSP 6 Score: 70.4774 bits (171), Expect = 4.077e-10
Identity = 44/124 (35.48%), Postives = 62/124 (50.00%), Query Frame = -2
Query: 7678 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8043
            FC   Q  C +  C   N  CN  +DC DG DE+   C   +CE NQ+ C        +++C+   W+CD  NDCG+  DE +     + TCL  +F C  N   IP+S  CD + +C +  DE
Sbjct: 3550 FCRLGQFQCSDGNCTSSNFICNARQDCPDGSDEDAVLCEHHRCESNQWQC-------ANKRCIPESWQCDSLNDCGDNSDE-DSSHCARRTCLPGYFKC-ANGHCIPQSWKCDVDNDCGDYSDE 3664          

HSP 7 Score: 67.3958 bits (163), Expect = 2.969e-9
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = -2
Query: 7669 ATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDD--------NVTLIPRSAWCDENPNCLNGEDEKNC 8064
            A L     C  NQ  C N  CI E+  C+ + DC D  DE+ + CA+  C P  F C        +  C+   W+CD +NDCG+  DE          C+G  + CD+        N   IP+ A C+   +C +  DE+NC
Sbjct: 3584 AVLCEHHRCESNQWQCANKRCIPESWQCDSLNDCGDNSDEDSSHCARRTCLPGYFKC-------ANGHCIPQSWKCDVDNDCGDYSDE------PLQECMGPAYRCDNYTEFDCKTNYRCIPKWAVCNGFDDCRDNSDEQNC 3712          

HSP 8 Score: 65.4698 bits (158), Expect = 1.341e-8
Identity = 45/122 (36.89%), Postives = 60/122 (49.18%), Query Frame = -2
Query: 7660 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK--NCRHP 8019
            C +  CI +   C+G  DC D  DE   TC    PN   C     +  +  CV   W+CDG+NDCG+G DE   + L+    L + F CD+N   I R   C+   +C +G DEK  NC  P
Sbjct: 3803 CSSGHCIPDQMRCDGFADCLDASDEA--TCPTRFPNGAYCPATLFECKNHVCVQPSWKCDGDNDCGDGSDEELHLCLNITCDLTNRFRCDNN-RCIYRHELCNHEDDCGDGSDEKKENCLAP 3921          

HSP 9 Score: 62.003 bits (149), Expect = 1.267e-7
Identity = 41/117 (35.04%), Postives = 52/117 (44.44%), Query Frame = -2
Query: 7669 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8019
            C N  CI     C+G  DC D  DEE     QC  ++F C         Q C+ + W CD  NDCG+  DE +C  +   TC   +F C      IP    CD   +CL+  DE  C
Sbjct: 3725 CTNHHCIPLRWRCDGHNDCGDNSDEENCVPRQCSESEFRCDD-------QTCIPSRWICDQNNDCGDNSDERDCEVM---TCHPGYFQCSSG-HCIPDQMRCDGFADCLDASDEATC 3830          

HSP 10 Score: 60.4622 bits (145), Expect = 3.892e-7
Identity = 46/124 (37.10%), Postives = 57/124 (45.97%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS +   C N  CI     C+   DC DG DE IN C      Q +CH       +  C     RCDGE DC +  DELNC +     CL + F C      IPR   CD +P+C +  DE +C
Sbjct:  109 CSSHHFTCTNGECIPVEYRCDHSTDCLDGTDE-IN-CRYPVCQQQTCH-------NGACYNTSQRCDGEIDCRDASDELNCTQ----RCLRNEFQCGSG-ECIPRDYVCDHDPDCSDSSDEHSC 218          

HSP 11 Score: 59.3066 bits (142), Expect = 9.946e-7
Identity = 42/136 (30.88%), Postives = 65/136 (47.79%), Query Frame = -2
Query: 7669 VKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEE---INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNV----TLIPRSAWCDENPNCLNGEDE-KNC 8052
            V   C  N+  C +  CI E   C+G +DC+DG DE    + + + C  ++F C        + +C+   W CDG+NDCG+  DE      + + C    F C ++       IP S  CD + +C +  DE +NC
Sbjct: 2857 VSPTCKNNEFQCTSGSCIPELWHCDGERDCDDGSDEPATCVYSPSTCSSDEFKCD-------NNRCIQMEWICDGDNDCGDMSDEDGRHHCENHNCSSYAFHCVNSAPPSRRCIPLSWVCDGDADCSDAYDEHQNC 2985          

HSP 12 Score: 58.5362 bits (140), Expect = 1.538e-6
Identity = 57/181 (31.49%), Postives = 81/181 (44.75%), Query Frame = -2
Query: 7597 NGTVYECVHNNLLIKAT----LIVKD--FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNC--LNGEDEKNCRHPEVVIPNQETTYVVHANSSISL 8109
            NG   +C H      A      IV D   C+  Q  C +  CI E+  CN I +C D  DE    CA   C P  F+C        + +C+  ++RCD  NDCG+  DE  C     N  + + F+C +N   +P    CD   +C   N  DEKNC      +P+    Y+  ANS++ +
Sbjct: 2668 NGPECKCPHEGRWYLANNNKYCIVDDGKRCNSTQFTCLSGYCILESLKCNDIDECGDSSDELETLCAYHTCPPTSFTC-------ANGRCIQRHFRCDHYNDCGDNSDESGCRFRSCN--ITTEFSC-NNGKCLPLQLVCDGIDHCNDNNTSDEKNCAQ-HTCLPD----YIKCANSNVCI 2833          

HSP 13 Score: 57.3806 bits (137), Expect = 3.160e-6
Identity = 44/125 (35.20%), Postives = 57/125 (45.60%), Query Frame = -2
Query: 7657 CRNS-ICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNCRHPE 8019
            C NS +CI     C+G  DC D  DE    C    C+ N+F C T G       C+   W CDGE DC +G DE        +TC    F CD+N  +  +  W CD + +C +  DE    H E
Sbjct: 2826 CANSNVCIPRLFLCDGDNDCGDMSDENPIYCVSPTCKNNEFQC-TSG------SCIPELWHCDGERDCDDGSDEPATCVYSPSTCSSDEFKCDNNRCI--QMEWICDGDNDCGDMSDEDGRHHCE 2941          
BLAST of SMED30010499 vs. TrEMBL
Match: A0A4D6G2K6 (Plc (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plc PE=2 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 291/293 (99.32%), Postives = 292/293 (99.66%), Query Frame = -2
Query: 6481 LCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGP 7359
            LCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRC GQRSGP
Sbjct:    1 LCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCIGQRSGP 293          
BLAST of SMED30010499 vs. TrEMBL
Match: A0A5K4F322 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 0.000e+0
Identity = 261/732 (35.66%), Postives = 409/732 (55.87%), Query Frame = -2
Query: 6283 STVNINSVKPFHAGTYYCDAK--KNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGT----VIWRREDKKSFQIDVESRVGGET-QALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKL-DKNTCLGSHFACDDNVTLIPRSAWCDENPNC-LNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNV-----FLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTC----ETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQN--QCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERN---DPLCDKC 8409
            S ++I +V+ +H G Y C A   K+ A  ++ +     L VTP E+  RPG++ +FLC+L   +G     V W R D++  +   E  +G    +ALLIV    +  +   Y C        A L V++ C+   R C +  C++E KFC+G+ DCEDG+DE  + C +C  N+ +C  +    P + C   +W CDGE+DCGN +DE NC+   D + C G+H+ C     +I R+  CD  P+C  NG+DE  C +P ++ P+ ET  + H + +++L C     P  TI+WR+NWG L + +  +++ T  +CN   + LT+ ++ P  +G+YTCEA++  RA+A D+ + V    +C+ P FN+AA F  MCL C+CS  TD C+S  GY +SP+         LL++FK+  I+  +Y +   D + +  + + ++  D +  P+V     F+ SDF + GSW++SY Y + IN+RLFGES + +PGP VIL N   +S+YWC  ++  ++++ P G+ N++ I L E++ WFID  C    + +  R   + ++SDIK +  R+KY+ +QT  E FN  V+H + + D  G   +   IE+C CP  Y GLSCEKC  GY+K+  N  +C   C   C +CD  GNC  C G+R+GP+C +C+ G+ R     L++DC  C+     N   V   C  +        CKC   E N   +P CD+C
Sbjct:  584 SFLSIMNVQKYHEGFYVCRALNLKDTAKLIVKIR---DLTVTPEEVKARPGTTVQFLCELSTITGMKGGKVFWMRTDRQDLRSGKEEVIGTNGGRALLIVKDVGRFDHNISYMCTDGYSKGYAKLYVQEVCAPGFRPCGSQQCLEETKFCDGVVDCEDGYDEIPSKCTECGVNENACGLMNDVKPLKNCYLQFWHCDGEDDCGNNFDESNCLAPSDYDQCNGTHYTCPQGDKMIARAFMCDSVPDCEPNGDDESECSYPSIIEPSGETHLIGHQSGNLTLTCVAYGRPPPTISWRYNWGHLREGVKHSINYTVINCNMAISHLTLTDLEPRASGLYTCEAVNRGRALAPDFLVNVAKGGICKAPQFNDAAWFDDMCLTCYCSNVTDTCTSVKGYRKSPH--------DLLLDFKTTPIILSTYNQ---DGSIEEGQGITEIDGDILRIPDVPNESTFIESDFNLSGSWVKSYGYDIIINLRLFGESLNYLPGPFVIL-NSTDQSIYWCPPNDRLLVHTIPTGYDNRIHIRLSERDKWFIDKECKQKIDQTIGRAGFMQIISDIKKIGFRVKYFRDQTTLELFNIKVEHAVKS-DVPGQ--WVGEIEECTCPNGYEGLSCEKCAPGYQKDPDNPLKCRPFCA--CDKCDTEGNCIECPGKRAGPRCQQCQDGYYRPDKSLLATDCQPCDMCGN-NLPYVVKKCHFNPQADDDYFCKCRISEDNKLLNPTCDRC 1294          

HSP 2 Score: 261.151 bits (666), Expect = 0.000e+0
Identity = 374/1631 (22.93%), Postives = 659/1631 (40.40%), Query Frame = -3
Query: 2052 VINAYRNLCQLLMN------ETAKKRDLSENKNCNSLGTENIVD-GKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQN--TNNQLLVNRTENIILVKRNPNQIGLVYVTLKLT----NSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNF-PKWRIGK-----EGKLLEDRETFIRALMTAQHLSIGFPFDNG-FVKDVRLRDLTI---------EHAKWMNDLG-KIAPVEMCLCPKGNPG--------IKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKW----NKVSESTHLNVTHEMTEDK---------SSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEE---------------------------KPPRLAV-EISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENK-VYKIDIEVPTNVTTGVKLKGVIVG---------SRVENPFRFVIEENIKRNLSINSDQLKVSVDKPV-LEVNFLESARVRVLVNP-KIRTETFWYKV-----------NED----GSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEI--LNTTEPRNASIS------------------LYVPDPIKCPSQSWELVDPK-TKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFET--SVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSST-----------------INWKIVGGFSLDLHEGIYTCRINN-------SFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPIS-RSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISY-PK-ETSIYLKV-DGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIK-----------TTMGQQI---PVSELPGFTKEIT-PKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDN----------------------DKITFGGLIYHPADNSAVGVCKADYFNT--IMYSEPFSFKVIKKDRTE-TPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNT-KFNPYNNSGKYTFIATNKFGTDSKTILLPQH---NNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYP-ISLKWS---------PVNEYQLS--GATVESS-DYVTSLIYDKFDR-KINSGEYTCQAISHQGLLTKK--VQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETD 6293
            ++N   + CQL ++      + AK     +  +C+  GT+   D G C+CK  Y G  C EC  G+F++  +CL+C+CS KT  C                    D+ L  R   G  + ++  TN    + R  +   VK   N  G+++  + L      +   +D+  Y  +YGGK+SF  +       +L   + +  +E+ES ++GR WT+ +FN  T+  E  F E+ +   WR+G      +  +   R   +R L+T  ++ I     N   + +++L  L+I         E   +  + G   APVE+C CP  NP           CE C  +  + +I + P   D+ CG C    C +C EG Y YD    K   +CQ  + + TK R I V   E I + C A S+RGG+  H+W    N+ S    ++  +    D           S  IL  K  +  D G Y C A    S  +E F+++V +                            PP L V EI     D   +Q+ +    P+    +   W+ +     DAK   ++I+ T     + ++ I   T  +    + G  +G         +R+  P     E +      I  D +   ++ P  + V F++   V+V   P K      W K+           ++D     S+  LP G ++D  +L IW+A + H G Y G ++   +G +V +++T ++V PM      E+      EP  + +                    + PD   C + +W +VD +  K  DIT  V + SD+   ++  L+ G  +RF+C  IP+            S  P + +K  ++   S +P  + C D N  + SSV        + + ++ +  +S+                  ++W+ +G F    ++G +TC +NN       +    S  VP+   +   +R   Y      +  T  + +   +  I + + ++L I       P+N+         +I   I    + YS L  +   D+ +L +   +++   G   S+ +EIS  PK E  ++ K+      +  +  + G   ++ C +  + +  +   ID  I W ++           T +   +   P  E   FTK    P+ L I    R  +  I + T  Y +  + S +I      +   + V + G      ++ +E  T+Q+ C   DA  N+ +     +W  T I S+   ++L  +N                      D +   GL   P +  A   CK     T    YS+    +V+  D  E  P+L +    DPN P YP  V C D   N  S +T    ++  D  ++ + P   ++ +T N   KF+P  ++G YT  + N + +  K + +P      +       E+ I S    +N+  +  GD  +++IC ++GHP P   L+WS          ++ + LS  G  ++S   Y T++   +FD    ++G + C A++  G + ++  V+VE     + I+ L+E G     +I  ++G N     N  D
Sbjct: 1286 LLNPTCDRCQLAIDRGDELPDDAKCDTKPQPMDCHYYGTQLTSDNGDCQCKTGYTGVKCDECEEGYFNYMGQCLQCYCSGKTSSC---------------PGFGFDIWLGQRTEMGGLQRKDYTTNGNQRIEREMDNFYVKYPLNNKGIIHFGINLIPPKPTTLTQNDVTIYKYIYGGKMSFKIDSIKLNPNELTQREASVIVELESPRYGRAWTLATFNLMTQRYEVEFHENWWLGGWRLGTPLTSFDSPVSLTRNQLLRFLITTTNIGIITSSGNSESLNNMKLSGLSIQIGLPIKTNERQAFAKEQGLPKAPVEICDCP--NPAKSNERELSPSCEGCTDLSKQTIIRLEPLGEDVGCGGCLGDKCDECSEGEYIYDIYTGKRLDSCQKAVTIDTKSRRIIVKLREPINLLCKATSYRGGLVTHEWITPNNEYSSQPIISRQYLAKPDYYNRVNLTTYQSETILQIKFAKQEDAGEYTCIAKGIGSEVNETFYVVVIDPNAVSLPDVPEDDEINRKFPLPIPPIHDPPSLTVYEIKK---DPDNSQITLIGGQPEILDTHHTIWYSINGTPIDAK---TEITDTARGAFIVRLPIPYETIKSGNDSITGYFLGKDPVYTPQWTRMMEPVIIATEAD-----EITPDDI---INPPAEVTVPFMQPYIVQVRTKPGKEDISVTWKKIGPLPETITEKKDDDVKTLDSDSTLPEGTSQDKTNLNIWAAAEQHEGIYEGTVVRDRDGVEVKRIQTIIRVQPMTSGSKTELGLAEAAEPIESEVGDDDDQEEKEPPAWDFIVGGFTPDAKHCENPTWTIVDYQLNKTTDITDKVIRTSDENFRVNYPLTSGLYLRFQCKPIPKT-----------SPDPRIILKPIYDNPDSTFPTRLVCMDLNPEYDSSV--NLTSSSMSQEMISHAITSTEQKFIIRKGDIPPIRRLEMDWRRIGEFDPFNNDGYFTCFVNNTETNGSKTIKLPSDKVPIQLPEDPFTRLYIY------SPDTYVVPELDGSAKIMIPEGEQLRIYCVFEARPSNEFHGWRGTTSEIENNIKIEHRIYSSLAQT---DKANLSLDGQKLECVYGER-SKSLEISVIPKDERKLHAKILSDAFINDRLVGITGSDMNLTCDVKHTTR--KPATID-KIDWYVQYPNGIRRDIKHTQLADSLSTGPKGEWIYFTKLTEKPQGLNIFCVVRLED--IQKATQAYYSSPHISLWI------REPKVLVSIEGQDHLGIITGIETQTAQIKCIVKDAWRNKTVEEADIAWE-TKITSIQ--EELSNNNNERARPQPSPKDLPMLGAKALYDTMVIAGLRRQP-NWIARFRCKGTDLKTGAYGYSDFVKLEVLPGDTLEQVPKLRLISHTDPNSP-YPNKVECIDDNQNYESQVTWTRQDEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSN---VNEIFQDSGDRYVRLICTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHKVYVRINELSESG-----LIENQKGSNGTITCNAYD 2838          

HSP 3 Score: 74.7146 bits (182), Expect = 5.197e-9
Identity = 80/355 (22.54%), Postives = 144/355 (40.56%), Query Frame = -3
Query:  870 IRNGTTDYASKTVVVNIIENELLH--PDLVFVTEYSKESPFYPQKLIC-KDKTGVSSKVQVVKETGINNEKVN---IYLTHNEGTLDWNSH---PFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETT---TPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSG------DLFVVKKPVLFSNYSQYYAAVQINEFDA-KTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKN-LRGRCIVIVQGKKYFSKYF 1874
            ++ G   Y S  V + ++  + L   P L  ++     SP YP K+ C  D     S+V   ++    +E ++   I  T N   L W  +    F P  D G Y C   N Y        +P     T   TP+   V+  S VNEI  +   + + +I        C +YG   P   ++   +  +G        ++  + ++  +   Y+  +   +FDA    +G + C + N+   + +R  ++  +  + V I  L  +  ++  +GSN T+ C   D   +       Y WE+E  NG++ +   +++    +   L    + P  N LR RCI +    +Y S  F
Sbjct: 2568 LKTGAYGY-SDFVKLEVLPGDTLEQVPKLRLISHTDPNSP-YPNKVECIDDNQNYESQVTWTRQ----DEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSNVNEIFQDSGDRYVRLI--------CTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHKVYVRINELSESGLIENQKGSNGTITCNAYDGYLQFILPDATYTWEVERINGERVHPNLIADQIEMNHNQLHYYGLSPTANKLRIRCIALNDTARYISSDF 2908          

HSP 4 Score: 67.3958 bits (163), Expect = 1.046e-6
Identity = 75/357 (21.01%), Postives = 145/357 (40.62%), Query Frame = -3
Query: 3255 ELVDPKTKPIDITHL-VRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKG---------KIKI----TIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLD--LHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLV---NGKITEPISRSKYYSKLVISEVKD-------------QDHLGIYEVRVKLENGTVISR-KIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEII-DANIVWKIKTTMGQQI 4223
            E   P+  P D+  L  + + D  +I         + RFRC      D+K          K+++    T++    +  I      S YP  +EC D+N  + S V W  + +P+D   +  T +++ + W   G    D  +  GIYTCR  N ++S+ K V +P         +     + I S+ N IF+         +  + + +    +G+P  +  L+W +   NG      S       LVI   +                H G+++       G +I R ++ +   K   +Y++++ ++ SG +   +G   ++ C+   +  G    I+ DA   W+++   G+++
Sbjct: 2523 ERARPQPSPKDLPMLGAKALYDTMVIAGLRRQPNWIARFRCK---GTDLKTGAYGYSDFVKLEVLPGDTLEQVPKLRLISHTDPNSPYPNKVECIDDNQNYESQVTWTRQDEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSNVNEIFQD--------SGDRYVRLICTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHK---VYVRINELSESGLIENQKGSNGTITCN---AYDGYLQFILPDATYTWEVERINGERV 2862          
BLAST of SMED30010499 vs. TrEMBL
Match: A0A5K4F4U5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 0.000e+0
Identity = 261/732 (35.66%), Postives = 409/732 (55.87%), Query Frame = -2
Query: 6283 STVNINSVKPFHAGTYYCDAK--KNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGT----VIWRREDKKSFQIDVESRVGGET-QALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKL-DKNTCLGSHFACDDNVTLIPRSAWCDENPNC-LNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNV-----FLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTC----ETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQN--QCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERN---DPLCDKC 8409
            S ++I +V+ +H G Y C A   K+ A  ++ +     L VTP E+  RPG++ +FLC+L   +G     V W R D++  +   E  +G    +ALLIV    +  +   Y C        A L V++ C+   R C +  C++E KFC+G+ DCEDG+DE  + C +C  N+ +C  +    P + C   +W CDGE+DCGN +DE NC+   D + C G+H+ C     +I R+  CD  P+C  NG+DE  C +P ++ P+ ET  + H + +++L C     P  TI+WR+NWG L + +  +++ T  +CN   + LT+ ++ P  +G+YTCEA++  RA+A D+ + V    +C+ P FN+AA F  MCL C+CS  TD C+S  GY +SP+         LL++FK+  I+  +Y +   D + +  + + ++  D +  P+V     F+ SDF + GSW++SY Y + IN+RLFGES + +PGP VIL N   +S+YWC  ++  ++++ P G+ N++ I L E++ WFID  C    + +  R   + ++SDIK +  R+KY+ +QT  E FN  V+H + + D  G   +   IE+C CP  Y GLSCEKC  GY+K+  N  +C   C   C +CD  GNC  C G+R+GP+C +C+ G+ R     L++DC  C+     N   V   C  +        CKC   E N   +P CD+C
Sbjct:  584 SFLSIMNVQKYHEGFYVCRALNLKDTAKLIVKIR---DLTVTPEEVKARPGTTVQFLCELSTITGMKGGKVFWMRTDRQDLRSGKEEVIGTNGGRALLIVKDVGRFDHNISYMCTDGYSKGYAKLYVQEVCAPGFRPCGSQQCLEETKFCDGVVDCEDGYDEIPSKCTECGVNENACGLMNDVKPLKNCYLQFWHCDGEDDCGNNFDESNCLAPSDYDQCNGTHYTCPQGDKMIARAFMCDSVPDCEPNGDDESECSYPSIIEPSGETHLIGHQSGNLTLTCVAYGRPPPTISWRYNWGHLREGVKHSINYTVINCNMAISHLTLTDLEPRASGLYTCEAVNRGRALAPDFLVNVAKGGICKAPQFNDAAWFDDMCLTCYCSNVTDTCTSVKGYRKSPH--------DLLLDFKTTPIILSTYNQ---DGSIEEGQGITEIDGDILRIPDVPNESTFIESDFNLSGSWVKSYGYDIIINLRLFGESLNYLPGPFVIL-NSTDQSIYWCPPNDRLLVHTIPTGYDNRIHIRLSERDKWFIDKECKQKIDQTIGRAGFMQIISDIKKIGFRVKYFRDQTTLELFNIKVEHAVKS-DVPGQ--WVGEIEECTCPNGYEGLSCEKCAPGYQKDPDNPLKCRPFCA--CDKCDTEGNCIECPGKRAGPRCQQCQDGYYRPDKSLLATDCQPCDMCGN-NLPYVVKKCHFNPQADDDYFCKCRISEDNKLLNPTCDRC 1294          

HSP 2 Score: 257.684 bits (657), Expect = 0.000e+0
Identity = 374/1631 (22.93%), Postives = 658/1631 (40.34%), Query Frame = -3
Query: 2052 VINAYRNLCQLLMN------ETAKKRDLSENKNCNSLGTENIVD-GKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQN--TNNQLLVNRTENIILVKRNPNQIGLVYVTLKLT----NSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNF-PKWRIGK-----EGKLLEDRETFIRALMTAQHLSIGFPFDNG-FVKDVRLRDLTI---------EHAKWMNDLG-KIAPVEMCLCPKGNPG--------IKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKW----NKVSESTHLNVTHEMTEDK---------SSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEE---------------------------KPPRLAV-EISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENK-VYKIDIEVPTNVTTGVKLKGVIVG---------SRVENPFRFVIEENIKRNLSINSDQLKVSVDKPV-LEVNFLESARVRVLVNP-KIRTETFWYKV-----------NED----GSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEI--LNTTEPRNASIS------------------LYVPDPIKCPSQSWELVDPK-TKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFET--SVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSST-----------------INWKIVGGFSLDLHEGIYTCRINN-------SFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPIS-RSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISY-PK-ETSIYLKV-DGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIK-----------TTMGQQI---PVSELPGFTKEIT-PKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDN----------------------DKITFGGLIYHPADNSAVGVCKADYFNT--IMYSEPFSFKVIKKDRTE-TPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNT-KFNPYNNSGKYTFIATNKFGTDSKTILLPQH---NNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYP-ISLKWS---------PVNEYQLS--GATVESS-DYVTSLIYDKFDR-KINSGEYTCQAISHQGLLTKK--VQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETD 6293
            ++N   + CQL ++      + AK     +  +C+  GT+   D G C+CK  Y G  C EC  G+F++  +CL+C+CS KT  C                    D+ L  R   G  + ++  TN    + R  +   VK   N  G+++  + L      +   +D+  Y  +YGGK+SF  +       +L   + +  +E+ES ++GR WT+ +FN  T+  E  F E+ +   WR+G      +  +   R   +R L+T  ++ I     N   + +++L  L+I         E   +  + G   APVE+C CP  NP           CE C  +  + +I + P   D+ CG C    C +C EG Y YD    K   +CQ  + + TK R I V   E I + C A S+RGG+  H+W    N+ S    ++  +    D           S  IL  K  +  D G Y C A    S  +E F+++V +                            PP L V EI     +   T +   V  P+    +   W+ +     DAK   ++I+ T     + ++ I   T  +    + G  +G         +R+  P     E +      I  D +   ++ P  + V F++   V+V   P K      W K+           ++D     S+  LP G ++D  +L IW+A + H G Y G ++   +G +V +++T ++V PM      E+      EP  + +                    + PD   C + +W +VD +  K  DIT  V + SD+   ++  L+ G  +RF+C  IP+            S  P + +K  ++   S +P  + C D N  + SSV        + + ++ +  +S+                  ++W+ +G F    ++G +TC +NN       +    S  VP+   +   +R   Y      +  T  + +   +  I + + ++L I       P+N+         +I   I    + YS L  +   D+ +L +   +++   G   S+ +EIS  PK E  ++ K+      +  +  + G   ++ C +  + +  +   ID  I W ++           T +   +   P  E   FTK    P+ L I    R  +  I + T  Y +  + S +I      +   + V + G      ++ +E  T+Q+ C   DA  N+ +     +W  T I S+   ++L  +N                      D +   GL   P +  A   CK     T    YS+    +V+  D  E  P+L +    DPN P YP  V C D   N  S +T    ++  D  ++ + P   ++ +T N   KF+P  ++G YT  + N + +  K + +P      +       E+ I S    +N+  +  GD  +++IC ++GHP P   L+WS          ++ + LS  G  ++S   Y T++   +FD    ++G + C A++  G + ++  V+VE     + I+ L+E G     +I  ++G N     N  D
Sbjct: 1286 LLNPTCDRCQLAIDRGDELPDDAKCDTKPQPMDCHYYGTQLTSDNGDCQCKTGYTGVKCDECEEGYFNYMGQCLQCYCSGKTSSC---------------PGFGFDIWLGQRTEMGGLQRKDYTTNGNQRIEREMDNFYVKYPLNNKGIIHFGINLIPPKPTTLTQNDVTIYKYIYGGKMSFKIDSIKLNPNELTQREASVIVELESPRYGRAWTLATFNLMTQRYEVEFHENWWLGGWRLGTPLTSFDSPVSLTRNQLLRFLITTTNIGIITSSGNSESLNNMKLSGLSIQIGLPIKTNERQAFAKEQGLPKAPVEICDCP--NPAKSNERELSPSCEGCTDLSKQTIIRLEPLGEDVGCGGCLGDKCDECSEGEYIYDIYTGKRLDSCQKAVTIDTKSRRIIVKLREPINLLCKATSYRGGLVTHEWITPNNEYSSQPIISRQYLAKPDYYNRVNLTTYQSETILQIKFAKQEDAGEYTCIAKGIGSEVNETFYVVVIDPNAVSLPDVPEDDEINRKFPLPIPPIHDPPSLTVYEIKKDPDNSQITLIGGQV-KPEILDTHHTIWYSINGTPIDAK---TEITDTARGAFIVRLPIPYETIKSGNDSITGYFLGKDPVYTPQWTRMMEPVIIATEAD-----EITPDDI---INPPAEVTVPFMQPYIVQVRTKPGKEDISVTWKKIGPLPETITEKKDDDVKTLDSDSTLPEGTSQDKTNLNIWAAAEQHEGIYEGTVVRDRDGVEVKRIQTIIRVQPMTSGSKTELGLAEAAEPIESEVGDDDDQEEKEPPAWDFIVGGFTPDAKHCENPTWTIVDYQLNKTTDITDKVIRTSDENFRVNYPLTSGLYLRFQCKPIPKT-----------SPDPRIILKPIYDNPDSTFPTRLVCMDLNPEYDSSV--NLTSSSMSQEMISHAITSTEQKFIIRKGDIPPIRRLEMDWRRIGEFDPFNNDGYFTCFVNNTETNGSKTIKLPSDKVPIQLPEDPFTRLYIY------SPDTYVVPELDGSAKIMIPEGEQLRIYCVFEARPSNEFHGWRGTTSEIENNIKIEHRIYSSLAQT---DKANLSLDGQKLECVYGER-SKSLEISVIPKDERKLHAKILSDAFINDRLVGITGSDMNLTCDVKHTTR--KPATID-KIDWYVQYPNGIRRDIKHTQLADSLSTGPKGEWIYFTKLTEKPQGLNIFCVVRLED--IQKATQAYYSSPHISLWI------REPKVLVSIEGQDHLGIITGIETQTAQIKCIVKDAWRNKTVEEADIAWE-TKITSIQ--EELSNNNNERARPQPSPKDLPMLGAKALYDTMVIAGLRRQP-NWIARFRCKGTDLKTGAYGYSDFVKLEVLPGDTLEQVPKLRLISHTDPNSP-YPNKVECIDDNQNYESQVTWTRQDEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSN---VNEIFQDSGDRYVRLICTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHKVYVRINELSESG-----LIENQKGSNGTITCNAYD 2840          

HSP 3 Score: 75.0998 bits (183), Expect = 4.943e-9
Identity = 80/355 (22.54%), Postives = 144/355 (40.56%), Query Frame = -3
Query:  870 IRNGTTDYASKTVVVNIIENELLH--PDLVFVTEYSKESPFYPQKLIC-KDKTGVSSKVQVVKETGINNEKVN---IYLTHNEGTLDWNSH---PFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETT---TPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSG------DLFVVKKPVLFSNYSQYYAAVQINEFDA-KTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKN-LRGRCIVIVQGKKYFSKYF 1874
            ++ G   Y S  V + ++  + L   P L  ++     SP YP K+ C  D     S+V   ++    +E ++   I  T N   L W  +    F P  D G Y C   N Y        +P     T   TP+   V+  S VNEI  +   + + +I        C +YG   P   ++   +  +G        ++  + ++  +   Y+  +   +FDA    +G + C + N+   + +R  ++  +  + V I  L  +  ++  +GSN T+ C   D   +       Y WE+E  NG++ +   +++    +   L    + P  N LR RCI +    +Y S  F
Sbjct: 2570 LKTGAYGY-SDFVKLEVLPGDTLEQVPKLRLISHTDPNSP-YPNKVECIDDNQNYESQVTWTRQ----DEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSNVNEIFQDSGDRYVRLI--------CTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHKVYVRINELSESGLIENQKGSNGTITCNAYDGYLQFILPDATYTWEVERINGERVHPNLIADQIEMNHNQLHYYGLSPTANKLRIRCIALNDTARYISSDF 2910          

HSP 4 Score: 67.3958 bits (163), Expect = 9.950e-7
Identity = 75/357 (21.01%), Postives = 145/357 (40.62%), Query Frame = -3
Query: 3255 ELVDPKTKPIDITHL-VRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKG---------KIKI----TIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLD--LHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLV---NGKITEPISRSKYYSKLVISEVKD-------------QDHLGIYEVRVKLENGTVISR-KIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEII-DANIVWKIKTTMGQQI 4223
            E   P+  P D+  L  + + D  +I         + RFRC      D+K          K+++    T++    +  I      S YP  +EC D+N  + S V W  + +P+D   +  T +++ + W   G    D  +  GIYTCR  N ++S+ K V +P         +     + I S+ N IF+         +  + + +    +G+P  +  L+W +   NG      S       LVI   +                H G+++       G +I R ++ +   K   +Y++++ ++ SG +   +G   ++ C+   +  G    I+ DA   W+++   G+++
Sbjct: 2525 ERARPQPSPKDLPMLGAKALYDTMVIAGLRRQPNWIARFRCK---GTDLKTGAYGYSDFVKLEVLPGDTLEQVPKLRLISHTDPNSPYPNKVECIDDNQNYESQVTWTRQDEPIDPAQITTTPNNAVLKWTHNGMDKFDPRIDAGIYTCRSVNPYSSSVKQVYIPYDLMVTDYETPITPEVRILSNVNEIFQD--------SGDRYVRLICTFYGHPPPEGGLQWSIDRFNGTRNSLSSHWLSMQGLVIQSGRHYWTTIGSPQFDALGRHTGVFQCTALNSIGQIIERDQVRVELHK---VYVRINELSESGLIENQKGSNGTITCN---AYDGYLQFILPDATYTWEVERINGERV 2864          
BLAST of SMED30010499 vs. TrEMBL
Match: A0A4E0S494 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Fasciola hepatica OX=6192 GN=D915_000229 PE=4 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 0.000e+0
Identity = 260/754 (34.48%), Postives = 398/754 (52.79%), Query Frame = -2
Query: 6280 WTFKNLASNVETNLSKDAVIRHNSFN---STVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASG----TVIWRREDKKSFQIDVESRVGGET-QALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDK-NTCLGSHFACDDNVTLIPRSAWCDENPNC-LNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPN-VFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTC----ETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERN---DPLCDKCL 8487
            W+F    S  E  +  D  I   S     S +NI +V+ +H GTY C A    A++ L VL + TL V P ++  RPG++ RFLC+L   SG     + W R D+K  +   E  +G    +ALLIV++     + T Y C       ++ + V++ C    R+C +  C+  + FC+G  DCEDG DE +  C +C  N+  C  +GGK P + C   YW+CDGE+DCGN +DE NC    K + C G+ + C ++   I R+  CD   +C  NGEDE  C  P VV P+ ET      ++++++ C V   P   I+WR+NWG L   +   ++ T  DCN + + LT+ ++ P+  G+YTCEA++  R +A D+++ V    LC  PMFN+AA F  MC+KC+CSG T +C S  GY +S   K    ++G         ++ + Y  S  +  +K  +F  ++ +    +   VFL    G++GSW+ SY + LK  +RLFG + + + G  V L     +SLYWC   +  + Y+   G+ N + I + E+E WF+D  C      +  R   + +L  +K + IR   Y +QT FE  +  ++H +  P  +   ++   IE+C CP  Y GLSCEKC  GYE++     + +    C ECD++GNC  C+G RSGP+C +CK GF R Y   L+ DC  C+  +Q    +V   C+  +       CKC  +E     DP CD+C+
Sbjct:  563 WSFIPKGSEEEVLVHPDVNIERPSATPATSFINIANVQKYHEGTYVCRALNMKATSELVVLTR-TLSVNPEQLDARPGTTVRFLCELSAVSGLDGGKLYWMRTDRKDLRPGKEEVIGSTGGRALLIVHSVDWTDHNTTYMCTDGVSSAQSRIFVREACGPGFRSCESGGCVSSSVFCDGKNDCEDGSDENVAKCNECGANELRCEEIGGKKPLRSCFLQYWKCDGEDDCGNNFDEENCPPPTKPDRCNGTQYICPESNKPIARAFLCDGVADCEPNGEDENECSLPVVVEPSGETQMFGKRSTNLTMTCIVHGKPPPAISWRYNWGGLRDGVKHVINHTVVDCNTVISHLTLIDLEPEAGGLYTCEAVNKGRTLAPDFSVNVAQGGLCHPPMFNDAAWFEDMCIKCYCSGVTQNCRSVQGYSKSSTDKYWIISEG-------SSVIRI-YRDSEVEETTKGLEFTPRLIRYKGSESGLVFLEGPLGLNGSWITSYGHNLKFTVRLFGTTTERLKGAMVALHGPE-ESLYWCPPTDRVLFYAMNVGYENDISIRINERERWFLDPNCTQRLSEATGRAQFMNLLKMVKRVGIRTNIYDDQTSFELQDLRLEHSV--PSDL-PGVWVAEIEQCECPPGYEGLSCEKCAYGYERHPTEPGLCRLQCACDECDEHGNCLTCSGNRSGPRCQQCKTGFYRPYESSLADDCIPCDRCAQGAPHVVKE-CVDSMLPAEDPFCKCQAKEDGKLVDPDCDQCV 1302          

HSP 2 Score: 291.967 bits (746), Expect = 0.000e+0
Identity = 253/938 (26.97%), Postives = 409/938 (43.60%), Query Frame = -3
Query: 3777 ENKNCNSLGTEN-IVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTL-NSADIKLDVVLSNRQISG--VYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKL----TNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPK-WRIGKEGKLLED-------RETFIRALMTAQHLSI--GFPFDNGFVKDVRLRDLTIE----HAKWMNDLGKIAPVEMCLCPKGNP------GIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNV---------THEMTEDKSSNL----------ILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIV-------------EEKPPRLAV---EISVTT-----------IDKVK-TQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVG-SRVENPFRFVIEE-NIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNP-KIRTETFWYKVN---ED---GSEHP--LPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRP---VV-----------NKEILNTTEPRNA-----SISLYVPDPIKCPSQSWELVDPKTKPI-DITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFE--TSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSST--------------INWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVP 6224
            E   C + GT++  V G+C+C+  Y+G  C +CS G+F F K+CL C+CS +T  C+ SD++ F N+TL +      D+ L+     G  +     TN +  + +    ++V+    + GL++  L +    T S    DI  Y  LYGG++SF         + +  S     IEI+S +FGR+WT  +FN +T+  E  F E+ +P  WRIG      E        R   +R L TA  +SI     F  G  KD+RL  L I+     A   +     APVE+C CP+ +        + CE C        + + P  PD+ C  C  P+C +C  G +KY+    ++  TC+ G+EM ++ R + +     + + C   S+ GGI  H+W   S S    V          +E   DK S +          I++    + SD G+Y C A    S+     ++ V             EEK   L V    IS TT            D  K T V  TV +P   T  ++ WF         K      +  T   V ++D+   + ++    + G  VG S V NP+   + +  I    +       +   +P + V F++   ++V V P K      W ++    ED     E P  LP G+T+D  +L+IW+  + H G Y G +I   +  ++ +   TV+V PM P   V+             E + +  P+        +  + PD   C   +W +VD +T  I D+T  V ++S     +D  L+ G  +RF+C  +P++++ G+IK  I S  P +  +  ++   S +P  + C D N + PS V        VD+     +  S+               ++W+ +G F   +  G +TC +NNS  S SK++ VP
Sbjct: 1320 EPSPCEAAGTKSGTVAGECECQTGYRGDRCEDCSDGYFRFHKRCLGCYCSGQTSSCRMSDRHYFWNVTLADPQGFDFDIWLAQGSAHGNLLRSDFTTNGERRLEQVNGDVIVRHPILERGLIHFVLNIHHTQTGSQTDSDIPIYRNLYGGQMSFRLNSPNLDPQKVTQSQAGVVIEIDSPRFGRVWTQATFNVETQRYEVEFNENWWPGGWRIGTTDAFGERGPQQGLLRGQLLRVLGTASSISIVTSSGFSEGL-KDMRLSGLAIQVALPSAPSSDPDAPFAPVEVCDCPEPSKPEERALSLSCEGCRDPRKRTTVRLQPGGPDLECEECRGPNCDECASGLFKYNVYTGRSLQTCRPGLEMDSEQRYVVIRTGSPLTLVCRVTSYLGGIVTHEWVAPSSSDPDRVEISRRPILRPNEPGIDKDSQMFNQSIHRSEAIISISSAEKSDSGVYSCRASGIGSSLDRPTYVEVLDETDGIPLTHPDEEKLGALNVIQPSISPTTPFLSKYTFESEPDNPKVTVVKGTVKNPSDLTANQLVWFASNGSAFHIK--PDVYNTETGEVVVRLDVPYSSVLSGKESINGYFVGNSPVFNPYWTPMRKPEIAFPTADEVSAKDIVPPEPEVRVPFMQPHTIKVQVTPGKTPIHVIWTRIGSLPEDFRKWEELPGALPEGMTQDETNLIIWAGTEQHEGVYEGLVIRDSDQQEIARFNVTVRVDPMVPDSKVILPPGKADDLPDKDENVTSVTPKPGVTWDFVVQGFTPDAEYCEYPTWTMVDYQTNTITDVTERVHRLSPSSFRVDYPLTSGIYLRFQCQPVPKLNLTGEIKFNISSPDPRIVFQTLYDDPNSTFPTRLICLDLNPSRPSDVNISSDSMTVDRIRDALSVPSTVKVHRPGDVPIRQLELDWRRIGDFDPFIDSGKFTCFVNNSETSGSKTITVP 2254          

HSP 3 Score: 90.1225 bits (222), Expect = 1.286e-13
Identity = 92/404 (22.77%), Postives = 166/404 (41.09%), Query Frame = -3
Query:  870 FSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKT--VVVNIIENELLH--PDLVFVTEYSKESPFYPQKLIC-KDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNS---HPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPM---NEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP----MIDVEIVYE--AKSGDLFVVKKPVLFSNYSQYYAAVQINEFDA-KTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLS-ESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYF 2024
             SG+ E R P       L T + N    V G ++  + V      E R R ++  ++ ++++  V + ++  + L   P L    + S E P+YP ++ C  D     S+V   ++ G      ++ +  N   L W       F P  D G Y C  TN +        LP+      P+   +  ++  S VN+I  E   + + ++  +   + C+YYG  AP       VE + E    +G   +    +   +   Y++ +   +FDA    +G Y C + +    +  +  I+  +  ++V I+ L+    ++ T+G N  + C   D   +      +Y WEIE  NG + N  +L+ E  + D      N+       R RC+V     +Y S  F
Sbjct: 2541 ISGIDEDRIPNSYEIPWLGTREDNGILVVGGLRVREEWVG-----EFRCRAKSPVSNASAESDWVRLEVLTGDTLMRVPKLRLEAKSSPEFPYYPTQVNCIDDNEEFPSEVTWTRQEGTIPPN-DLEVKPNSARLTWTHDGVEKFDPQRDAGVYVCRATNAFSSSVRQFYLPQDMMPKEPIPISDHKIEITSDVNQIFYENGDRYMRVVQNSPFELLCSYYGHPAPPGGLQWSVERINELGQSAGSPSIAMLGLRVRSGRHYWSEIGTPKFDAMGRHAGVYRCEALSQDGRVIKQSLIRVELHKVNVRIQELNDAGFIEATEGDNGAITCNAYDGYFEFILPEAKYSWEIERMNGDRVNPNSLATEVNIEDNHIKYTNINPAANAFRARCVVHNDTARYVSADF 2938          

HSP 4 Score: 70.8626 bits (172), Expect = 8.189e-8
Identity = 74/332 (22.29%), Postives = 130/332 (39.16%), Query Frame = -3
Query: 3102 VEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVG--GFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITE-------PI---------SRSKYYSKLVISEVKDQD-HLGIYEVRVKLENGTVISRK-IEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDV 4037
            +E K   E   YP  + C D+N   PS V W  +   +  N +    +S+ + W   G   F      G+Y CR  N+F+S+ +   +P               I ITS  N IF +     + V +    E+    +G+PA    L+W V  +I E       P          S   Y+S++   +      H G+Y      ++G VI +  I +   K   + +++  +N +G +   EGD  ++ C+        E  + +A   W+I+   G ++  + L      I    +K +  N   N++  +C    +   Y S    F +
Sbjct: 2618 LEAKSSPEFPYYPTQVNCIDDNEEFPSEVTWTRQEGTIPPNDLEVKPNSARLTWTHDGVEKFDPQRDAGVYVCRATNAFSSSVRQFYLPQDMMPKEPIPISDHKIEITSDVNQIFYENGDRYMRVVQNSPFELLCSYYGHPAPPGGLQWSVE-RINELGQSAGSPSIAMLGLRVRSGRHYWSEIGTPKFDAMGRHAGVYRCEALSQDGRVIKQSLIRVELHK---VNVRIQELNDAGFIEATEGDNGAITCNAYDGYF--EFILPEAKYSWEIERMNGDRVNPNSL-ATEVNIEDNHIKYTNINPAANAFRARCVVHNDTARYVSADFGFRI 2942          

HSP 5 Score: 70.4774 bits (171), Expect = 1.245e-7
Identity = 90/376 (23.94%), Postives = 136/376 (36.17%), Query Frame = -3
Query: 2052 VSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSV-------------VNWKKLIEDNDKITFGGLIYHPADNSAVG--VCKAD--YFNTIMYSEPFSFKVIKKDR-TETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNT-KFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKII--------CVYFGHPYPI-SLKWS--PVNEYQLS---------GATVESSDYVTSLI----YDKFDRKINSGEYTCQAISHQGLLTKK--VQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETD 3044
            V  VE  T  + C   D    +       +W  T +  +             + W    EDN  +  GGL         VG   C+A     N    S+    +V+  D     P+L +     P  P YP  V C D      S +T            +  KP    + +T +   KF+P  ++G Y   ATN F +  +   LPQ        P        +  +N      GD  ++++        C Y+GHP P   L+WS   +NE   S         G  V S  +  S I    +D   R  ++G Y C+A+S  G + K+  ++VE     + I  LN+ G      I   +G+N     N  D
Sbjct: 2504 VQGVEAQTLHLKCAVTDLWRQKPARNAHITWE-TRVKPISGIDEDRIPNSYEIPWLGTREDNGILVVGGLRVR---EEWVGEFRCRAKSPVSNASAESDWVRLEVLTGDTLMRVPKLRLEAKSSPEFPYYPTQVNCIDDNEEFPSEVTWTRQEGTIPPNDLEVKPNSARLTWTHDGVEKFDPQRDAGVYVCRATNAFSSSVRQFYLPQDMMPKEPIPISDHKIEITSDVNQIFYENGDRYMRVVQNSPFELLCSYYGHPAPPGGLQWSVERINELGQSAGSPSIAMLGLRVRSGRHYWSEIGTPKFDAMGR--HAGVYRCEALSQDGRVIKQSLIRVELHKVNVRIQELNDAG-----FIEATEGDNGAITCNAYD 2868          
BLAST of SMED30010499 vs. TrEMBL
Match: A0A4S2KYA6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010460 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 0.000e+0
Identity = 259/757 (34.21%), Postives = 395/757 (52.18%), Query Frame = -2
Query: 6280 WTFKNLASNVETNLSKDAVI-RHNSFNST--VNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGA----SGTVIWRREDKKSFQIDVESRVGGET-QALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNC-LNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKM--YQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTC--ETSAM--RPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYE--KNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERN---DPLCDKCL 8487
            W F     ++E +L +   I R  +  ST  + I +V+ +H G + C +      A LNV  +  L V P E+  RPG+SARFLC+L        G + W R D++  +   E  +G    + LLIV + + E N T YEC      + A + V+D C    RAC +  C++  +FC+G +DCEDG DE ++ C +C PN++ C  + GK P +KC   YW CDG++DCGN +DE NC +  + + C G+HFAC     LI RS  CD   +C  +G DE  C  P ++ P+ ET      + +++L C V   P   INWRFNWG L   + + ++ T  DCN++ + LT+ NM P  +G+YTCEA+S +R+MA D  + V    +C  P FN+ A F   CL+C+CSG TD C SA GY +SP  K        +        + V Y   I +  +   +    +  Y ++  D   +L  +FG+ G W+ SYSY +K+ IR +G   +  PG  V L     K++YWC + N  ++ +  +G+ N+L I L E++ WF D  C    S++  R   + +L D++ + IR++ + +QT  E  +  +++V     S   + +   +E+C+CP  Y GLSCE C  GY+   ++  +C  +C   C +CD  GNC  C G R GP+C  C+ GF R     +  DC  C   +     +V   C      +   +CKC  RE     DP CD+C+
Sbjct:  557 WYFLPSEDSIERHLPQGVSIGRPAATPSTSFLTIKNVQKYHEGEFLCRSFGMERRARLNVKLR-ALSVNPEEVDARPGTSARFLCELSVVPGLDGGKLFWMRTDRRDLKPGKEEVIGSTGGRTLLIVKSLSWEDNSTTYECSDGVNSVTARIFVRDDCPPGYRACNSRGCVESWRFCDGKQDCEDGSDELLSKCDECSPNEYVCRMLDGKKPLRKCYLQYWHCDGDDDCGNNFDEANCPLPSEYDKCNGTHFACPGQSKLISRSFVCDGVADCEADGADEHECSDPVIIEPSGETHLFGIQSKNLTLTCAVYGHPPPAINWRFNWGGLRDDVTYVMNTTVVDCNKVISQLTLTNMEPQASGLYTCEAVSKRRSMAPDIAVNVAKGGMCTVPFFNDGATFADECLRCYCSGVTDKCQSAKGYVKSPVNK--------MWKLTGTTSVIVLYNDDIGEATTDGLQITDNLVRYTNYPED-EAYLEGEFGLQGPWVTSYSYNMKVKIRQYGPFTNFFPGALVALHGKE-KTIYWCPHPNQILLNTAEDGYENELSIKLNERDRWFEDRKCSRRLSSLDGRSAFMNILRDVQTIGIRVRNFEDQTSTEVQDVQLEYVTP---SGRTDAWVTEVEQCDCPVGYEGLSCESCALGYQPDPDEPGKCQPRC--VCDKCDAQGNCINCPGNRVGPRCQHCQTGFYRPERSTMDEDCVPCEKCAAAPAHVVKE-CAGSTLPEQHYLCKCEVREDGKLVDPDCDQCV 1296          

HSP 2 Score: 327.02 bits (837), Expect = 0.000e+0
Identity = 390/1649 (23.65%), Postives = 674/1649 (40.87%), Query Frame = -3
Query: 1932 AKKRDLSENKNCNSLGTENIV-DGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTL-NSADIKLDVVLSNRQISGVYE--AQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKL----TNSTVPDDIHKYTLLYGGKISFTFEY-NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPK-WRIGKEGKLLEDRETFIRALMTAQHLSI-------GFPFDNGFVKDV---RLRDLTIEHAKWMNDL---GKI-------APVEMCLCP-KGNPGIK-----CEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKW------NKVSESTHLNVTHEMT----------EDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEK----PPRLA---------VEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTEN-----KVYKID---------IEVPTNVTTGVK--LKGVIVGSR-VENPF-----RFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNP---KIRTETFWYKVNE--------DGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTT-----EPRNASISL---------YVPDPIKCPSQSWELVDPKTKPI-DITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFE--TSVYPVSMECRDNNTAHPSSVVWYFKGKPVDK---NLVIN-----------TNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQAL-SIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISR--SKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIE--------ISYPKETSIYLKVDGINPSGNMTI-LEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSE-----------------LPGFTKEITPKEL----KISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSV----------------VNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFS-FKVIKKD-RTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNT-KFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAE----LSIFSTSPVINDK-----IRIQGDTSLKIICVYFGHPYPI-SLKWS---------PVNEYQLSGATVESSD-YVTSLIYDKFDRK-INSGEYTCQAISHQGLLTKKVQ--VESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIR-------HPGMTNYSLLTTDKVNAKFEVTG 6245
            AK  +  E   CN+ GT++++ +G C CKENY GP C +C PGF  ++  CL+C+C+ ++  C+ S ++ F N+T+ + A +  D  L+ R I G  E        Q  + RT   ++V+    + G++++ +++     +S   +DI  Y  LYGG++ F  +  N DL K L   +    +E+ES+++GR+WT   +N+  +T E  F E+ +P  W++G     +E    F + L   Q L +            +G  K +   ++  L+I+ A+ +N     G +       APVE+C CP   +P  +     CE C       VI ++P  PD VC          C  G +KY+    + + +CQ+G+ + T+ R+I V K + +R+ C + SHRGGI +H+W       + +  +   + H  +          E   S  I   +     D G Y C A    + A    ++IV E     PP +            ISV    K  + V+ T++S   PTD  V    +K  +    E    + ++        K+ ++D         + VP          ++G  VG     NPF     R  + E+ K  +  N     ++     +E+ F++   +RVL  P   KIR +  W ++++        D      P G+ +D NDL+IW+A + H G Y G +   D+G ++ +   T++V P+ P     +   T     +P +  ++          + P+   C    W L+D + K + D+TH V+++S     ++  L+ G  +RF+C+ +P   + G+IK  I S  P +  +  +E   S +P  + C D N + PS V         DK    LV +           +     ++W+ +G F      G YTC +NN+  S +++V +PD K            I I S    + ++     S+ VT+  RL +       PA+D  L W  +        R   + YS LV           I E  + L+  TV  + ++        +    E +  +KV      G+  I   G    ++C  +K V+G    I    I W ++   G++  VS+                   G TK  T  ++    +   A   L +Y            + S  +   +    +  +++ L       V   E  T ++ C A D   NR +  V+ SW  T +                   + W    E ++ +  GGL   P           D  + +  S  ++  +V+  D  + TP+L +     P+ P YP    C D      S ++          + V  KP    I +  N   +F+P  + G YT  A N + +  K I  P         PA     L   ST  ++ D       R+      +++CV++GHP P   L+W+          ++   + G  V+S   Y   L    FD K  ++G Y C A+   G + ++ Q  VE +   +++  L + G     VI +++G + V   +  D   N      +  WE+        HP M   +++ T+    + E TG
Sbjct: 1309 AKCEEQPERLECNTEGTQSVLGNGDCVCKENYDGPRCDQCKPGFIKYKNSCLECYCAGQSPSCQLSKEHVFWNVTMEDPAGMTFDFWLARRSIHGGLERVEDAVTEQPRLERTPTELIVRTPVLERGIIHLAVQIKPPPVDSPTTNDIPIYRYLYGGQMFFRLDAVNLDLSK-LKAEEARVVVELESERYGRVWTQAVYNKALQTYEVQFDENWWPGGWKLGTP---IEGHGQF-QGLTRGQLLRVLATTSSISIVTSSGLSKGLAGMKISGLSIQLAQSVNQRPTPGGVDPNTLPPAPVEVCDCPMPSSPDERELSPSCEGCKDTSLRTVIRMNPYGPDFVCSTLLGSKFDGCPSGQFKYNVYTGERYDSCQLGLTIDTRQRVIVVTKGDPVRLVCESTSHRGGIGVHEWIPPVSSARTANESRRRIIHTPSLAIRALPSDAESHRSEAIFEIENANKQDEGEYRCRATVIGTMAELPIYLIVREPDEPMPPAIVDAEDPLNSKFWISVPPGAKAPSAVSYTLES--DPTDDSVTRATIKMRDPADLENHQLVWLSPNGSQIVTKLERMDLFRGEAQFLLHVPHAQLEAQPEDVQGYFVGKNPASNPFWTPIGRPKVMESAKDRVKSND----ITAPPSTVEIPFMQPETLRVLKKPGKSKIRVD--WKRLSDIPDKPEPSDVIPSRFPEGMIQDGNDLVIWAAAEQHEGVYEGVVYRDDDGKELKRFNVTIRVQPLNPGKTTHLAPGTAADLPQPTDDDVTTPVWDFVVQGFTPEAEYCEEPKWMLIDYQKKTVTDVTHKVQRLSPSSFRVEYPLTSGIYLRFQCTPVPWSKLFGEIKYNITSDDPRIVFETYYENPNSTFPTRLVCYDLNPSRPSDVEIASDAMGPDKLKEALVTSPLGREQDPHGLSKVKVELDWQRIGNFDPFSDSGGYTCFVNNTEASGTRTVQIPDEKVPVKVPEDPFSRIYIYSPDTFVSQEVDGRSSVEVTEGDRLRLYCHYDARPASDF-LGWGSDSSEVNANMRFTHRPYSSLV----------EIGEANLDLDGKTVSCKTVDKEKVVELKVISKTERAYEVKVTSEYMVGDRIIGTTGGDLDLQCE-VKQVRGVPVAI--QRIDWFVQYPNGRRHAVSKSKLAQNVQLEDNGSKLRFSGLTKRSTGAQIFCVARPVDATSALQAY------------HPSPSVELWIRSPKLLAEIQPLAR--PGVVVGPEAGTIRLYCTATDKWHNRTVENVQISWE-TEVRPEYIPDGGELKIRPSPHDIPWLLKQEIHNSLVVGGLRRPPEWIGRFRCTVTDPLSNVSTSSDWAVLEVLAGDVASRTPKLRIIAESRPSFPFYPTRAECVDENKEYPSEVSWIRNEDAMVPENVEQKPSSATIIWKVNGIEEFDPRKHGGIYTCKAVNPYSSAYKQIQFPLDVMPKEPIPAADHKLLITSSTHEILRDTDEIPYTRVIQGQPFELLCVFYGHPPPAGGLQWTVKRTGTATDGLSRMLMQGLQVKSGRLYWAQLSASSFDAKGKHTGLYQCAALDSTGNVVQQTQVRVEMYKVNVKVKELTDSG-----VIEREEGSDGVITCSAYDGYLNFILPDATYTWEVEKYTGERVHPNMLANTVVITEN---RIEYTG 2907          

HSP 3 Score: 80.8777 bits (198), Expect = 8.252e-11
Identity = 101/436 (23.17%), Postives = 178/436 (40.83%), Query Frame = -3
Query: 3009 KTKPIDITHLVRKVSDKEIIIDRELSIGQVI-RFRCSVIPEIDMKGKIKITIDSKFPVVEI----------------KKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVG--GFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALS-IFVTKKQRLEITAELFGNPANDSQLEWLV--NGKITEPISR-----------SKYYSKLVISEVKDQD-HLGIYEVRVKLENGTVISR-KIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEII-DANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVI 4208
            +  P DI  L+++     +++       + I RFRC+V   +       ++  S + V+E+                + +     YP   EC D N  +PS V W      +    V    SS+TI WK+ G   F    H GIYTC+  N ++SA K +  P               + ITSST+ I +    +    V + Q  E+    +G+P     L+W V   G  T+ +SR             Y+++L  S    +  H G+Y+       G V+ + ++ +   K   + +KV  +  SG +   EG    + CS   +  G  + I+ DA   W+++   G+++  + L   T  IT   ++ +  +R  +++  +C    +   Y S    F V++ + +   R    I+      +EED  Q I
Sbjct: 2545 RPSPHDIPWLLKQEIHNSLVVGGLRRPPEWIGRFRCTVTDPLS-----NVSTSSDWAVLEVLAGDVASRTPKLRIIAESRPSFPFYPTRAECVDENKEYPSEVSWIRNEDAMVPENVEQKPSSATIIWKVNGIEEFDPRKHGGIYTCKAVNPYSSAYKQIQFPLDVMPKEPIPAADHKLLITSSTHEILRDTDEIPYTRVIQGQPFELLCVFYGHPPPAGGLQWTVKRTGTATDGLSRMLMQGLQVKSGRLYWAQLSASSFDAKGKHTGLYQCAALDSTGNVVQQTQVRVEMYK---VNVKVKELTDSGVIEREEGSDGVITCS---AYDGYLNFILPDATYTWEVEKYTGERVHPNML-ANTVVITENRIEYTGLSREASNFRAKCVAFNQTARYYSTPFGFRVHRVSGEPAKRPTD-IEPGNTRWIEEDGKQPI 2967          

HSP 4 Score: 73.1738 bits (178), Expect = 1.907e-8
Identity = 74/350 (21.14%), Postives = 148/350 (42.29%), Query Frame = -3
Query:  870 TTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKV----NIYLTHNEGTLDWNSH---PFSPFFDQGTYKCIGTN----RYKQ-RFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENK-KTLEIINGNKLLISCNYYGTEAPMIDVEIVYE----AKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQ-SGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYF 1862
            ++D+A   V+   + +    P L  + E     PFYP +  C D+    +K    + + I NE      N+    +  T+ W  +    F P    G Y C   N     YKQ +F   V+P  +E     +  +   S  +EI  + ++     +I G    + C +YG   P   ++   +    A  G   ++ + +   +   Y+A +  + FDAK + +G Y C + ++T ++  +  ++  +  ++V +K L  +  ++  +GS+  + C   D           Y WE+E+  G++ +   L+ + V  +  +    + +   N R +C+   Q  +Y+S  F
Sbjct: 2592 SSDWAVLEVLAGDVASRT--PKLRIIAESRPSFPFYPTRAECVDE----NKEYPSEVSWIRNEDAMVPENVEQKPSSATIIWKVNGIEEFDPRKHGGIYTCKAVNPYSSAYKQIQFPLDVMP--KEPIPAADHKLLITSSTHEILRDTDEIPYTRVIQGQPFELLCVFYGHPPPAGGLQWTVKRTGTATDGLSRMLMQGLQVKSGRLYWAQLSASSFDAKGKHTGLYQCAALDSTGNVVQQTQVRVEMYKVNVKVKELTDSGVIEREEGSDGVITCSAYDGYLNFILPDATYTWEVEKYTGERVHPNMLANTVVITENRIEYTGLSREASNFRAKCVAFNQTARYYSTPF 2933          
BLAST of SMED30010499 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 211.075 bits (536), Expect = 1.359e-63
Identity = 172/627 (27.43%), Postives = 269/627 (42.90%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTV-HQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ------------------------SPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKV-ILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCKC--TGRERNDPLCDKC 8040
            C  +Q  C+N  CI  +  C+G +DC DG DE +  T + CEPN+F C        + +C    WRCDG+NDC +  DE++C ++   + C    F C  +   IP S  CDE P+C +  DE  C  P V  P +++   +   + ++  C+ V VPT  I WR NWG +P     T+  + G+        LTI ++     G YTCEA++ K    A+           + C +  FN        C+ CFC G T +C S   Y                          +P P TST+   +L+N + ++   V  ++   D++S                P  FL       G+ ++SY  +L+  +    + +   P  K  IL   NG+ L +     +     +P+   NQ +I   E ENW    T   S  R ++L  L++++ + IR  Y +        +  +D         G     P+ +E+C CP  Y+GLSCE C +G+++    + +  C   NC      CD  +G+C  C     GP+C +C+PG+          DC  C C     +   S+ C  D+ GQ     C+   TGR      C+KC
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGT-VTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRVPSNCPEGHFNIGGR----CMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLTSTQ---ILINPEEEEFQLVDLSRRFLDLDS------------HWTLPRQFL-------GNKVDSYGGFLRYKVSYSLQREGSEPDNKADILLMGNGQRLVYRRGSPT-----SPD-IKNQREIKFTE-ENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQ----PKDVEECRCPPGYSGLSCESCSSGFDRVPGGRYLGTCAGCNCHGHASACDPVSGHCLSCQHNTEGPQCDKCRPGYFGDPSRGRHDDCKPCPCPYTETSRRFSDTCFLDVDGQATCDACRPGYTGRR-----CEKC 764          

HSP 2 Score: 55.4546 bits (132), Expect = 1.359e-63
Identity = 78/326 (23.93%), Postives = 124/326 (38.04%), Query Frame = -3
Query: 5301 IVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLL-VNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFT--FEYNT-----DLLKDLVFSDVTPFIE--IESKKFGRLWTVLS--FNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGF----VKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6188
            + +G+  C  N  GP C EC PG F         CL+CFC   T++C  S   R                    Q+ G       N QL  +    N   +    +Q G   ++ +  NS VP DI+ + +           YGG++ +   FE+ +     D   D+V      F+E   ++K   R+ TV++  F E                WR   +G+    RE  + AL     L I   + +      + D+ + D+ + H+       +   VE C CP+G  G  C+ C +VGY    +       +  G C+  DC
Sbjct:  780 VPNGEPLCLANVAGPLCDECKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTR-------------------DQVRG-----GVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNS-VPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPTVVTVPFRESA--------------WRRA-DGQPCT-REHLLMALADVAVLMIRATYADKMSESSISDIHM-DIAVPHSTGNE---RAMEVEECACPQGYRGPSCQEC-EVGYTRTGS------GLYLGTCEKCDC 1053          

HSP 3 Score: 82.8037 bits (203), Expect = 8.574e-27
Identity = 93/385 (24.16%), Postives = 151/385 (39.22%), Query Frame = -2
Query: 6238 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFV-GKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 7356
            C+   F+ +A     CL+CFC G T  C+S+           + +   L     ++ I E    K   +++ +S+  V   +Y  + V P  F        G  + +Y   L+  +R   +S   +    P V+LQ   G  ++   +  ++ +   P       + S W + +            R  +L  L+D+  L+IR  Y    +     +  +D  I  P S GN   A  +E+C CP  Y G SC++C  GY +         C K  C  +  ECD + G C +C    +GP+C  C PGF   YG  ++     C  C C      +  +  C  D  GQ              P C+ C   P   A  R+C++
Sbjct:  799 CKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTRDQVRGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIY--YWVMPESFR-------GDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQ---GNGIFLEHSSQTKPLPRVPTVVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMD--IAVPHSTGNE-RAMEVEECACPQGYRGPSCQECEVGYTRTGSGLYLGTCEKCDCHGHASECDSETGACLQCLHNTAGPRCDSCLPGF---YGNPVTGGIHACRPCPCL----GSAPAKSCYLDSDGQ--------------PTCNNC---PPGYAGRRNCER 1137          

HSP 4 Score: 60.4622 bits (145), Expect = 8.574e-27
Identity = 37/104 (35.58%), Postives = 47/104 (45.19%), Query Frame = -3
Query: 5922 KNCNSLGTENI-VDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNR 6218
            + C++ G+E    +G C+CK N +GP CS C P  F      +  CL CFC   TQ+C  S  YR             DVV S      V+   NT    LVNR
Sbjct: 1136 ERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSSSYYR-------------DVVTS------VFAPGNTQGYALVNR 1220          

HSP 5 Score: 58.5362 bits (140), Expect = 1.470e-7
Identity = 47/203 (23.15%), Postives = 75/203 (36.95%), Query Frame = -2
Query: 6226 RPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADER-DCKKTRSI 6807
            R  +L VL+D+  +LIR  Y++          +++  + N   +   +    +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C  C     G  C +C  G+          DC  C C         S  C  +  G G   C           C++C         ER  C+ T ++
Sbjct: 1451 REHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQAL---EVEQCRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEL--CECNGHSDSCHPETGICTNCLHNTMGELCEQCATGYFGDASAGTPEDCQPCACPHTDPGNQFSPTC--ESLGSGDYQCTACQPGYTGQYCERCAPGYTGNPQERIKCRPTNAL 1646          
BLAST of SMED30010499 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 211.075 bits (536), Expect = 1.477e-63
Identity = 172/627 (27.43%), Postives = 269/627 (42.90%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTV-HQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR---AMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ------------------------SPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKV-ILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCKC--TGRERNDPLCDKC 8040
            C  +Q  C+N  CI  +  C+G +DC DG DE +  T + CEPN+F C        + +C    WRCDG+NDC +  DE++C ++   + C    F C  +   IP S  CDE P+C +  DE  C  P V  P +++   +   + ++  C+ V VPT  I WR NWG +P     T+  + G+        LTI ++     G YTCEA++ K    A+           + C +  FN        C+ CFC G T +C S   Y                          +P P TST+   +L+N + ++   V  ++   D++S                P  FL       G+ ++SY  +L+  +    + +   P  K  IL   NG+ L +     +     +P+   NQ +I   E ENW    T   S  R ++L  L++++ + IR  Y +        +  +D         G     P+ +E+C CP  Y+GLSCE C +G+++    + +  C   NC      CD  +G+C  C     GP+C +C+PG+          DC  C C     +   S+ C  D+ GQ     C+   TGR      C+KC
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGT-VTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRVPSNCPEGHFNIGGR----CMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLTSTQ---ILINPEEEEFQLVDLSRRFLDLDSH------------WTLPRQFL-------GNKVDSYGGFLRYKVSYSLQREGSEPDNKADILLMGNGQRLVYRRGSPT-----SPD-IKNQREIKFTE-ENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQ----PKDVEECRCPPGYSGLSCESCSSGFDRVPGGRYLGTCAGCNCHGHASACDPVSGHCLSCQHNTEGPQCDKCRPGYFGDPSRGRHDDCKPCPCPYTETSRRFSDTCFLDVDGQATCDACRPGYTGRR-----CEKC 764          

HSP 2 Score: 55.4546 bits (132), Expect = 1.477e-63
Identity = 78/326 (23.93%), Postives = 124/326 (38.04%), Query Frame = -3
Query: 5301 IVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLL-VNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFT--FEYNT-----DLLKDLVFSDVTPFIE--IESKKFGRLWTVLS--FNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGF----VKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6188
            + +G+  C  N  GP C EC PG F         CL+CFC   T++C  S   R                    Q+ G       N QL  +    N   +    +Q G   ++ +  NS VP DI+ + +           YGG++ +   FE+ +     D   D+V      F+E   ++K   R+ TV++  F E                WR   +G+    RE  + AL     L I   + +      + D+ + D+ + H+       +   VE C CP+G  G  C+ C +VGY    +       +  G C+  DC
Sbjct:  780 VPNGEPLCLANVAGPLCDECKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTR-------------------DQVRG-----GVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNS-VPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPTVVTVPFRESA--------------WRRA-DGQPCT-REHLLMALADVAVLMIRATYADKMSESSISDIHM-DIAVPHSTGNE---RAMEVEECACPQGYRGPSCQEC-EVGYTRTGS------GLYLGTCEKCDC 1053          

HSP 3 Score: 82.8037 bits (203), Expect = 7.705e-27
Identity = 93/385 (24.16%), Postives = 151/385 (39.22%), Query Frame = -2
Query: 6238 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFV-GKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 7356
            C+   F+ +A     CL+CFC G T  C+S+           + +   L     ++ I E    K   +++ +S+  V   +Y  + V P  F        G  + +Y   L+  +R   +S   +    P V+LQ   G  ++   +  ++ +   P       + S W + +            R  +L  L+D+  L+IR  Y    +     +  +D  I  P S GN   A  +E+C CP  Y G SC++C  GY +         C K  C  +  ECD + G C +C    +GP+C  C PGF   YG  ++     C  C C      +  +  C  D  GQ              P C+ C   P   A  R+C++
Sbjct:  799 CKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTRDQVRGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIY--YWVMPESFR-------GDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQ---GNGIFLEHSSQTKPLPRVPTVVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMD--IAVPHSTGNE-RAMEVEECACPQGYRGPSCQECEVGYTRTGSGLYLGTCEKCDCHGHASECDSETGACLQCLHNTAGPRCDSCLPGF---YGNPVTGGIHACRPCPCL----GSAPAKSCYLDSDGQ--------------PTCNNC---PPGYAGRRNCER 1137          

HSP 4 Score: 60.4622 bits (145), Expect = 7.705e-27
Identity = 37/104 (35.58%), Postives = 47/104 (45.19%), Query Frame = -3
Query: 5922 KNCNSLGTENI-VDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNR 6218
            + C++ G+E    +G C+CK N +GP CS C P  F      +  CL CFC   TQ+C  S  YR             DVV S      V+   NT    LVNR
Sbjct: 1136 ERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSSSYYR-------------DVVTS------VFAPGNTQGYALVNR 1220          

HSP 5 Score: 60.077 bits (144), Expect = 5.511e-8
Identity = 95/478 (19.87%), Postives = 155/478 (32.43%), Query Frame = -2
Query: 6226 TINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPM--------FNNAAMFVSMCLKCFCSGQTDDCSSA----------------MGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYA---------------------KSIYDVNS--------KSYKFVGKMYQDFVVDPN--VFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADER-DCKKTRSI 7467
            T NN  P +AG   CE    + +           K   E P         F+ +      CL CFC G T  C+S+                 GY      +T+  T G  +   +    + S+                      K   D N           Y++   +Y+DF + P+  +F        G  + SY   LK  I     S+   P   + +Q +          D     +   +G        +  +E+++          R  +L VL+D+  +LIR  Y++          +++  + N   +   +    +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C  C     G  C +C  G+          DC  C C         S  C  +  G G   C           C++C         ER  C+ T ++
Sbjct: 1121 TCNNCPPGYAGRRNCERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSSSYYRDVVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQLPNSYQGDKVQSDTNICNVFFFFFSQYRYA-LVYKDFSLHPDDVLFWQLPPKFRGDKVGSYGGKLKYTISYVPGSRG-APIDDIDVQIIGNDITLVARQD-----WRRGQGTRESRSFEIVFREDYWKRPD-GMPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQAL---EVEQCRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEL--CECNGHSDSCHPETGICTNCLHNTMGELCEQCATGYFGDASAGTPEDCQPCACPHTDPGNQFSPTC--ESLGSGDYQCTACQPGYTGQYCERCAPGYTGNPQERIKCRPTNAL 1583          
BLAST of SMED30010499 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 209.92 bits (533), Expect = 3.329e-63
Identity = 172/634 (27.13%), Postives = 271/634 (42.74%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTV-HQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR----------AMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ------------------------SPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKV-ILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCKC--TGRERNDPLCDKC 8040
            C  +Q  C+N  CI  +  C+G +DC DG DE +  T + CEPN+F C        + +C    WRCDG+NDC +  DE++C ++   + C    F C  +   IP S  CDE P+C +  DE  C  P V  P +++   +   + ++  C+ V VPT  I WR NWG +P     T+  + G+        LTI ++     G YTCEA++ K            + ++   F  +   C +  FN        C+ CFC G T +C S   Y                          +P P TST+   +L+N + ++   V  ++   D++S                P  FL       G+ ++SY  +L+  +    + +   P  K  IL   NG+ L +     +     +P+   NQ +I   E ENW    T   S  R ++L  L++++ + IR  Y +        +  +D         G     P+ +E+C CP  Y+GLSCE C +G+++    + +  C   NC      CD  +G+C  C     GP+C +C+PG+          DC  C C     +   S+ C  D+ GQ     C+   TGR      C+KC
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGT-VTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFFFAHCNCPEGHFNIGGR----CMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLTSTQ---ILINPEEEEFQLVDLSRRFLDLDS------------HWTLPRQFL-------GNKVDSYGGFLRYKVSYSLQREGSEPDNKADILLMGNGQRLVYRRGSPT-----SPD-IKNQREIKFTE-ENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQ----PKDVEECRCPPGYSGLSCESCSSGFDRVPGGRYLGTCAGCNCHGHASACDPVSGHCLSCQHNTEGPQCDKCRPGYFGDPSRGRHDDCKPCPCPYTETSRRFSDTCFLDVDGQATCDACRPGYTGRR-----CEKC 766          

HSP 2 Score: 55.4546 bits (132), Expect = 3.329e-63
Identity = 78/326 (23.93%), Postives = 124/326 (38.04%), Query Frame = -3
Query: 5301 IVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLL-VNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFT--FEYNT-----DLLKDLVFSDVTPFIE--IESKKFGRLWTVLS--FNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGF----VKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6188
            + +G+  C  N  GP C EC PG F         CL+CFC   T++C  S   R                    Q+ G       N QL  +    N   +    +Q G   ++ +  NS VP DI+ + +           YGG++ +   FE+ +     D   D+V      F+E   ++K   R+ TV++  F E                WR   +G+    RE  + AL     L I   + +      + D+ + D+ + H+       +   VE C CP+G  G  C+ C +VGY    +       +  G C+  DC
Sbjct:  782 VPNGEPLCLANVAGPLCDECKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTR-------------------DQVRG-----GVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNS-VPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPTVVTVPFRESA--------------WRRA-DGQPCT-REHLLMALADVAVLMIRATYADKMSESSISDIHM-DIAVPHSTGNE---RAMEVEECACPQGYRGPSCQEC-EVGYTRTGS------GLYLGTCEKCDC 1055          

HSP 3 Score: 82.8037 bits (203), Expect = 1.781e-29
Identity = 93/385 (24.16%), Postives = 151/385 (39.22%), Query Frame = -2
Query: 6238 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFV-GKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 7356
            C+   F+ +A     CL+CFC G T  C+S+           + +   L     ++ I E    K   +++ +S+  V   +Y  + V P  F        G  + +Y   L+  +R   +S   +    P V+LQ   G  ++   +  ++ +   P       + S W + +            R  +L  L+D+  L+IR  Y    +     +  +D  I  P S GN   A  +E+C CP  Y G SC++C  GY +         C K  C  +  ECD + G C +C    +GP+C  C PGF   YG  ++     C  C C      +  +  C  D  GQ              P C+ C   P   A  R+C++
Sbjct:  801 CKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTRDQVRGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIY--YWVMPESF-------RGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQ---GNGIFLEHSSQTKPLPRVPTVVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMD--IAVPHSTGNE-RAMEVEECACPQGYRGPSCQECEVGYTRTGSGLYLGTCEKCDCHGHASECDSETGACLQCLHNTAGPRCDSCLPGF---YGNPVTGGIHACRPCPCL----GSAPAKSCYLDSDGQ--------------PTCNNC---PPGYAGRRNCER 1139          

HSP 4 Score: 69.3218 bits (168), Expect = 1.781e-29
Identity = 75/308 (24.35%), Postives = 121/308 (39.29%), Query Frame = -3
Query: 5385 KNCNSLGTENI-VDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVK----------------RNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNE--------KTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6218
            + C++ G+E    +G C+CK N +GP CS C P  F      +  CL CFC   TQ+C  S  YR             DVV S      V+   NT    LVNR     +                   N +++G      +L NS   D +      YGGK+ +T  Y       +  S   P  +I+ +  G   T+++  +        ++++ E +F ED    W+  +   +   RE  +  L     + I   +    ++   +  +++E A      L +   VE C CP G  G+ C+ C
Sbjct: 1138 ERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSSSYYR-------------DVVTS------VFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQLPNSYQGDKVGS----YGGKLKYTISY-------VPGSRGAPIDDIDVQIIGNDITLVARQDWRRGQGTRESRSFEIVFRED---YWK--RPDGMPTTREHLLMVLADLDDILIRASYHTE-MRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQDC 1409          

HSP 5 Score: 62.003 bits (149), Expect = 1.413e-8
Identity = 81/378 (21.43%), Postives = 135/378 (35.71%), Query Frame = -2
Query: 6403 TINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPM--------FNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ----SPNPKTSTRTKGLLMNFKSQKILE-VSYAKSIYDVNSKSYKFVGKMYQD--FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7467
            T NN  P +AG   CE    + +           K   E P         F+ +      CL CFC G T  C+S+  YY+    S     +T+   L+   ++ +I    S   S       S+    ++ Q+  +   PN +        G  + SY   LK  I     S+   P   + +Q +          D     +   +G        +  +E+++          R  +L VL+D+  +LIR  Y++          +++  + N   +   +    +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C  C     G  C +C  G+          DC  C C
Sbjct: 1123 TCNNCPPGYAGRRNCERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSS-SYYRDVVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQLPNSY-------QGDKVGSYGGKLKYTISYVPGSRG-APIDDIDVQIIGNDITLVARQD-----WRRGQGTRESRSFEIVFREDYWKRPD-GMPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQAL---EVEQCRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEL--CECNGHSDSCHPETGICTNCLHNTMGELCEQCATGYFGDASAGTPEDCQPCAC 1480          
BLAST of SMED30010499 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 209.92 bits (533), Expect = 5.081e-63
Identity = 172/634 (27.13%), Postives = 271/634 (42.74%), Query Frame = -2
Query: 6283 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTV-HQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKR----------AMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ------------------------SPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKV-ILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPR-IEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCKC--TGRERNDPLCDKC 8040
            C  +Q  C+N  CI  +  C+G +DC DG DE +  T + CEPN+F C        + +C    WRCDG+NDC +  DE++C ++   + C    F C  +   IP S  CDE P+C +  DE  C  P V  P +++   +   + ++  C+ V VPT  I WR NWG +P     T+  + G+        LTI ++     G YTCEA++ K            + ++   F  +   C +  FN        C+ CFC G T +C S   Y                          +P P TST+   +L+N + ++   V  ++   D++S                P  FL       G+ ++SY  +L+  +    + +   P  K  IL   NG+ L +     +     +P+   NQ +I   E ENW    T   S  R ++L  L++++ + IR  Y +        +  +D         G     P+ +E+C CP  Y+GLSCE C +G+++    + +  C   NC      CD  +G+C  C     GP+C +C+PG+          DC  C C     +   S+ C  D+ GQ     C+   TGR      C+KC
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGT-VTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ------GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFFFAHCNCPEGHFNIGGR----CMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLTSTQ---ILINPEEEEFQLVDLSRRFLDLDS------------HWTLPRQFL-------GNKVDSYGGFLRYKVSYSLQREGSEPDNKADILLMGNGQRLVYRRGSPT-----SPD-IKNQREIKFTE-ENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQ----PKDVEECRCPPGYSGLSCESCSSGFDRVPGGRYLGTCAGCNCHGHASACDPVSGHCLSCQHNTEGPQCDKCRPGYFGDPSRGRHDDCKPCPCPYTETSRRFSDTCFLDVDGQATCDACRPGYTGRR-----CEKC 766          

HSP 2 Score: 55.0694 bits (131), Expect = 5.081e-63
Identity = 78/326 (23.93%), Postives = 124/326 (38.04%), Query Frame = -3
Query: 5301 IVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLL-VNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFT--FEYNT-----DLLKDLVFSDVTPFIE--IESKKFGRLWTVLS--FNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGF----VKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6188
            + +G+  C  N  GP C EC PG F         CL+CFC   T++C  S   R                    Q+ G       N QL  +    N   +    +Q G   ++ +  NS VP DI+ + +           YGG++ +   FE+ +     D   D+V      F+E   ++K   R+ TV++  F E                WR   +G+    RE  + AL     L I   + +      + D+ + D+ + H+       +   VE C CP+G  G  C+ C +VGY    +       +  G C+  DC
Sbjct:  782 VPNGEPLCLANVAGPLCDECKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTR-------------------DQVRG-----GVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNS-VPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPTVVTVPFRESA--------------WRRA-DGQPCT-REHLLMALADVAVLMIRATYADKMSESSISDIHM-DIAVPHSTGNE---RAMEVEECACPQGYRGPSCQEC-EVGYTRTGS------GLYLGTCEKCDC 1055          

HSP 3 Score: 83.1889 bits (204), Expect = 2.338e-29
Identity = 93/385 (24.16%), Postives = 151/385 (39.22%), Query Frame = -2
Query: 6238 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFV-GKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDI--PGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 7356
            C+   F+ +A     CL+CFC G T  C+S+           + +   L     ++ I E    K   +++ +S+  V   +Y  + V P  F        G  + +Y   L+  +R   +S   +    P V+LQ   G  ++   +  ++ +   P       + S W + +            R  +L  L+D+  L+IR  Y    +     +  +D  I  P S GN   A  +E+C CP  Y G SC++C  GY +         C K  C  +  ECD + G C +C    +GP+C  C PGF   YG  ++     C  C C      +  +  C  D  GQ              P C+ C   P   A  R+C++
Sbjct:  801 CKPGSFHLSADNPDGCLQCFCMGVTKQCASSTWTRDQVRGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIY--YWVMPESFR-------GDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQ---GNGIFLEHSSQTKPLPRVPTVVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMD--IAVPHSTGNE-RAMEVEECACPQGYRGPSCQECEVGYTRTGSGLYLGTCEKCDCHGHASECDSETGACLQCLHNTAGPRCDSCLPGF---YGNPVTGGIHACRPCPCL----GSAPAKSCYLDSDGQ--------------PTCNNC---PPGYAGRRNCER 1139          

HSP 4 Score: 68.9366 bits (167), Expect = 2.338e-29
Identity = 75/308 (24.35%), Postives = 121/308 (39.29%), Query Frame = -3
Query: 5385 KNCNSLGTENI-VDGKCKCKENYKGPNCSECSPGFFSF----QKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVK----------------RNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNE--------KTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6218
            + C++ G+E    +G C+CK N +GP CS C P  F      +  CL CFC   TQ+C  S  YR             DVV S      V+   NT    LVNR     +                   N +++G      +L NS   D +      YGGK+ +T  Y       +  S   P  +I+ +  G   T+++  +        ++++ E +F ED    W+  +   +   RE  +  L     + I   +    ++   +  +++E A      L +   VE C CP G  G+ C+ C
Sbjct: 1138 ERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSSSYYR-------------DVVTS------VFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQLPNSYQGDKVGS----YGGKLKYTISY-------VPGSRGAPIDDIDVQIIGNDITLVARQDWRRGQGTRESRSFEIVFRED---YWK--RPDGMPTTREHLLMVLADLDDILIRASYHTE-MRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQDC 1409          

HSP 5 Score: 62.3882 bits (150), Expect = 1.246e-8
Identity = 81/378 (21.43%), Postives = 135/378 (35.71%), Query Frame = -2
Query: 6403 TINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPM--------FNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQ----SPNPKTSTRTKGLLMNFKSQKILE-VSYAKSIYDVNSKSYKFVGKMYQD--FVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7467
            T NN  P +AG   CE    + +           K   E P         F+ +      CL CFC G T  C+S+  YY+    S     +T+   L+   ++ +I    S   S       S+    ++ Q+  +   PN +        G  + SY   LK  I     S+   P   + +Q +          D     +   +G        +  +E+++          R  +L VL+D+  +LIR  Y++          +++  + N   +   +    +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C  C     G  C +C  G+          DC  C C
Sbjct: 1123 TCNNCPPGYAGRRNCERCDARGSEGCSANGVCRCKMNVEGPTCSNCKPRTFHLSPANKDGCLICFCMGITQQCTSS-SYYRDVVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQLPNSY-------QGDKVGSYGGKLKYTISYVPGSRG-APIDDIDVQIIGNDITLVARQD-----WRRGQGTRESRSFEIVFREDYWKRPD-GMPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQAL---EVEQCRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCEL--CECNGHSDSCHPETGICTNCLHNTMGELCEQCATGYFGDASAGTPEDCQPCAC 1480          
BLAST of SMED30010499 vs. Ensembl Cavefish
Match: lama1 (laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-1])

HSP 1 Score: 89.7373 bits (221), Expect = 5.383e-17
Identity = 72/267 (26.97%), Postives = 124/267 (46.44%), Query Frame = -2
Query: 6283 SWLESYSYYLKINIRLFGESKDD-----IPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQ----NQCVK-KCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7053
            S L +Y  +L  ++  +  S D+     +P    ++   NG+SL       S  ++ NP   + +  + L    ++F+D   E    R ++++VL+D+  L IR    ++  G     ++V   + +P S  +   AP +E+C CP  Y+G SCE C++G+ +         C++ +C  +  ECD NG C  C+   +GP C +C PG+     E  + DC  C C   L +   S  C   L G G I+C    +      C++C
Sbjct:  514 SLLTAYGSFLNYSV-AYDASVDNNVDKTLPSHFDVVIQGNGRSLRQL---QSRRVFLNP---HMEQHVVLEFLPHFFVDMHMERRVQRDELMSVLADVASLRIRAHLNTSVDGVLRL-SSVSLAVADPISR-SAAPAPDVEQCECPWGYSGTSCEYCISGFYRVGGILFGGNCLQCECNDHATECDINGVCLGCSHNTTGPHCDQCLPGYYGDPTEGTAEDCQRCACPLTLASNNFSPTC--SLQGPGEIMCDQCEQGYTGTKCERC 769          

HSP 2 Score: 61.2326 bits (147), Expect = 2.143e-11
Identity = 85/391 (21.74%), Postives = 151/391 (38.62%), Query Frame = -2
Query: 6283 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSP------NPKTSTRTKGLL---MNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPG--PKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLK----ISLWEKENWFIDSTCETSAMRPDILAVLSDIKY-LLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQ-------------CVK-KCPINCVECDKN-GNCNRCTGQRSGPKCLECKPGFVRLYGEKLS--SDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 7356
            C+   F       S C  CFC G +  C    G  + P      +  + +  KG L    + + + +L+V+  +S   +    Y  + + +Q                 GS L SY   L  ++         +    P+V+++  + K L         VIY +     N ++    + L E +  + ++  E +    D +++LS++   +L+ +  Y         N ++D  +   ++      A  +E C CP  Y GLSC++C  GY +   ++             CV  +C  + + CD + G C  C    +G  C  C PG+   YG+     SDC+ C C   L++   S  C+  L G G   C           C++C
Sbjct: 1069 CKTGTFGLWGQNPSGCSPCFCFGVSTVCEELGGLVRVPVSAERLHVVSQSDLKGTLEGVYHTEGEMLLDVTQLQSASSLTGPYYWRLPQRFQ-----------------GSKLLSYGGDLSYSVAFAALDGSGLSNHEPQVLIRGGHLKKL---------VIYMDMPAPENSIRTTQRVPLTEHKWKYFNAVSEKAVSHADFMSILSNLHINILVLMANYLLFLYMLISNISMDTAVEADEAPEGTPEARLVEACECPPGYAGLSCQECAPGYYRQHVSELNMKGMKRPMMQPCVPCQCNNHSLACDLDTGKCLGCQHNTTGENCNVCAPGY---YGQVKGSISDCSLCAC--PLHSNSFSPTCV--LEGVGDFRCDACKPGYEGRYCERC 1426          

HSP 3 Score: 30.0314 bits (66), Expect = 2.143e-11
Identity = 11/31 (35.48%), Postives = 15/31 (48.39%), Query Frame = -3
Query: 6087 GKCKCKENYKGPNCSECSPGFFSFQKKCLKC 6179
            GKC+CK   +G  C +C         +CL C
Sbjct: 1461 GKCECKAGVRGHLCDQCEDRHVLSNDQCLSC 1491          

HSP 4 Score: 47.3654 bits (111), Expect = 3.071e-9
Identity = 43/129 (33.33%), Postives = 59/129 (45.74%), Query Frame = -2
Query: 6283 CPTPYTGLSCEKCLAGYEKN----DQNQCVKKC-----PINCVECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSS-DCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKC 6636
            C   YTG  CE+C  GY  N     Q   V +C     P     CD   G C +C G  SG  C  C+ G+   +G+ +++ DC  C C++   N  VS++C   +TGQ    C C      D  CD+C
Sbjct:  757 CEQGYTGTKCERCANGYYGNPTVAGQKCSVCECNGNVDPSEPGHCDAVTGECLKCVGHTSGRHCERCEDGY---FGDAVTAKDCQACGCHA---NGSVSSVC-NIITGQ----CDCRANVVGDK-CDRC 873          

HSP 5 Score: 36.1946 bits (82), Expect = 3.071e-9
Identity = 14/42 (33.33%), Postives = 20/42 (47.62%), Query Frame = -3
Query: 6060 DGKCKCKENYKGPNCSECSPGFFSFQK-KCLKCFCSNKTQEC 6182
            DG+C+C     G  C  C  GF++F    C  C C++    C
Sbjct:  904 DGQCQCIVGVSGAKCDRCQQGFYNFTDGGCTPCDCAHTHGNC 945          

HSP 6 Score: 41.2022 bits (95), Expect = 7.625e-6
Identity = 21/59 (35.59%), Postives = 30/59 (50.85%), Query Frame = -3
Query: 6051 CNSLGTENIVDGK-CKCKENYKGPNCSECSPGFFSFQ----KKCLKCFCSNKTQECKES 6212
            C+  G+ NI   + C CK N  G NC  C  GF++ Q    + C +CFC   +  C+ S
Sbjct:  451 CSLKGSHNIDPCRECICKVNVMGANCDLCKQGFYNLQASNPEGCTECFCFGVSDVCEGS 509          

HSP 7 Score: 30.8018 bits (68), Expect = 7.625e-6
Identity = 27/100 (27.00%), Postives = 43/100 (43.00%), Query Frame = -2
Query: 6283 NGNCNRCTGQRSGPKCLECKPGFVRLYGEK--LSSDCTECNCYSQLNNTLVSNICMRDLT----GQGAIVCKCTGRE--------------RNDPLCDKC 6522
             G C  CT   +G  C  C  G+ R +      +  C ECNC  + +   VS++C++D      G+G +  +C  +E              R+ PLC +C
Sbjct:  353 GGVCINCTQNTAGVNCETCADGYYRPHKMSPYATEPCLECNCDMRGS---VSHVCLKDDKHANPGKGLLPGQCVCKEGFAGEKCDRCAFGYRDFPLCTRC 449          
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 77.7962 bits (190), Expect = 5.827e-14
Identity = 45/124 (36.29%), Postives = 64/124 (51.61%), Query Frame = -2
Query: 7678 DF-CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8046
            DF C   Q  C+N IC +    C+G  DC DG DE       C P+QF C T        +C+   +RC+G+++CG+G DE +C ++   TC  + F C      IPR   CD + +C +G DE
Sbjct: 3340 DFKCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTT------HRCIPGIFRCNGQDNCGDGEDEKDCPEV---TCAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSDE 3454          

HSP 2 Score: 72.0182 bits (175), Expect = 2.659e-12
Identity = 46/127 (36.22%), Postives = 62/127 (48.82%), Query Frame = -2
Query: 7669 FNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NCIKL---DKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8034
              Q AC N  CI+ N  C+   DC D  DE I     C  +QF C++        +C+ ++W CDG+NDCG+  DE   NC KL       C G  F C  +   IP    CD + +C++  DEK C
Sbjct:  952 LTQFACNNGRCINMNWRCDADNDCADASDE-IGCNHSCSISQFKCNS-------GRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPLRWRCDGDTDCIDTSDEKEC 1070          

HSP 3 Score: 72.0182 bits (175), Expect = 2.843e-12
Identity = 46/135 (34.07%), Postives = 65/135 (48.15%), Query Frame = -2
Query: 7636 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQE 8040
            C   Q  C+N+ C+     C+   DC D  DEE  T   C  ++FSC        + +C+A  WRCDG++DC +G DE +C       C    F C  N   IP+   CD + +C++G DE NC       P+ E
Sbjct: 3505 CEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSC-------ANGRCIAGRWRCDGDHDCSDGSDEKDC----SPRCDHDQFQC-RNGHCIPQRWRCDADIDCIDGSDEDNCAAIVRTCPHHE 3627          

HSP 4 Score: 71.2478 bits (173), Expect = 5.241e-12
Identity = 53/137 (38.69%), Postives = 68/137 (49.64%), Query Frame = -2
Query: 7639 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVV-IPNQ 8040
            C+ ++  C+N  CI     C+   DC D  DE  + C   +C P QF C        +  C    + CDG+NDCG+G DE NC   D + CL S F C      IP    C+   NC +GEDEK+C  PEV   PNQ
Sbjct: 3303 CTASRFVCKNDKCIPFWWKCDTEDDCGDRSDEPAD-CPDFKCRPGQFQCK-------NGICTNPAFICDGDNDCGDGSDEANC---DVHVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDC--PEVTCAPNQ 3426          

HSP 5 Score: 67.3958 bits (163), Expect = 7.652e-11
Identity = 46/131 (35.11%), Postives = 60/131 (45.80%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ----CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C  +Q  CRN  CI +   C+   DC DG DE+   CA     C  ++F C+    KP         W+CDGE+DCG+  DE   + L      G  F C +N         CD   NC +G DE+NC  P
Sbjct: 3582 CDHDQFQCRNGHCIPQRWRCDADIDCIDGSDED--NCAAIVRTCPHHEFQCNNTLCKPLS-------WKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKP 3703          

HSP 6 Score: 66.6254 bits (161), Expect = 1.330e-10
Identity = 63/206 (30.58%), Postives = 87/206 (42.23%), Query Frame = -2
Query: 7660 TVIWRREDKKSFQI---DVESRVGGETQALLIVNTATKEM-----NGTVYECVHNNLLIKATLIVK---DF-----CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE-KNCRHP 8220
            T + R E    F+I   D E +  G T A  + N     +      G    C  + LL    +  K   D+     C   + AC+N  CI E   C+G  DC D  DE    C Q  C  ++F C        + +C+   W CDG+NDCGN  DE N       TC  + F+C      IP S  CD + +C +  DE  +C +P
Sbjct:  752 TTVLRNERPPIFEIRTYDREQQKSG-TNACHVNNGGCSILCLAVPEGRACACADDQLLDADNITCKPNPDYTPPPQCHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQ-------NNRCIPLRWLCDGDNDCGNSEDESN-TTCAARTCPPNQFSCASG-HCIPMSWKCDLDDDCGDRSDEPPSCAYP 947          

HSP 7 Score: 61.2326 bits (147), Expect = 5.263e-9
Identity = 41/117 (35.04%), Postives = 55/117 (47.01%), Query Frame = -2
Query: 7672 SICIDENKFCNGIKDCEDGFDEE----INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKN 8010
            S+C+     C+G  DC D  DE+     +    C P+ F+C       P   C+   W+CD E DC +G DELNC  L    C   HF C DN   I +   CD   +C +  DEK+
Sbjct: 2641 SLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNC-------PSGPCIPTAWKCDREPDCDDGADELNCDML----CAVDHFEC-DNGKCITKRWMCDGEDDCGDRSDEKD 2745          

HSP 8 Score: 60.4622 bits (145), Expect = 8.848e-9
Identity = 39/132 (29.55%), Postives = 60/132 (45.45%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--------CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS +Q  C +  CI  +  C+G  DC D  DE    C +        C  ++F C   G      +C+   WRCDG+ DC +  DE  C  + +       F+C D    I ++ +CD + +C +  DE+ C
Sbjct:  988 CSISQFKCNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADG------QCIPLRWRCDGDTDCIDTSDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC 1113          

HSP 9 Score: 59.6918 bits (143), Expect = 1.475e-8
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = -2
Query: 7663 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLG-SHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH 8040
            C  ++  C+N+ CI     C+G  DC +  DE   TCA   C PNQFSC +         C+   W+CD ++DCG+  DE         TC   + FAC+ N   I  +  CD + +C +  DE  C H
Sbjct:  868 CPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCAS-------GHCIPMSWKCDLDDDCGDRSDEPPSCAYP--TCFPLTQFACN-NGRCINMNWRCDADNDCADASDEIGCNH 986          

HSP 10 Score: 58.151 bits (139), Expect = 4.495e-8
Identity = 41/110 (37.27%), Postives = 53/110 (48.18%), Query Frame = -2
Query: 7717 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAW 8040
            C  +Q  CR +  CI     CNG  +C DG DE+      C PNQF C +       ++C+   W CD +NDCG+G DE  NC ++   TC    F C      IP S W
Sbjct: 3382 CLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDCPEVTCAPNQFQCSST------KRCIPRVWVCDRDNDCGDGSDEPANCTQM---TCGQEEFRCKGTGRCIP-SRW 3481          

HSP 11 Score: 54.6842 bits (130), Expect = 5.018e-7
Identity = 46/160 (28.75%), Postives = 60/160 (37.50%), Query Frame = -2
Query: 7669 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSC-----------------------------------HTVGGKPPH-------QKCVANYWRCDGENDCGNGYDELNCIKLDKNT-CLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8019
            C N  C++  K CNG+ DC D  DE     + C  ++F C                                   H +G +            CV   W CDG NDCG+  DE NC K   +  C   +F C      IP +  CD  P+C +G DE NC
Sbjct: 2550 CLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSG-PCIPTAWKCDREPDCDDGADELNC 2708          
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 74.3294 bits (181), Expect = 6.143e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE-INTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C   Q  C +  CI  +  C+G  DC DG DE+  + C    C P++F+C      PP ++C+   + CDG+ DC +  DE  NC    + +C    FACD+ + +  R   CD   +C +G DE+ C +P
Sbjct: 2868 CPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTC--ADASPPRRRCIQRRFVCDGDADCSDALDEHQNCT---RRSCTAGEFACDNGLCVHSRYR-CDRRNDCGDGSDERGCTYP 2992          

HSP 2 Score: 71.633 bits (174), Expect = 4.046e-12
Identity = 45/127 (35.43%), Postives = 57/127 (44.88%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C   Q  C +  CID    C+G  DC DG DE       C   QFSC +        +C+A Y+RCDG  DC +  DE+ C       C    F C  +   IP    CD +P+C +G DE    HP
Sbjct: 1111 CHPMQFQCPDHRCIDNAYVCDGDSDCVDGADER-GCVFNCTSYQFSCSS------GDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDE----HP 1226          

HSP 3 Score: 64.3142 bits (155), Expect = 6.651e-10
Identity = 40/125 (32.00%), Postives = 58/125 (46.40%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C+  + AC N +C+     C+   DC DG DE   T   C  NQF+C        + +C+   + CDG+NDCG+G DE  +       TC    F C      +     C++  +C +G DEK C
Sbjct: 2955 CTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCE-------NGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAG-ECVAIHLVCNQANDCADGSDEKGC 3071          

HSP 4 Score: 63.1586 bits (152), Expect = 1.300e-9
Identity = 54/173 (31.21%), Postives = 68/173 (39.31%), Query Frame = -2
Query: 7669 TLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKP-----------------PHQKCVANYWRCD---------------------GENDCGNGYDELNCIKLDKNTC--LGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8061
            TL     C+ NQ  C N  CI     C+G  DC+DG DE+  TCA   C P QF C+     P                 PH  C+    RCD                     G +DC +  DE  C ++   TC  LG +    DN   IP    CD   +C +G DE+NC
Sbjct: 3552 TLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEI---TCDPLGDYRC--DNHRCIPLRWRCDRYDDCGDGSDERNC 3719          

HSP 5 Score: 63.1586 bits (152), Expect = 1.563e-9
Identity = 43/140 (30.71%), Postives = 59/140 (42.14%), Query Frame = -2
Query: 7669 ACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHT-----VGGKPPH---------------QKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8022
            AC N  C+     C+G  DC DG DE         C P  F+C       +  +P                  +C+  YW CD +NDCG+G DE  C      TC    F C D+   I  +  CD + +C++G DE+ C
Sbjct: 1009 ACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDM--SGTCHPMQFQCPDH-RCIDNAYVCDGDSDCVDGADERGC 1145          

HSP 6 Score: 61.2326 bits (147), Expect = 5.180e-9
Identity = 43/125 (34.40%), Postives = 58/125 (46.40%), Query Frame = -2
Query: 7669 SFNQRACR-NSICIDENKFCNGIKDCEDGFDEEINTCAQCEP-NQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8037
            S  + ACR N  CI     CNG+ DC D  DE+      C+P   + C        + +C+   WRCD  +DCG+G DE NC       C  S F C  N   IP    C+   +C +  DE++C
Sbjct: 3645 SHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEITCDPLGDYRCD-------NHRCIPLRWRCDRYDDCGDGSDERNCA---PRPCSESEFRC-TNQRCIPGRWVCNHENDCGDNSDERDC 3758          

HSP 7 Score: 60.4622 bits (145), Expect = 9.389e-9
Identity = 44/129 (34.11%), Postives = 63/129 (48.84%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNCRHP 8040
            C   Q  C +  CI  +  C+ I DC D  DE   + A C   QF C +        +C+A  + CDGE DC +  DE  NC     +TC  SHF C     +  +SA+ CD   +C +  DE++C++P
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRS------DNRCIARAFVCDGEADCADRSDEHQNC---PGSTCSSSHFTCASGHCV--QSAFRCDHFQDCDDRSDEQSCQYP 118          

HSP 8 Score: 58.5362 bits (140), Expect = 3.648e-8
Identity = 47/157 (29.94%), Postives = 68/157 (43.31%), Query Frame = -2
Query: 7669 MNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ----CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDD----NVTLIPRSAWCDENPNCLNGEDE-KNC 8112
            ++G   E   N+L     L +      N+  C N  CI  +  C+  +DC D  DE  ++C+     C   QF+C +        +C+   W CDG+NDCG+G DE         TC    F C D        I R   CD + +C +  DE +NC
Sbjct: 2802 LSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEP-SSCSDPGRTCPGTQFTCDS-------GRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEHQNC 2950          

HSP 9 Score: 56.6102 bits (135), Expect = 1.209e-7
Identity = 39/142 (27.46%), Postives = 62/142 (43.66%), Query Frame = -2
Query: 7678 VYECVHNNLLIKATLIVKDFCSFNQRACR-NSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8100
             ++C   +  +         C  ++  C+ + +CI     C+G  DC+DG DE       C P   +C     +  +  CV   WRCDG+NDC +G DE +C          S + C ++   +     CD N +C +G DE
Sbjct: 1172 AFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDEH----PGCPPR--TCAAGYLRCDNGNCVPESWRCDGDNDCRDGTDERDCPTPPYRCQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDE 1307          

HSP 10 Score: 56.225 bits (134), Expect = 1.662e-7
Identity = 51/189 (26.98%), Postives = 74/189 (39.15%), Query Frame = -2
Query: 7663 YECVHNNLLIKATLIVKDFCSFN------QRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTV----------GG----------KPP----------------HQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH 8097
            Y C H N    ++   ++ C+F       + AC N  CI  ++ CNG+ +C D    +   C +  C+P    C T           GG          +PP                + +C+   W CD E DC +  DE +       TC G+ F CD     IP S  CD + +C +G DE   RH
Sbjct: 2719 YRCDHTNDCGDSS--DEEGCAFRTCDPAAEFACTNGRCIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTCDSG-RCIPGSWICDGDNDCGDGSDEDG-RH 2903          

HSP 11 Score: 56.225 bits (134), Expect = 1.916e-7
Identity = 40/122 (32.79%), Postives = 56/122 (45.90%), Query Frame = -2
Query: 7660 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE--KNCRHP 8019
            C +  CI E   C+G  DC+D  DE +  C    PN   C     +  +  C+   W+CDG+NDCG+G DE     LD        F CD+N  +      C+   +C +G DE    C+ P
Sbjct: 3770 CGSGHCIPERLKCDGSADCQDFSDESL--CPTRYPNGTWCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDNNRCIYSHEI-CNAVDDCGDGSDETPDKCKEP 3888          

HSP 12 Score: 55.8398 bits (133), Expect = 2.423e-7
Identity = 46/131 (35.11%), Postives = 57/131 (43.51%), Query Frame = -2
Query: 7657 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTC-LGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPE 8040
            C  +Q  C N  CI     C+   +C DG DE    CA   CEP  F+C        + +CV   +RCD  NDCG+  DE  C      TC   + FAC  N   I RS  C+   NC +       R PE
Sbjct: 2661 CGTSQFTCLNGRCIPFRNKCDNRDNCRDGSDELERVCAFHTCEPTDFTCR-------NGRCVRYGYRCDHTNDCGDSSDEEGCA---FRTCDPAAEFAC-TNGRCIARSQVCNGVNNCRDNATSDEQRCPE 2780          

HSP 13 Score: 55.4546 bits (132), Expect = 3.221e-7
Identity = 39/126 (30.95%), Postives = 53/126 (42.06%), Query Frame = -2
Query: 7669 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDEE-INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C  +Q  C +   CI     C+   DC DG DE   +    C P QF C       P  +C+ N + CDG++DC +G DE  C+      C    F+C      I     CD   +C +  DE  C
Sbjct: 1070 CRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSGTCHPMQFQC-------PDHRCIDNAYVCDGDSDCVDGADERGCVF----NCTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGC 1184          

HSP 14 Score: 54.299 bits (129), Expect = 6.296e-7
Identity = 42/124 (33.87%), Postives = 54/124 (43.55%), Query Frame = -2
Query: 7675 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNT--CLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK 8040
            CS ++  C N  CI     CN   DC D  DE       C P  F C +         C+    +CDG  DC +  DE  C     N   C  S F CD++V  IP S  CD + +C +G DE+
Sbjct: 3724 CSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCELQTCLPGYFQCGS-------GHCIPERLKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHV-CIPPSWKCDGDNDCGDGSDEE 3839          

HSP 15 Score: 52.373 bits (124), Expect = 2.638e-6
Identity = 38/130 (29.23%), Postives = 58/130 (44.62%), Query Frame = -2
Query: 7669 FCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQC---EPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8043
            +C  +   C N +CI  +  C+G  DC DG DEE++ C       P +F C        + +C+ ++  C+  +DCG+G DE    C +     C    F C      IP +A C+    C +  DE  C
Sbjct: 3806 WCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCD-------NNRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASG-RCIPMAAVCNNYNECRDNTDETGC 3927          
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.868e-13
Identity = 48/135 (35.56%), Postives = 66/135 (48.89%), Query Frame = -2
Query: 7636 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQE 8040
            C   Q  C+N+ CI     C+   DC D  DEE  T   C  ++FSC        + +C+A  WRCDG++DC +G DE +C       C    F C  N   IP+   CD + +CL+G DE+NC     + P  E
Sbjct:  876 CEPYQFRCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSC-------ANGRCIAGRWRCDGDHDCMDGSDEKDC----SLRCEQDQFQC-QNGHCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDE 998          

HSP 2 Score: 63.929 bits (154), Expect = 8.262e-10
Identity = 45/132 (34.09%), Postives = 62/132 (46.97%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA-------QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 8040
            C+ +Q +C+N  CI     C+G  DC D   +E +TC        QC  ++F C   G       C+   WRCDG+ DC +  DE  C    +    G+HF C  N   I R AW CD + +C +  DE  C
Sbjct:  150 CADSQFSCKNGHCIPSQWVCDGDNDCGD-VSDETHTCEFPARPLRQCREDEFRCAING------NCIPLRWRCDGDADCMDISDEKECDGQRRTCNPGTHFTCVSNGICI-RKAWVCDGDNDCEDNSDEAGC 273          

HSP 3 Score: 57.3806 bits (137), Expect = 6.856e-8
Identity = 41/118 (34.75%), Postives = 56/118 (47.46%), Query Frame = -2
Query: 7660 CIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE-KNCRHP 8004
            CI +   C+G  DC+DG DE    C Q  C  ++F C        + +C+   W CDG+NDCG   DE N       TC    F C  N   IP +  CD + +C +  DE  +C +P
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCK-------NNRCIPMRWLCDGDNDCGENEDESN-TTCTVRTCPAEQFTC-GNGKCIPIAWKCDLDNDCSDNSDEPPSCAYP 109          

HSP 4 Score: 55.4546 bits (132), Expect = 2.883e-7
Identity = 43/135 (31.85%), Postives = 60/135 (44.44%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLG------SHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C  +Q  C+N  CI +   C+   DC DG DEE    A   C  ++F C++   KP         WRCDGE+DCG+  DE      D + C          F C ++   +     CD   NC +  DE++C  P
Sbjct:  953 CEQDQFQCQNGHCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQCNSTLCKP-------FSWRCDGEDDCGDNSDE------DADHCRAFQCPPRRQFRCRNDRVCVSLDRVCDGINNCGDHSDEEHCGEP 1074          

HSP 5 Score: 52.7582 bits (125), Expect = 1.682e-6
Identity = 51/149 (34.23%), Postives = 66/149 (44.30%), Query Frame = -2
Query: 7660 ECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA--QCEP-NQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKN-CRHP 8094
            +C  N      T  V+  C   Q  C N  CI     C+   DC D  DE   +CA   C P  QFSC+       + +C+   WRCD +NDC +  DE  C     NTC  S F+C  N   IP    CD + +C +  DE + C  P
Sbjct:   54 DCGENEDESNTTCTVR-TCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPP-SCAYPTCLPLTQFSCN-------NGRCINIRWRCDSDNDCADSSDEAGC----NNTCADSQFSC-KNGHCIPSQWVCDGDNDCGDVSDETHTCEFP 188          

HSP 6 Score: 52.373 bits (124), Expect = 2.335e-6
Identity = 33/94 (35.11%), Postives = 48/94 (51.06%), Query Frame = -2
Query: 7585 CVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEV 7866
            C+ + WRCDG+NDC +G DEL  I   ++TC+   F C +N   IP    CD + +C   EDE N        P ++ T        I+ KC++
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEI-CQQHTCISDRFKCKNN-RCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDL 92          
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 7.950e-13
Identity = 83/340 (24.41%), Postives = 142/340 (41.76%), Query Frame = -2
Query: 6346 CLKCFCSGQTDDCSS-AMGYYQSPNPK--TSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKI----NIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYS-NQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKC-PINCV----ECDK-NGNC----NRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTG 7311
            C  CFC G +  C S   G  Q  + +    T  +GL    K +  +EV     +   N+   + +  +Y  + + P  +L       G+ L +Y+ +L+     +I +     + I    VI++  NG++L    +  S  +   P   + +  +SL      F D        R  ++  L+++  L IR  Y S  Q  +     ++D  + +PD+   +  A  +E+C+CP  Y G SCE C+ G+ + D      +C P  C     +CD  +G+C    + C     GP C  C+PGF        + DC  C C   + +   S  C +D  G
Sbjct:  386 CSACFCFGLSSSCRSLPWGVTQVVDMRGWRVTDRQGLR---KVKTFVEVD---QVAVRNADVRRTLPALY--YWLAPTSYL-------GNKLTAYAGHLRYSVSYDIPVDSTDSEMISDVDVIIEG-NGQAL----SSGSLGLMLQP---FEEQTLSLRLLPENFFDFRSNAPVSRDALMTALANVTRLQIRASYSSVKQAVYRLSAVSLD--VASPDAAVGSPAALDVEQCHCPHGYAGTSCESCMRGHRRVDGTLHGGRCEPCRCHGHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRG 700          

HSP 2 Score: 23.8682 bits (50), Expect = 7.950e-13
Identity = 18/71 (25.35%), Postives = 30/71 (42.25%), Query Frame = -3
Query: 6045 RDLSENKNCNSLGTENIVD---GKC-KCKENYKGPNCSECSPGFF---SFQKKCLKCFCSNKTQECKESDQ 6236
            R    N N  + G   + D   G+C +C+E   G +C  C+ GF+   +    C  C C  +     + D+
Sbjct:  735 RRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQCHPEGATAPQCDR 805          
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 72.0182 bits (175), Expect = 2.024e-12
Identity = 52/148 (35.14%), Postives = 74/148 (50.00%), Query Frame = -2
Query: 7606 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDEEINTCAQ-CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKN-TCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSS 8040
            C  NQ  C+NS  CI  +  C+   DC D  DE  +   Q C+  +FSC        + +CV + WRCDG+NDC +  DE+NC     N +C    F C      IPR   CD + +CL+G DE+  +    ++P Q T   ++  SS
Sbjct:  660 CGTNQFRCQNSGRCIPMSYKCDQEDDCGDNSDEPADCPHQKCQATEFSCS-------NGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGNISCSADGFQCPSG-PCIPRRWLCDGDKDCLDGADEQ--QQCGGLVPPQPTPGHLNCTSS 797          

HSP 2 Score: 69.3218 bits (168), Expect = 1.525e-11
Identity = 45/144 (31.25%), Postives = 68/144 (47.22%), Query Frame = -2
Query: 7633 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGK--PPHQ------KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQET 8040
            C+ ++  CR+ +CI  +  C+G+ DC D + +E N  A C     S  TV  +  P  Q      +CV  +W+CD +NDCG+  DE  C     + C    F C D   +      CD +P+C +G DE  C     VI  + +
Sbjct:  794 CTSSEFQCRSGVCISLHWKCDGVDDCGD-YSDEANCRASCIICWSSGPTVAPRCLPLFQFQCRNHRCVPVWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCGDGTCIFDHFV-CDGSPDCADGSDEYGCPTQHAVITGRPS 935          

HSP 3 Score: 57.3806 bits (137), Expect = 6.481e-8
Identity = 41/128 (32.03%), Postives = 58/128 (45.31%), Query Frame = -2
Query: 7678 QRACRNSICIDENKFCNGIKDCEDGFDEEINTC-----AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNC------IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8028
            Q  CRN  C+     C+   DC D  DE+  TC     + C  +QF C           C+ +++ CDG  DC +G DE  C      I    + C  + F C  + T +P SA CD   +C++G DE
Sbjct:  851 QFQCRNHRCVPVWWKCDNDNDCGDWSDED--TCPSKLPSGCPAHQFRCGD-------GTCIFDHFVCDGSPDCADGSDEYGCPTQHAVITGRPSPCSFTQFQCLKDKTCVPASARCDGRKDCVDGSDE 969          
BLAST of SMED30010499 vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 79.7221 bits (195), Expect = 1.198e-14
Identity = 50/143 (34.97%), Postives = 68/143 (47.55%), Query Frame = -2
Query: 7669 YECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8097
            Y+C+  +L  +A   V   CS +   C N  C   +  C+G  DC DG DE+      C P QFSC       P  +C+   WRCDG+ DC +G DE  C       C  S F+C  N   I  +  CD + +C +  DE+NC
Sbjct:   67 YDCLAPDLSDEANCSVATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSC-------PSGRCIPLRWRCDGDGDCSDGADERGCP---PKNCTDSQFSC-SNGQCISLAWRCDGDHDCADKSDERNC 198          

HSP 2 Score: 63.5438 bits (153), Expect = 1.025e-9
Identity = 40/121 (33.06%), Postives = 58/121 (47.93%), Query Frame = -2
Query: 7678 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            C+ +Q +C N  CI     C+G  DC D  DE   T   C+P +F+C         + C+   W CDGENDCG+  DE++C      +C    + C +    I +S  CD   +C +  DE
Sbjct:  164 CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACAN------GRHCIQRKWICDGENDCGDRSDEVDC---GLESCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 275          

HSP 3 Score: 58.5362 bits (140), Expect = 4.502e-8
Identity = 47/129 (36.43%), Postives = 59/129 (45.74%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDC--GNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS  +  C+N  CI     C+G  DC D  DE E   CA+  C  ++F C         +KC+   WRCDG+ DC   +  DE NC       C  S F C  N    PR   CD   +C +G DEK C
Sbjct:    1 CSAGKFTCKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQA------SRKCIPLSWRCDGDYDCLAPDLSDEANCSV--ATNCSASMFRC-ANGQCKPRDWVCDGFDDCGDGSDEKGC 120          
BLAST of SMED30010499 vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 79.337 bits (194), Expect = 1.947e-14
Identity = 46/112 (41.07%), Postives = 64/112 (57.14%), Query Frame = -2
Query: 7678 NSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8013
            +S CI     C+G+ +CEDG DE+      C P++F+C + G       C+A+ W CDG+NDCG+  DELNC +L   TC  + F C  N   IP+SA CD   +C +  DE
Sbjct:  132 SSHCIPRRWLCDGLAECEDGSDEKNCQKFTCAPDKFACASGG-------CIASRWVCDGDNDCGDNSDELNCTRL---TCPPTKFLC-ANGMCIPKSAVCDGENDCGDMSDE 232          

HSP 2 Score: 68.9366 bits (167), Expect = 2.822e-11
Identity = 48/142 (33.80%), Postives = 70/142 (49.30%), Query Frame = -2
Query: 7666 VHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCG-NGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR 8088
            VH  +L +A    K+  S + +   +  CI ++  C+G  DC D  DEE      C   +F+C+         +CV   W+CDGE DC   G+DE  C  +   TC  ++F C ++   IPR   CD    C +G DEKNC+
Sbjct:   32 VHAKILQQA----KNCGSRHFKCVSDGKCIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKEFNCN--------NQCVPLSWKCDGEKDCRPGGFDEEGCEPV---TCASTYFLCPNSSHCIPRRWLCDGLAECEDGSDEKNCQ 158          

HSP 3 Score: 60.8474 bits (146), Expect = 1.008e-8
Identity = 41/123 (33.33%), Postives = 56/123 (45.53%), Query Frame = -2
Query: 7678 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ-CEPN-QFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            C   +  C N +CI ++  C+G  DC D  DE  N  A  C+P  +F C        + +C+   WRCDG  DC +G DE  C    + TC    + C      IP S  CD   +C +  DE
Sbjct:  201 CPPTKFLCANGMCIPKSAVCDGENDCGDMSDEPSNCSAHICDPKLEFQC-------ANGRCINKKWRCDGMKDCADGSDESTC---GEGTCRPDEWHCIGTSRCIPLSRVCDGTNDCGDNYDE 313          

HSP 4 Score: 55.0694 bits (131), Expect = 4.721e-7
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = -2
Query: 7786 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLD 8019
            C N  CI++   C+G+KDC DG DE       C P+++  H +G      +C+     CDG NDCG+ YDE  +C+ LD
Sbjct:  249 CANGRCINKKWRCDGMKDCADGSDESTCGEGTCRPDEW--HCIG----TSRCIPLSRVCDGTNDCGDNYDEGSHCLDLD 321          
BLAST of SMED30010499 vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 75.485 bits (184), Expect = 2.404e-13
Identity = 57/179 (31.84%), Postives = 74/179 (41.34%), Query Frame = -2
Query: 7639 VKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA----------------QCEPNQFSCHTVGGKP--------------PHQ-----------KCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQ 8052
            V+  C+ NQ  C N  CI  +  C+G  DC DG DE+ + CA                +C P+Q+ C      P              P +           +CV  +WRCDGE DC +G DE  C    K+ C  S F C  N   IP S  CD   NC +  DEK C  P   +P +
Sbjct:  116 VQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDEKESLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRRCSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGCR---KSNCASSEFTC-ANGQCIPSSQRCDGTSNCRDSSDEKACVTPPPCMPGE 290          

HSP 2 Score: 64.3142 bits (155), Expect = 6.553e-10
Identity = 40/121 (33.06%), Postives = 59/121 (48.76%), Query Frame = -2
Query: 7678 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            CS     CRN  C+  +  C+G KDC DG DE+    + C  ++F+C        + +C+ +  RCDG ++C +  DE  C+      C+   F C      IP S  CD   +C +GEDE
Sbjct:  207 CSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGCRKSNCASSEFTC-------ANGQCIPSSQRCDGTSNCRDSSDEKACVT--PPPCMPGEFKCQSTGRCIPESKVCDGTRDCQDGEDE 318          

HSP 3 Score: 62.003 bits (149), Expect = 3.291e-9
Identity = 41/124 (33.06%), Postives = 61/124 (49.19%), Query Frame = -2
Query: 7675 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEK 8040
            C  +Q  CRN  CI     C+G  DC DG+  + + C    C  ++F C        ++KC++  W CD ++DCG+  DE   +   + TC  + F C  N   I  S  CD + +C +G DEK
Sbjct:   40 CLQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNCGNVTCGADEFMCS-------NRKCISRSWTCDNQDDCGDNSDEDRNV---QRTCASNQFTC-SNGDCISNSWTCDGDNDCNDGSDEK 152          

HSP 4 Score: 62.003 bits (149), Expect = 4.211e-9
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 8040
            C  ++  C N  CI  +  C+   DC D  DE+ N    C  NQF+C        +  C++N W CDG+NDC +G DE   +   K +C  + F C  +      S W CD + +C +  DE  C
Sbjct:   81 CGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDRNVQRTCASNQFTCS-------NGDCISNSWTCDGDNDCNDGSDEKESLCASK-SCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGC 197          

HSP 5 Score: 60.077 bits (144), Expect = 1.303e-8
Identity = 48/126 (38.10%), Postives = 62/126 (49.21%), Query Frame = -2
Query: 7678 CSFNQRAC-RNSICIDENKFCNGIKDCEDGFDEEIN--TCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGY--DELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            CS  Q  C  +  CI     C+G  DC DG DE+ +  TC Q   +QF+C        + KC+   W+CDGE+DC +GY  DE NC  +   TC    F C  N   I RS  CD   +C +  DE
Sbjct:    1 CSHGQFECVSDQKCIVLRWRCDGEDDCSDGSDEQGSPKTCLQ---DQFTCR-------NGKCIQATWKCDGEDDCRDGYRSDESNCGNV---TCGADEFMC-SNRKCISRSWTCDNQDDCGDNSDE 112          
BLAST of SMED30010499 vs. Ensembl Nematostella
Match: EDO31103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW2])

HSP 1 Score: 75.485 bits (184), Expect = 3.771e-13
Identity = 86/327 (26.30%), Postives = 134/327 (40.98%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQ---------SPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFV--GKMYQDFVVD-PNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQ-NVNGKSLYWCTNDNSEVIYS--NPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVD--HVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQN-----QCVK-KCPINCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            CL+C CSG + +CS A GY +         + +P   T   G    + + ++       SI ++    Y+F       +DF    P  +LT               Y   +   F   +D+   P    + +V  K  Y+    NSE++ S   P G        ++ + NW I +T    A   +++ VLS ++YL IR ++ +N T        +D    I N  S+G+ ++   +E C CP  Y G  CE+C  GY +   N      CV   C  +   CD ++G C  C    +G  C +C  G         SSDC EC C
Sbjct:  856 CLRCHCSGFSTNCSMASGYTRGQLISYLLLTADP---TDLDGWTGRYPNGQLASNLIFSSISNLPGGFYRFYIEASSARDFYFSAPTKYLTR------------GRYAYTHAMTFSLQQDNTTIPSSSTRGDVIIKGRYF----NSELVTSLPTPPGLTFTTYKVVFLESNWRIGNTSGRVATDKELVRVLSSLEYLWIRGRW-TNLTDPSLKTRLMDITMTIANKSSIGDTVF--NVETCQCPIQYVGQFCERCAPGYTRATPNGGAYTPCVPCSCNNHTDTCDPESGVCIDCQHNTTGDHCEKCAVGLYGDATNGTSSDCRECPC 1160          

HSP 2 Score: 40.817 bits (94), Expect = 1.093e-8
Identity = 44/150 (29.33%), Postives = 61/150 (40.67%), Query Frame = -2
Query: 6289 NCPTPYTGLSCEKCLAGY---EKNDQNQCVKKCPINC-VECDKNGNCNRCTGQ-------RSGPKCLECKPGFVRLYGEKLSSDCTECNC------YSQLNNT--------LVSNI----CMRDL----TGQGAIVCKCTGRERNDPLCD 6639
            NC   + G  CE+C  GY     +  N   +KC  N  V+    GNCN  TG+        SG  C  C  GF   +G   +  C  CNC      + + NN         LV+ +    C++D     +G+G   C C  +  ND  CD
Sbjct: 1186 NCSESHAGRQCERCQDGYYGTPTDPVNGQCRKCNCNGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGF---HGNATAKTCQACNCTDRGSKHGECNNVTGQCDCHPLVTGLSCERCVKDAFNYTSGKGCTACGCHPQGSNDTQCD 1332          

HSP 3 Score: 39.2762 bits (90), Expect = 1.093e-8
Identity = 14/39 (35.90%), Postives = 20/39 (51.28%), Query Frame = -3
Query: 6069 VDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKT 6185
            V G C C  N KG  C +C P F+   K C+   C+ ++
Sbjct: 1334 VFGNCTCNTNVKGDKCDQCMPNFYDVGKSCIGVSCTARS 1372          
BLAST of SMED30010499 vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 73.9442 bits (180), Expect = 1.091e-12
Identity = 45/124 (36.29%), Postives = 60/124 (48.39%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C+  Q  C N  CI  +  C+   DC D  DE     + C P+QF C        + +C+++ WRCD +NDCG+  DE NC      TC    F C  N   IP S  CD + +C +  DE NC
Sbjct:  950 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-------NGRCISSKWRCDHDNDCGDMSDERNCT----GTCAPGQFKC-GNGKCIPSSWKCDHDNDCGDNSDENNC 1061          

HSP 2 Score: 71.633 bits (174), Expect = 6.589e-12
Identity = 43/124 (34.68%), Postives = 63/124 (50.81%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C+  Q  C N  CI  +  C+   DC D  DE     + C P+QF C        + +C+++ WRCD +NDCG+  DE NC     +TC  ++F C  N   IP    CD + +C +  DE++C
Sbjct: 1027 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-------NGRCISSKWRCDHDNDCGDMSDERNCT---FSTCASNYFRC-ANQRCIPMRWVCDFDNDCRDNSDERDC 1139          

HSP 3 Score: 69.3218 bits (168), Expect = 3.199e-11
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C+ N   C N  CI     C+   DC D  DE     T + C  N F C        +Q+C+   W CD +NDC +  DE +C    + +C    F+C  N   I RS  CD + +C +G DE+NC +P
Sbjct: 1105 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTPTFSTCASNYFRC-------ANQRCIPMRWVCDFDNDCRDNSDERDCTPTGR-SCNSGQFSC-SNGRCISRSWVCDRDNDCGDGSDERNCSYP 1224          

HSP 4 Score: 67.3958 bits (163), Expect = 1.157e-10
Identity = 46/149 (30.87%), Postives = 70/149 (46.98%), Query Frame = -2
Query: 7594 NSICIDENKFCNGIKDCEDGFDEEINTC-------AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIK-LDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVI-PNQETTYVVHANSSISLK 8013
            + +CI  +  CNG  DC D +DE+   C         C P ++ C        +  C+ + + CDG   C +G DE  C   +  ++C G  F CD N   +P    CD + +C +  DE NC  P +V  P+ ETT      +SI+L+
Sbjct: 1341 SGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCD-------NGACIPSRYECDGRIQCSDGSDETGCTATISPSSCPG--FLCDGNTLCLPFYKRCDGSYDCKDYTDEFNCSMPLMVSNPHVETT----TPTSITLR 1476          

HSP 5 Score: 61.2326 bits (147), Expect = 8.196e-9
Identity = 35/96 (36.46%), Postives = 50/96 (52.08%), Query Frame = -2
Query: 7669 FDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAW-CDENPNCLNGEDEKNC 7953
            F ++  T   C P QF C        + KC+ + W+CD +NDCG+  DE NC     +TC  S F CD+   +   S W CD + +C +  DE+NC
Sbjct:  940 FHQDAQTAGTCAPGQFKCG-------NGKCIPSSWKCDHDNDCGDNSDENNC---PYSTCNPSQFKCDNGRCI--SSKWRCDHDNDCGDMSDERNC 1023          

HSP 6 Score: 54.6842 bits (130), Expect = 7.280e-7
Identity = 41/137 (29.93%), Postives = 56/137 (40.88%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEE--INTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKN-----------TCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C+ N   C N  CI     C+   DC D  DE     T   C   QFSC        + +C++  W CD +NDCG+G DE NC                 +C    F+C +   +  R   CD   +C +  DE +C
Sbjct: 1146 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTPTGRSCNSGQFSCS-------NGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSCLNGRCVFYRLV-CDGVDDCGDSSDEMSC 1274          
BLAST of SMED30010499 vs. Ensembl Medaka
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:NCBI gene;Acc:101159991])

HSP 1 Score: 208.764 bits (530), Expect = 3.922e-66
Identity = 175/621 (28.18%), Postives = 265/621 (42.67%), Query Frame = -2
Query: 6289 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAM--AKDYTIFVTSKTLCEKPMFNNAAMFV----SMCLKCFCSGQTDDCSSAMGY-------------------YQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIR--LFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWE-KENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCP-INC----VECDK-NGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAI-VCKC--TGRERNDPLCD 8040
            C  +Q  C++  CI  +  C+G +DC DG DE   T + CEPN+F C        + +C    WRCDG+NDC +  DE++C K  +  C   HF C  +   IP S  CDE P+C +  DE  C  P V  P +E+   V   S++   C  V VPT  I WR NWG +P     +++            LTI ++     G YTCEA++ K  +    D  + + S  +   P+  N           C+ CFC+G + +C SA  Y                   Y S        +  LL+  + ++   V  ++   +++S            F   P  FL       G+ ++SY   LK  +R  L     + +  P VIL   NG+ L +          S P    NQ +I   E ++NW   +    S  R +++  L+++  + IR  Y ++       +  ++   T   S+G    A  +E+C CP  YTGLSCE C +G+E+      +  C   NC     +CD  +GNC  C     GP+C +C+PG+    G     DC  C C      +  S+ C  D+  Q     C+   TGR      CD
Sbjct:  183 CRADQATCQSGECISRDYICDGERDCADGSDEFRCTPSPCEPNEFRCK-------NGRCALKLWRCDGDNDCEDNSDEMDCTKGPEEQCASKHFECVSDRKCIPASYQCDEEPDCADRSDEYGC-PPTVTTPPEESIQAVRG-STVMFTCRAVGVPTPMITWRLNWGHIPVSGRVSMNNKNG-----FGTLTIRDVKESDQGAYTCEAINAKGLVFGVPDGVLTLVSNPI---PLSGNCPDGTFSVNDRCVPCFCAGISKNCKSAGRYRDQIRLRFTDEEDFKVNVSYPSRPSTPPLSSTQLLIKPEMEEFQLVDLSRRFLNLDS------------FWTLPRQFL-------GNKIDSYGGTLKFKVRYTLARGLSESVERPDVILVG-NGRRLVYRRGQ------STPANVVNQKEIRFTEFQDNWQHSNGQPVS--RGELMMTLANLDSISIRTIYDNHMVSVALSDIVMETTTTEFISLGP---ARDVEEC-CPAGYTGLSCEICSSGFERVPGGLYLGTCAGCNCNGHATDCDPISGNCLSCQHNTEGPQCEKCRPGYFGDPGRGRPDDCKPCPC-PYPETSRFSDTCFLDIDQQATCDACRPGYTGRRCESSKCD 753          

HSP 2 Score: 66.2402 bits (160), Expect = 3.922e-66
Identity = 83/332 (25.00%), Postives = 131/332 (39.46%), Query Frame = -3
Query: 5301 ENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKK----CLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTL----------LYGGKISFTFEY-------NTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGF---VKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDC 6224
            E+  C++ GT +     C CK N  G +C EC PGFF   +     CL CFC   ++ C  S  +R         + +L   LSNR         NTN       T +  + +R P++I   + T      ++PDDI+ + L           YGG++ +T  +       + D   D+V       +E           +       +T+   F E     WR   +G+    RE  + AL       I   + +     + DV++ D+ + H+   N++     VE C CP G  G  C+ C +VGY    +       I  G C+  DC
Sbjct:  748 ESSKCDNRGTVSSSSRPCSCKNNVAGASCDECKPGFFHLSQANPQGCLSCFCMGVSKTCA-SSTWRRDQQVRGGVNGQL-FSLSNR--------ANTN-------TISEGISQRGPSEIVYRFFT------SLPDDIYYWNLPESFRGDKVTAYGGELHYTVRFEPFQRSQSVDNQPDVVLQGNDILLEY-------YHPIKLIPRVAQTVTVTFRES---AWRR-SDGQPCT-REHLLMALADVDVFMIRATYADNLAESISDVQM-DIAVPHSTG-NEVA--LEVEECACPLGYRGPSCQEC-EVGYSRTRS------GIYLGTCERCDC 1033          

HSP 3 Score: 82.4185 bits (202), Expect = 1.026e-14
Identity = 78/301 (25.91%), Postives = 122/301 (40.53%), Query Frame = -3
Query: 5385 NCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQK----KCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLL----------YGGKISFTFEY---NTDLLKD-----LVFSDVTPFIEIESKKF-GRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHA-KWMNDLGKIAPVEMCLCPKGNPGIKCEAC 6215
            NC+  G++    G C CK N +G +CS C PG F   +     CL CFC   TQ+C  S  YR             D V S     G +E     N+   NR      V+ +     L Y           ++ H + L           YGGK+ +T  Y   +T  L+D     ++ +D+T       ++F GR         +TK  E +F E++   WR  +   +L  RE  +  L     + I   + +  ++   + D+++E A    + L +   VE C CP G  G+ C+ C
Sbjct: 1143 NCDQTGSQGCTGGTCYCKMNVEGSSCSSCKPGAFHLHQDNKEGCLSCFCMGVTQQCSSSTHYR-------------DTVTSAF-FPGNFEGFALVNRQRTNRISTGFTVEVSTEGTQLSYSNFDYLG----EEPHYWQLPEAYKGDKVVSYGGKLKYTISYVAESTKSLQDDPDVQIIGNDITLVARQPWRQFPGR---------QTKHFEVVFREEH---WR--RPDGILATREHLMMVLADLDDILIRASY-SADMRSSSISDVSMEIAVPNYSGLAQALEVEQCRCPPGYQGLSCQDC 1410          

HSP 4 Score: 70.0922 bits (170), Expect = 5.054e-11
Identity = 71/318 (22.33%), Postives = 123/318 (38.68%), Query Frame = -2
Query: 6403 CLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFK---SQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESK---DDIPGPKVILQNVNGKSLY-WCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECD--------KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNC 7311
            CL CFC G T  CSS+  Y  +    TS    G    F     Q+   +S   ++ +V+++  +     +     +P+ +   +    G  + SY   LK  I    ES     D P  ++I  ++   +   W      +  +     F    +   W + +  +       A R  ++ VL+D+  +LIR  Y ++       + +++  + N   +   +    +E+C CP  Y GLSC+ C  GY +      +  C +   EC+        + G C  C+    G  C  C PGF         +DC  C C
Sbjct: 1186 CLSCFCMGVTQQCSSSTHYRDT---VTSAFFPGNFEGFALVNRQRTNRISTGFTV-EVSTEGTQLSYSNFDYLGEEPHYWQLPE-AYKGDKVVSYGGKLKYTISYVAESTKSLQDDPDVQIIGNDITLVARQPWRQFPGRQTKH-----FEVVFREEHWRRPDGIL-------ATREHLMMVLADLDDILIRASYSADMRSSSISDVSMEIAVPNYSGLAQAL---EVEQCRCPPGYQGLSCQDCAPGYTRTGTGLYLGHCEL--CECNGHSDSCHPETGICTSCSHNTQGEFCELCAPGFFGDPTVGTPADCQLCAC 1481          

HSP 5 Score: 60.8474 bits (146), Expect = 3.497e-8
Identity = 74/330 (22.42%), Postives = 121/330 (36.67%), Query Frame = -2
Query: 6403 CEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQK-ILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRL--FGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPI-----NCVECD-KNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSD---CTECNC 7356
            C+   F+ +      CL CFC G +  C+S+       + +      G L +  ++     +S   S    +   Y+F   +  D       +        G  + +Y   L   +R   F  S+     P V+LQ   G  +        ++I    +      + S W + +            R  +L  L+D+   +IR  Y  N        + V   I  P S GN + A  +E+C CP  Y G SC++C  GY +      +  C       +   CD + G C +C     G +C  C+ G+   YG  L+ D   C  C C
Sbjct:  779 CKPGFFHLSQANPQGCLSCFCMGVSKTCASSTWRR---DQQVRGGVNGQLFSLSNRANTNTISEGISQRGPSEIVYRFFTSLPDDIY-----YWNLPESFRGDKVTAYGGELHYTVRFEPFQRSQSVDNQPDVVLQ---GNDILLEYYHPIKLIPRVAQTVTVTFRESAWRRSDG-------QPCTREHLLMALADVDVFMIRATYADN---LAESISDVQMDIAVPHSTGNEV-ALEVEECACPLGYRGPSCQECEVGYSRTRSGIYLGTCERCDCNGHSSSCDPETGRCLQCLHNTDGQRCERCQNGY---YGNPLTGDPQACQPCPC 1083          
BLAST of SMED30010499 vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 83.9593 bits (206), Expect = 2.291e-15
Identity = 53/129 (41.09%), Postives = 65/129 (50.39%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            CS +Q  C N  C+     C+G  DC DG DE ++TCA   C P+QF+C    G P +Q CV   W CDG+ DC NG DE NC       C    F C  N   I  S  CD + +C +G DE  C  P
Sbjct:   30 CSSSQLKCGNGRCVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNC----GAPINQ-CVPKSWHCDGKADCSNGADEKNCT---VKQCKNDEFRC-ANGQCISLSFVCDNDNDCSDGSDETTCSKP 149          

HSP 2 Score: 67.3958 bits (163), Expect = 2.290e-10
Identity = 42/123 (34.15%), Postives = 61/123 (49.59%), Query Frame = -2
Query: 7669 CRNSICIDENKFCNGIKDCEDGFDEEINTC------AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8019
            C NS+C+     C+G +DC DG DE   TC      A+C  ++F C        + +C+   WRCDG  DC +  DELNC    +  CL   F C D  + +  +  C+   +C +G DE +C
Sbjct:  158 CNNSVCVPSLWRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFEC-------ANGQCIPGSWRCDGGIDCDDRSDELNC---SRPVCLEGQFQCGDG-SCLQGNLKCNSVRDCSDGSDETDC 269          

HSP 3 Score: 63.929 bits (154), Expect = 2.808e-9
Identity = 46/130 (35.38%), Postives = 58/130 (44.62%), Query Frame = -2
Query: 7660 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL--NC-IKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C  ++  C N  CI  +  C+   DC DG DE   +   C P  F C+       +  CV + WRCDG+ DC +G DE    C  K     C  S F C  N   IP S  CD   +C +  DE NC  P
Sbjct:  112 CKNDEFRCANGQCISLSFVCDNDNDCSDGSDETTCSKPTCNPLSFQCN-------NSVCVPSLWRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFEC-ANGQCIPGSWRCDGGIDCDDRSDELNCSRP 233          
BLAST of SMED30010499 vs. Ensembl Medaka
Match: lrp2b (low density lipoprotein receptor-related protein 2b [Source:ZFIN;Acc:ZDB-GENE-111115-1])

HSP 1 Score: 79.7221 bits (195), Expect = 5.134e-14
Identity = 43/117 (36.75%), Postives = 63/117 (53.85%), Query Frame = -2
Query: 7669 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8019
            C    C   +  C+GI DC D  DE    C  C P  F+C+       ++ C+ + WRCDG +DCG+G DE+NC     +TC   +F C DN   + ++  CD + +C +G DE+NC
Sbjct:   56 CDEGRCRPNSYRCDGIFDCVDKTDEA--NCTSCSPLAFTCN-------NKHCIYSSWRCDGMDDCGDGSDEVNCPTYIPSTCSSEYFTC-DNKRCVSKAWLCDGDNDCGDGSDERNC 162          

HSP 2 Score: 75.8702 bits (185), Expect = 7.701e-13
Identity = 48/128 (37.50%), Postives = 65/128 (50.78%), Query Frame = -2
Query: 7666 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE---EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR 8040
            CS     C N  CI  +  C+G+ DC DG DE        + C    F+C        +++CV+  W CDG+NDCG+G DE NC     +TC   +F C D+   I     CD + +CL+G DEKNC 
Sbjct:   86 CSPLAFTCNNKHCIYSSWRCDGMDDCGDGSDEVNCPTYIPSTCSSEYFTCD-------NKRCVSKAWLCDGDNDCGDGSDERNC-NSSISTCRPGYFLCPDH-RCISSYFVCDGDQDCLDGSDEKNCE 204          

HSP 3 Score: 73.1738 bits (178), Expect = 6.146e-12
Identity = 43/127 (33.86%), Postives = 62/127 (48.82%), Query Frame = -2
Query: 7666 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEI--NTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCR 8040
            CS     C N  C+ +   C+G  DC DG DE    ++ + C P  F C       P  +C+++Y+ CDG+ DC +G DE NC    + +C    FAC      +  S  CD   +C +  DE+NCR
Sbjct:  128 CSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDERNCNSSISTCRPGYFLC-------PDHRCISSYFVCDGDQDCLDGSDEKNC----EFSCQSYQFACASGDQCVSSSYRCDGVFDCRDHSDERNCR 243          

HSP 4 Score: 66.2402 bits (160), Expect = 6.215e-10
Identity = 46/129 (35.66%), Postives = 60/129 (46.51%), Query Frame = -2
Query: 7660 CSFNQRACRNS-ICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELN-CIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8040
            C   Q AC +   C+  +  C+G+ DC D  DE       C  ++F C   G       C+   W CDG  DC +G DE N C  +   TCL S+F C  N   IP S  CD   +C +  DE+NC  P
Sbjct:  207 CQSYQFACASGDQCVSSSYRCDGVFDCRDHSDERNCRPGLCHDDEFQCQMDG------FCIPANWECDGHPDCEDGSDEHNTCPAV---TCLSSYFQC-ANKMCIPMSWLCDGENDCRDMSDEQNCPTP 325          

HSP 5 Score: 55.0694 bits (131), Expect = 1.859e-6
Identity = 50/165 (30.30%), Postives = 68/165 (41.21%), Query Frame = -2
Query: 7594 FCSFNQRACR-NSICIDENKFCNGIKDCEDGFDEEINTC--AQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLD---KNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP-EVVIP--------NQETTYVVHANSSISLK 8043
             C  ++  C+ +  CI  N  C+G  DCEDG DE  NTC    C  + F C        ++ C+   W CDGENDC +  DE NC       +  C  ++  C D     P  A C   P      D K C    E +IP        N+  T+  H +    L+
Sbjct:  246 LCHDDEFQCQMDGFCIPANWECDGHPDCEDGSDEH-NTCPAVTCLSSYFQC-------ANKMCIPMSWLCDGENDCRDMSDEQNCPTPPFTYQEDCALNNGGCSDGCIQSPFGAQCTCPPGFQLLNDSKTCDDINECLIPGFCSQQCYNERGTFRCHCSDGYLLE 402          
BLAST of SMED30010499 vs. Ensembl Medaka
Match: ENSORLT00000033251.1 (pep primary_assembly:ASM223467v1:8:21242553:21248942:-1 gene:ENSORLG00000021901.1 transcript:ENSORLT00000033251.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 9.965e-14
Identity = 53/168 (31.55%), Postives = 76/168 (45.24%), Query Frame = -2
Query: 7549 CRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFS---CHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLD--KNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH-----PEVVIPNQETTYVVHAN-SSISLKCEVVSVPTSTINWRF 8019
            C NSICI     C+G  DC DG DE   +C    P   +   CH++       + +   W+CDG+ DC +G DE  CI L   ++TC    F C D  T I  S  C++  +C +  DE  C       P  ++P +  T + H    S+ L C +  +  S   WR 
Sbjct:    7 CNNSICIPRQSACDGYNDCLDGSDEWPQSCHAESPVTLASHQCHSMEFHCGSGEYIHGSWKCDGDADCLDGSDEAGCIALPLARSTCRPDEFECGDG-TCIHGSRQCNQQYDCRDTTDESGCVDGKRTLPRSIVPLKSCTLLTHHFIWSLLLLCRLQRM--SLQQWRL 171          
BLAST of SMED30010499 vs. Ensembl Medaka
Match: lrp2a (LDL receptor related protein 2 [Source:NCBI gene;Acc:101157655])

HSP 1 Score: 75.8702 bits (185), Expect = 9.779e-13
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = -2
Query: 7654 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEV 8040
            C+  Q  C +  CID N  C+G +DC DG DE+   C  C  N+F C T G      +C+++Y+ CDG  DC +  DE NC +        S F C  + + +P +  CD +P+C +G DE +   P  
Sbjct: 1101 CNPEQFQCPDHRCIDPNYICDGDRDCVDGADEQ--DCYNCTANEFKC-TNG-----HQCISSYYHCDGVFDCSDRSDEHNCTRPPGMCHHESEFQCQSDGSCVPSTWECDGHPDCEDGSDEHHACPPRT 1221          

HSP 2 Score: 75.8702 bits (185), Expect = 1.100e-12
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE---EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            C  N  +C N  C+  +  C+G+ DC D  DE    +NT   C P+ F+C        +++CV   WRCDG NDC +  DE+NC      TC  + F C  N   IP +  CD + +C +G DE +C
Sbjct:  980 CGANSFSCGNGKCVPNSYRCDGVDDCHDNSDEMSCGVNT--TCSPSAFTC-------ANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTC-ANHRCIPHTWRCDTDNDCGDGSDEVDC 1096          

HSP 3 Score: 72.0182 bits (175), Expect = 1.566e-11
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = -2
Query: 7669 CSFNQRACRNSICIDENKFCNGIKDCEDGFDE---EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNC 8040
            CS +   C N  C+     C+G  DC D  DE          C  NQF+C        + +C+ + WRCD +NDCG+G DE++C+    +TC    F C D+  + P    CD + +C++G DE++C
Sbjct: 1020 CSPSAFTCANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTC-------ANHRCIPHTWRCDTDNDCGDGSDEVDCL---GSTCNPEQFQCPDHRCIDPNYI-CDGDRDCVDGADEQDC 1135          

HSP 4 Score: 70.0922 bits (170), Expect = 6.034e-11
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = -2
Query: 7672 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKN 8040
            C+     C+N +CI +   C+   DC D  DE +N    C+ N F+C       P  +C+   W CDGE+DC +  DE  C  + +  C    + C  +   IP    CD   +CL+GEDE N
Sbjct:  155 CNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDE-LNCYPTCKGNYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVPRE-CYPGEWPCPSSGKCIPMDKLCDGRVDCLDGEDETN 268          

HSP 5 Score: 68.5514 bits (166), Expect = 1.749e-10
Identity = 48/131 (36.64%), Postives = 64/131 (48.85%), Query Frame = -2
Query: 7657 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQ--CEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDEL-NCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPE 8040
            C   Q  C    CI  +  C+G  DC D  DE+   CAQ  C+ + F C + G      +C+ + W CD E DC +G DE  NC +    TC G  F C  N   IP    CD   +C +G DE++C +PE
Sbjct:    3 CELGQFRCGTGRCIPGDWHCDGTSDCVDDSDEQ--DCAQVTCDHSHFQCLSDG------ECIPDVWVCDDEEDCEDGSDERQNCGR----TCTGDQFTC-SNGMCIPALYRCDHMADCSDGSDERHC-YPE 119          

HSP 6 Score: 67.781 bits (164), Expect = 2.658e-10
Identity = 46/133 (34.59%), Postives = 68/133 (51.13%), Query Frame = -2
Query: 7654 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCI-KLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKN---CRHPEV 8040
            C  N+  C N +CI  + +C+   DC D  DE+  T   C+P+QF+C        + +CVA  + CDG+NDCG+  DEL  + +    TC   +F C +N   I  S  CD + +C +  DEK    C  P +
Sbjct: 2929 CGINEFTCSNGLCI-RSSYCDRRNDCGDSSDEQGCTYQPCQPHQFTCQ-------NGRCVAQDFVCDGDNDCGDESDELEHMCRTPAPTCPPGNFRC-ENGHCIDLSRVCDRSDDCSDNSDEKGINECTDPSI 3052          

HSP 7 Score: 67.781 bits (164), Expect = 2.940e-10
Identity = 46/133 (34.59%), Postives = 66/133 (49.62%), Query Frame = -2
Query: 7663 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEIN--TCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNV----TLIPRSAWCDENPNCLNGEDE-KNCRH 8040
            CS ++  C +  CI  + +C+G  DC DG DE ++      C  +QF C          +C+A  W CDG+NDCG+  DE    + +  TC  S F C +N       IPR   CD + +C +  DE +NC H
Sbjct: 2803 CSQSEFRCSSGRCIPAHWYCDGGSDCSDGSDEPLSCTLIRTCNTDQFRCDD-------GRCIALSWICDGDNDCGDMSDEDQ--RHNNRTCSSSEFTCANNQPPQRKCIPRDWVCDGDADCADALDEHQNCTH 2926          

HSP 8 Score: 66.2402 bits (160), Expect = 7.388e-10
Identity = 45/145 (31.03%), Postives = 61/145 (42.07%), Query Frame = -2
Query: 7660 ECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHP 8094
            +C+ ++  I     V   C  NQ  C N  CI     C+   DC DG DE     + C P QF C       P  +C+   + CDG+ DC +G DE +C       C  + F C +    I     CD   +C +  DE NC  P
Sbjct: 1044 DCLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDCLGSTCNPEQFQC-------PDHRCIDPNYICDGDRDCVDGADEQDCYN-----CTANEFKCTNGHQCISSYYHCDGVFDCSDRSDEHNCTRP 1176          

HSP 9 Score: 65.0846 bits (157), Expect = 1.888e-9
Identity = 41/122 (33.61%), Postives = 59/122 (48.36%), Query Frame = -2
Query: 7678 CSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCA-QCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8040
            C   Q  C +  C      CN  +DC DG DE+   C  QCE +Q+ C        +++C+   W+CDGE+DCG+  DE +       TC    F C  N   IP++  CD + +C +  DE
Sbjct: 3482 CHLGQFQCSDGNCTSPYFLCNSNQDCPDGSDEDPVLCTHQCESHQWQC-------ANKRCIPESWQCDGEDDCGDHSDE-DPAHCSARTCRPGQFKC-RNGRCIPQAWKCDVDDDCGDNSDE 3594          

HSP 10 Score: 63.5438 bits (153), Expect = 5.032e-9
Identity = 43/138 (31.16%), Postives = 70/138 (50.72%), Query Frame = -2
Query: 7663 IKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDE-EINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDE-LNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRH 8070
            +  TLI    C+ +Q  C +  CI  +  C+G  DC D  DE + +    C  ++F+C     +PP +KC+   W CDG+ DC +  DE  NC      +C  + F C + + +  RS++CD   +C +  DE+ C +
Sbjct: 2836 LSCTLIRT--CNTDQFRCDDGRCIALSWICDGDNDCGDMSDEDQRHNNRTCSSSEFTC--ANNQPPQRKCIPRDWVCDGDADCADALDEHQNCT---HRSCGINEFTCSNGLCI--RSSYCDRRNDCGDSSDEQGCTY 2964          

HSP 11 Score: 58.151 bits (139), Expect = 2.475e-7
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = -2
Query: 7678 CRNSICIDENKFCNGIKDCED-GFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDE 8019
            C N  CI +   CNGI +C D G  +E N    C+P Q  C +         C+   + CDG+NDCG+  DE +      +TC  S F C      IP   +CD   +C +G DE
Sbjct: 2728 CNNGRCIAKEYVCNGINNCYDNGTSDEQNCERTCQPEQTKCQST------NICIPRSYLCDGDNDCGDMSDE-SPTHCATSTCSQSEFRCSSG-RCIPAHWYCDGGSDCSDGSDE 2834          
BLAST of SMED30010499 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 4175.93 bits (10829), Expect = 0.000e+0
Identity = 2058/2081 (98.89%), Postives = 2068/2081 (99.38%), Query Frame = -3
Query:    3 AKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 6245
             KKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSN SEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVR+VSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVI EVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQ+NIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHIN VVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVC+DSRPNSTSNITV+V NKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKY FIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWS VNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGK+VPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAK EVTGKKIVIKDVSVLKNMEIRVRIRNGTTDY+SKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGI NEK+NIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP+IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAV+INEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTF+YLWEIEENNGK TNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYP ISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAG EFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNL YPIKDLAENLIEK
Sbjct: 1084 CKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNGSEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRRVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVIPEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQRNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINRVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCRDSRPNSTSNITVNVLNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYIFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSTVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKKVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKVEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYSSKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPIIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEK 3164          

HSP 2 Score: 1653.26 bits (4280), Expect = 0.000e+0
Identity = 779/788 (98.86%), Postives = 783/788 (99.37%), Query Frame = -2
Query: 6238 LKWQKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 8601
            L+  KKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKK+VASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQF+CHTVGG PPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDS CETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCL GYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK
Sbjct:  299 LEMAKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLTGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 1086          

HSP 3 Score: 582.793 bits (1501), Expect = 1.168e-166
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = -1
Query: 8585 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 9430
            ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCN TKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK
Sbjct:   23 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNTTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 304          

HSP 4 Score: 196.052 bits (497), Expect = 3.769e-49
Identity = 243/958 (25.37%), Postives = 415/958 (43.32%), Query Frame = -3
Query:    3 PQLSVNVIYDPNKPPYPVAVVCKDSRPNST-------SNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNT----NNIFPAELSIFSTSPVINDK-IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATV--------ESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGM--TNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYS-KESPFYPQKLICKDKTGVSSKVQVVKETGINNE-KVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRY-KQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKS-------GDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRS---RNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNL-QLTQGSNKTLQCFGLDSVTKKE-NNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVK-PNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPIS-KESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGS-NRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 2756
            P L     Y    P YP  ++CKD    S+       + I  +  N Y          G L      N+  F+P+ + G Y  I TN++       +LP+   T    N     E  +       N K + I     L I C Y+G   PI +    V E +     V          S Y  ++  ++FD K  SG Y C++ +    L+ ++ ++    G+++ +   +G +    +   QG N        D     +   F  +WEI       TN   L+  KV  K       +++  V   KN+  R  +      Y SK   V   E+ L  P L+    YS  E     + L C D++G  + +QV   +G +++ KVN      E  L  NS   +P    G+Y+C   N++     I  V   +R     +N   +      E  ++  K ++ ++N     I C Y G + P++  +   E  S       GD   VKK  +F   S   +    N     TQ  N+  +     +A    SD +NI  + P I V + GLD   ++    QGSN+ L C   ++ + K+ +  F++ W +E        I+ L+E+ +   G L    VK P + L  +C V        SK F +  +ED L++PKL    + + +   +K L+C+D+S   + + + +++ + +   +NK +N +E +   +S++ LK+ G Y C A +K+G++   +D K    +  + +++ +K    + K+     I     ++ EIDCL+ GG+PP    W+  K+S+  +L + +    + V++K+ +IL+++  N+ +  N  L C VKD+ G   S  V +      +   V GLD + S F P QGS +R+L  S+ +  + KD+S  F F W+        YPI  LAE + +K
Sbjct: 2565 PDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNE-----GTL----DWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPI-IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTI---KGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDK-----GTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLI--ANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSE--NPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNE----IDCLYSGGKPPLV-ADWFLEKNSEMRKLPRGD--SVKKYKVFEKRSDILSIRTEN----ITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEKDGKLSFMTVKNPRQVLYAQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYINRTLAGGVLNKKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRNTAILPEYRVI-EIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDANGVMISSPVFLTQSPSGVRFVVAGLDGDSS-FNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQK 3487          

HSP 5 Score: 77.411 bits (189), Expect = 2.556e-13
Identity = 74/317 (23.34%), Postives = 150/317 (47.32%), Query Frame = -3
Query:  339 CRSRNATH-----SLSDRLNIKGIIPG-IDVTIKGLDTNNNLQLTQGS-NKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIK-VNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 1232
            C + N TH     S++  +N      G   + + GL  + N     GS ++ L+C+  D   K  +  F++ W   + + ++  I  L++  V + G +  +++  P + L  +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G     + + KN+NSV ++ P+   +  +++G+Y C A+NK+GTD+  +++K    +  +S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 5037 CFATNGTHNFTSPSITVDVNKAETQTGPFTIWVSGLSGDFNFYPKVGSVDQKLRCYIEDDKKKDVSKDFKFTWYFLKADKQEYPIMDLADKVVINGGEISFMSMKNPQQVLTAQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 5349          
BLAST of SMED30010499 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 4175.93 bits (10829), Expect = 0.000e+0
Identity = 2058/2081 (98.89%), Postives = 2068/2081 (99.38%), Query Frame = -3
Query:    3 AKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 6245
             KKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSN SEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVR+VSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVI EVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQ+NIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHIN VVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVC+DSRPNSTSNITV+V NKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKY FIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWS VNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGK+VPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAK EVTGKKIVIKDVSVLKNMEIRVRIRNGTTDY+SKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGI NEK+NIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP+IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAV+INEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTF+YLWEIEENNGK TNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYP ISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAG EFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNL YPIKDLAENLIEK
Sbjct: 1084 CKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNGSEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRRVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVIPEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQRNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINRVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCRDSRPNSTSNITVNVLNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYIFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSTVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKKVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKVEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYSSKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPIIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEK 3164          

HSP 2 Score: 1653.26 bits (4280), Expect = 0.000e+0
Identity = 779/788 (98.86%), Postives = 783/788 (99.37%), Query Frame = -2
Query: 6238 LKWQKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 8601
            L+  KKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKK+VASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQF+CHTVGG PPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDS CETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCL GYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK
Sbjct:  299 LEMAKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLTGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 1086          

HSP 3 Score: 582.793 bits (1501), Expect = 1.168e-166
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = -1
Query: 8585 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 9430
            ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCN TKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK
Sbjct:   23 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNTTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 304          

HSP 4 Score: 196.052 bits (497), Expect = 3.769e-49
Identity = 243/958 (25.37%), Postives = 415/958 (43.32%), Query Frame = -3
Query:    3 PQLSVNVIYDPNKPPYPVAVVCKDSRPNST-------SNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNT----NNIFPAELSIFSTSPVINDK-IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATV--------ESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGM--TNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYS-KESPFYPQKLICKDKTGVSSKVQVVKETGINNE-KVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRY-KQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKS-------GDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRS---RNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNL-QLTQGSNKTLQCFGLDSVTKKE-NNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVK-PNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPIS-KESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGS-NRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 2756
            P L     Y    P YP  ++CKD    S+       + I  +  N Y          G L      N+  F+P+ + G Y  I TN++       +LP+   T    N     E  +       N K + I     L I C Y+G   PI +    V E +     V          S Y  ++  ++FD K  SG Y C++ +    L+ ++ ++    G+++ +   +G +    +   QG N        D     +   F  +WEI       TN   L+  KV  K       +++  V   KN+  R  +      Y SK   V   E+ L  P L+    YS  E     + L C D++G  + +QV   +G +++ KVN      E  L  NS   +P    G+Y+C   N++     I  V   +R     +N   +      E  ++  K ++ ++N     I C Y G + P++  +   E  S       GD   VKK  +F   S   +    N     TQ  N+  +     +A    SD +NI  + P I V + GLD   ++    QGSN+ L C   ++ + K+ +  F++ W +E        I+ L+E+ +   G L    VK P + L  +C V        SK F +  +ED L++PKL    + + +   +K L+C+D+S   + + + +++ + +   +NK +N +E +   +S++ LK+ G Y C A +K+G++   +D K    +  + +++ +K    + K+     I     ++ EIDCL+ GG+PP    W+  K+S+  +L + +    + V++K+ +IL+++  N+ +  N  L C VKD+ G   S  V +      +   V GLD + S F P QGS +R+L  S+ +  + KD+S  F F W+        YPI  LAE + +K
Sbjct: 2565 PDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNE-----GTL----DWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPI-IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTI---KGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDK-----GTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLI--ANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSE--NPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNE----IDCLYSGGKPPLV-ADWFLEKNSEMRKLPRGD--SVKKYKVFEKRSDILSIRTEN----ITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEKDGKLSFMTVKNPRQVLYAQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYINRTLAGGVLNKKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRNTAILPEYRVI-EIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDANGVMISSPVFLTQSPSGVRFVVAGLDGDSS-FNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQK 3487          

HSP 5 Score: 77.411 bits (189), Expect = 2.556e-13
Identity = 74/317 (23.34%), Postives = 150/317 (47.32%), Query Frame = -3
Query:  339 CRSRNATH-----SLSDRLNIKGIIPG-IDVTIKGLDTNNNLQLTQGS-NKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIK-VNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 1232
            C + N TH     S++  +N      G   + + GL  + N     GS ++ L+C+  D   K  +  F++ W   + + ++  I  L++  V + G +  +++  P + L  +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G     + + KN+NSV ++ P+   +  +++G+Y C A+NK+GTD+  +++K    +  +S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 5037 CFATNGTHNFTSPSITVDVNKAETQTGPFTIWVSGLSGDFNFYPKVGSVDQKLRCYIEDDKKKDVSKDFKFTWYFLKADKQEYPIMDLADKVVINGGEISFMSMKNPQQVLTAQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 5349          
BLAST of SMED30010499 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 4175.93 bits (10829), Expect = 0.000e+0
Identity = 2058/2081 (98.89%), Postives = 2068/2081 (99.38%), Query Frame = -3
Query:    3 AKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 6245
             KKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSN SEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVR+VSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVI EVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQ+NIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHIN VVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVC+DSRPNSTSNITV+V NKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKY FIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWS VNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGK+VPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAK EVTGKKIVIKDVSVLKNMEIRVRIRNGTTDY+SKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGI NEK+NIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP+IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAV+INEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTF+YLWEIEENNGK TNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYP ISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAG EFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNL YPIKDLAENLIEK
Sbjct: 1084 CKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNGSEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRRVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVIPEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQRNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINRVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCRDSRPNSTSNITVNVLNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYIFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSTVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKKVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKVEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYSSKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPIIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEK 3164          

HSP 2 Score: 1653.26 bits (4280), Expect = 0.000e+0
Identity = 779/788 (98.86%), Postives = 783/788 (99.37%), Query Frame = -2
Query: 6238 LKWQKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 8601
            L+  KKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKK+VASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQF+CHTVGG PPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDS CETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCL GYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK
Sbjct:  299 LEMAKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLTGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 1086          

HSP 3 Score: 582.793 bits (1501), Expect = 1.168e-166
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = -1
Query: 8585 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 9430
            ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCN TKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK
Sbjct:   23 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNTTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 304          

HSP 4 Score: 196.052 bits (497), Expect = 3.769e-49
Identity = 243/958 (25.37%), Postives = 415/958 (43.32%), Query Frame = -3
Query:    3 PQLSVNVIYDPNKPPYPVAVVCKDSRPNST-------SNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNT----NNIFPAELSIFSTSPVINDK-IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATV--------ESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGM--TNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYS-KESPFYPQKLICKDKTGVSSKVQVVKETGINNE-KVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRY-KQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKS-------GDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRS---RNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNL-QLTQGSNKTLQCFGLDSVTKKE-NNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVK-PNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPIS-KESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGS-NRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 2756
            P L     Y    P YP  ++CKD    S+       + I  +  N Y          G L      N+  F+P+ + G Y  I TN++       +LP+   T    N     E  +       N K + I     L I C Y+G   PI +    V E +     V          S Y  ++  ++FD K  SG Y C++ +    L+ ++ ++    G+++ +   +G +    +   QG N        D     +   F  +WEI       TN   L+  KV  K       +++  V   KN+  R  +      Y SK   V   E+ L  P L+    YS  E     + L C D++G  + +QV   +G +++ KVN      E  L  NS   +P    G+Y+C   N++     I  V   +R     +N   +      E  ++  K ++ ++N     I C Y G + P++  +   E  S       GD   VKK  +F   S   +    N     TQ  N+  +     +A    SD +NI  + P I V + GLD   ++    QGSN+ L C   ++ + K+ +  F++ W +E        I+ L+E+ +   G L    VK P + L  +C V        SK F +  +ED L++PKL    + + +   +K L+C+D+S   + + + +++ + +   +NK +N +E +   +S++ LK+ G Y C A +K+G++   +D K    +  + +++ +K    + K+     I     ++ EIDCL+ GG+PP    W+  K+S+  +L + +    + V++K+ +IL+++  N+ +  N  L C VKD+ G   S  V +      +   V GLD + S F P QGS +R+L  S+ +  + KD+S  F F W+        YPI  LAE + +K
Sbjct: 2565 PDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNE-----GTL----DWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPI-IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTI---KGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDK-----GTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLI--ANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSE--NPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNE----IDCLYSGGKPPLV-ADWFLEKNSEMRKLPRGD--SVKKYKVFEKRSDILSIRTEN----ITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEKDGKLSFMTVKNPRQVLYAQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYINRTLAGGVLNKKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRNTAILPEYRVI-EIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDANGVMISSPVFLTQSPSGVRFVVAGLDGDSS-FNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQK 3487          

HSP 5 Score: 77.411 bits (189), Expect = 2.556e-13
Identity = 74/317 (23.34%), Postives = 150/317 (47.32%), Query Frame = -3
Query:  339 CRSRNATH-----SLSDRLNIKGIIPG-IDVTIKGLDTNNNLQLTQGS-NKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIK-VNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 1232
            C + N TH     S++  +N      G   + + GL  + N     GS ++ L+C+  D   K  +  F++ W   + + ++  I  L++  V + G +  +++  P + L  +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G     + + KN+NSV ++ P+   +  +++G+Y C A+NK+GTD+  +++K    +  +S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 5037 CFATNGTHNFTSPSITVDVNKAETQTGPFTIWVSGLSGDFNFYPKVGSVDQKLRCYIEDDKKKDVSKDFKFTWYFLKADKQEYPIMDLADKVVINGGEISFMSMKNPQQVLTAQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 5349          
BLAST of SMED30010499 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 4175.93 bits (10829), Expect = 0.000e+0
Identity = 2058/2081 (98.89%), Postives = 2068/2081 (99.38%), Query Frame = -3
Query:    3 AKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 6245
             KKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSN SEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVR+VSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVI EVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQ+NIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHIN VVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVC+DSRPNSTSNITV+V NKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKY FIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWS VNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGK+VPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAK EVTGKKIVIKDVSVLKNMEIRVRIRNGTTDY+SKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGI NEK+NIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP+IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAV+INEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTF+YLWEIEENNGK TNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYP ISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAG EFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNL YPIKDLAENLIEK
Sbjct: 1084 CKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNGSEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRRVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVIPEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQRNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINRVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCRDSRPNSTSNITVNVLNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYIFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSTVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKKVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKVEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYSSKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPIIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEK 3164          

HSP 2 Score: 1653.26 bits (4280), Expect = 0.000e+0
Identity = 779/788 (98.86%), Postives = 783/788 (99.37%), Query Frame = -2
Query: 6238 LKWQKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 8601
            L+  KKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKK+VASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQF+CHTVGG PPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDS CETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCL GYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK
Sbjct:  299 LEMAKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLTGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 1086          

HSP 3 Score: 582.793 bits (1501), Expect = 1.168e-166
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = -1
Query: 8585 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 9430
            ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCN TKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK
Sbjct:   23 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNTTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 304          

HSP 4 Score: 196.052 bits (497), Expect = 3.769e-49
Identity = 243/958 (25.37%), Postives = 415/958 (43.32%), Query Frame = -3
Query:    3 PQLSVNVIYDPNKPPYPVAVVCKDSRPNST-------SNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNT----NNIFPAELSIFSTSPVINDK-IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATV--------ESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGM--TNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYS-KESPFYPQKLICKDKTGVSSKVQVVKETGINNE-KVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRY-KQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKS-------GDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRS---RNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNL-QLTQGSNKTLQCFGLDSVTKKE-NNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVK-PNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPIS-KESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGS-NRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 2756
            P L     Y    P YP  ++CKD    S+       + I  +  N Y          G L      N+  F+P+ + G Y  I TN++       +LP+   T    N     E  +       N K + I     L I C Y+G   PI +    V E +     V          S Y  ++  ++FD K  SG Y C++ +    L+ ++ ++    G+++ +   +G +    +   QG N        D     +   F  +WEI       TN   L+  KV  K       +++  V   KN+  R  +      Y SK   V   E+ L  P L+    YS  E     + L C D++G  + +QV   +G +++ KVN      E  L  NS   +P    G+Y+C   N++     I  V   +R     +N   +      E  ++  K ++ ++N     I C Y G + P++  +   E  S       GD   VKK  +F   S   +    N     TQ  N+  +     +A    SD +NI  + P I V + GLD   ++    QGSN+ L C   ++ + K+ +  F++ W +E        I+ L+E+ +   G L    VK P + L  +C V        SK F +  +ED L++PKL    + + +   +K L+C+D+S   + + + +++ + +   +NK +N +E +   +S++ LK+ G Y C A +K+G++   +D K    +  + +++ +K    + K+     I     ++ EIDCL+ GG+PP    W+  K+S+  +L + +    + V++K+ +IL+++  N+ +  N  L C VKD+ G   S  V +      +   V GLD + S F P QGS +R+L  S+ +  + KD+S  F F W+        YPI  LAE + +K
Sbjct: 2565 PDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNE-----GTL----DWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPI-IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTI---KGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDK-----GTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLI--ANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSE--NPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNE----IDCLYSGGKPPLV-ADWFLEKNSEMRKLPRGD--SVKKYKVFEKRSDILSIRTEN----ITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEKDGKLSFMTVKNPRQVLYAQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYINRTLAGGVLNKKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRNTAILPEYRVI-EIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDANGVMISSPVFLTQSPSGVRFVVAGLDGDSS-FNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQK 3487          

HSP 5 Score: 77.411 bits (189), Expect = 2.556e-13
Identity = 74/317 (23.34%), Postives = 150/317 (47.32%), Query Frame = -3
Query:  339 CRSRNATH-----SLSDRLNIKGIIPG-IDVTIKGLDTNNNLQLTQGS-NKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIK-VNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 1232
            C + N TH     S++  +N      G   + + GL  + N     GS ++ L+C+  D   K  +  F++ W   + + ++  I  L++  V + G +  +++  P + L  +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G     + + KN+NSV ++ P+   +  +++G+Y C A+NK+GTD+  +++K    +  +S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 5037 CFATNGTHNFTSPSITVDVNKAETQTGPFTIWVSGLSGDFNFYPKVGSVDQKLRCYIEDDKKKDVSKDFKFTWYFLKADKQEYPIMDLADKVVINGGEISFMSMKNPQQVLTAQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 5349          
BLAST of SMED30010499 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 4175.55 bits (10828), Expect = 0.000e+0
Identity = 2058/2081 (98.89%), Postives = 2068/2081 (99.38%), Query Frame = -3
Query:    3 AKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDXXXXXXXXXXXXXVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 6245
             KKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSN SEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVR+VSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVI EVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQ+NIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHIN VVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVC+DSRPNSTSNITV+V NKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKY FIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWS VNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGK+VPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAK EVTGKKIVIKDVSVLKNMEIRVRIRNGTTDY+SKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGI NEK+NIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAP+IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAV+INEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTF+YLWEIEENNGK TNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYP ISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAG EFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNL YPIKDLAENLIEK
Sbjct: 1084 CKKRDLSENKNCNSLGTENIVDGKCKCKENYKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADIKLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLKLTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKKFGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMTAQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNPGIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLNKNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSESTHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNGSEEFFIIVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEKDAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFVIEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWYKVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGKVETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPKTKPIDITHLVRRVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITIDSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVINTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGSRHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQLEWLVNGKITEPISRSKYYSKLVIPEVKDQDHLGIYEVRVKLENGTVISRKIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEIIDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQCTGTYENKNYESRFIFFDVNQRNIDMKVRLLGLIDNKFVSNVEEDTSQVICQAYDARSNRALPGVKYSWNMTHINRVVNWKKLIEDNDKITFGGLIYHPADNSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYPVAVVCRDSRPNSTSNITVNVLNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYIFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDKIRIQGDTSLKIICVYFGHPYPISLKWSTVNEYQLSGATVESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKKVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKVNAKVEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYSSKTVVVNIIENELLHPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPIIDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEK 3164          

HSP 2 Score: 1652.88 bits (4279), Expect = 0.000e+0
Identity = 779/788 (98.86%), Postives = 783/788 (99.37%), Query Frame = -2
Query: 6238 LKWQKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 8601
            L+  KKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKK+VASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQF+CHTVGG PPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDS CETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMG+NIYAPRIEKCNCPTPYTGLSCEKCL GYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK
Sbjct:  299 LEMAKKTFSVNIYPNNVSVFEDMPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCEKCLTGYEKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGEKLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDKCLQEPLSIADERDCKK 1086          

HSP 3 Score: 583.178 bits (1502), Expect = 1.127e-166
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = -1
Query: 8585 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 9430
            ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCN TKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK
Sbjct:   23 ERFRVFSVKTSDQLFTHVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLTTYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQPLTITCNTTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADELNIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRGFTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNFQYSNKVLFHSLEMAKK 304          

HSP 4 Score: 195.667 bits (496), Expect = 4.182e-49
Identity = 243/958 (25.37%), Postives = 415/958 (43.32%), Query Frame = -3
Query:    3 PQLSVNVIYDPNKPPYPVAVVCKDSRPNST-------SNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNPYNNSGKYTFIATNKFGTDSKTILLPQHNNT----NNIFPAELSIFSTSPVINDK-IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATV--------ESSDYVTSLIYDKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPEVIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGM--TNYSLLTTDKVNAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELLHPDLVFVTEYS-KESPFYPQKLICKDKTGVSSKVQVVKETGINNE-KVNIYLTHNEGTLDWNSHPFSPFFDQGTYKCIGTNRY-KQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVYEAKS-------GDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRS---RNATHSLSDRLNIKGIIPGIDVTIKGLDTNNNL-QLTQGSNKTLQCFGLDSVTKKE-NNTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVK-PNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPIS-KESGMKYIKSSIGLLNEIDCLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTENITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGS-NRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIEK 2756
            P L     Y    P YP  ++CKD    S+       + I  +  N Y          G L      N+  F+P+ + G Y  I TN++       +LP+   T    N     E  +       N K + I     L I C Y+G   PI +    V E +     V          S Y  ++  ++FD K  SG Y C++ +    L+ ++ ++    G+++ +   +G +    +   QG N        D     +   F  +WEI       TN   L+  KV  K       +++  V   KN+  R  +      Y SK   V   E+ L  P L+    YS  E     + L C D++G  + +QV   +G +++ KVN      E  L  NS   +P    G+Y+C   N++     I  V   +R     +N   +      E  ++  K ++ ++N     I C Y G + P++  +   E  S       GD   VKK  +F   S   +    N     TQ  N+  +     +A    SD +NI  + P I V + GLD   ++    QGSN+ L C   ++ + K+ +  F++ W +E        I+ L+E+ +   G L    VK P + L  +C V        SK F +  +ED L++PKL    + + +   +K L+C+D+S   + + + +++ + +   +NK +N +E +   +S++ LK+ G Y C A +K+G++   +D K    +  + +++ +K    + K+     I     ++ EIDCL+ GG+PP    W+  K+S+  +L + +    + V++K+ +IL+++  N+ +  N  L C VKD+ G   S  V +      +   V GLD + S F P QGS +R+L  S+ +  + KD+S  F F W+        YPI  LAE + +K
Sbjct: 2565 PDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGIKNEKINIYLTHNE-----GTL----DWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPMNEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPI-IDVEIVYEAKSGDLFVVKKPVLFSNYSQYYAAVEINEFDAKTQSGNYLCRSRNATHSLSDRLNIKGIIPGIDVTI---KGLDTNNNLQLTQGSNKTLQCFGLDSVTKKENNTFKYLWEIEENNGKPTNIETLSESKVFDK-----GTLILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLI--ANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIKVNKNKNSVELILPINSE--NPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLNE----IDCLYSGGKPPLV-ADWFLEKNSEMRKLPRGD--SVKKYKVFEKRSDILSIRTEN----ITQVMNFKLKCFVKDSAGTEFSDSVNIIYVKPIITVDVFGLDHEGSMFTPLQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLHYPIKDLAENLIEKDGKLSFMTVKNPRQVLYAQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYINRTLAGGVLNKKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRNTAILPEYRVI-EIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDANGVMISSPVFLTQSPSGVRFVVAGLDGDSS-FNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQK 3487          

HSP 5 Score: 77.0258 bits (188), Expect = 2.853e-13
Identity = 74/317 (23.34%), Postives = 150/317 (47.32%), Query Frame = -3
Query:  339 CRSRNATH-----SLSDRLNIKGIIPG-IDVTIKGLDTNNNLQLTQGS-NKTLQCFGLDSVTKKENNTFQYLWEIEENNGKQTNIETLSESKVFDKGTL-ILNVVKPNKNLRGRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSGSSSDIK-VNKNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 1232
            C + N TH     S++  +N      G   + + GL  + N     GS ++ L+C+  D   K  +  F++ W   + + ++  I  L++  V + G +  +++  P + L  +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G     + + KN+NSV ++ P+   +  +++G+Y C A+NK+GTD+  +++K    +  +S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 5139 CFATNGTHNFTSPSITVDVNKAETQTGPFTIWVSGLSGDFNFYPKVGSVDQKLRCYIEDDKKKDVSKDFKFTWYFLKADKQEYPIMDLADKVVINGGEISFMSMKNPQQVLTAQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 5451          
The following BLAST results are available for this feature:
BLAST of SMED30010499 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPG21.559e-5927.90heparan sulfate proteoglycan 2 [Source:HGNC Symbol... [more]
LAMA15.721e-1624.58laminin subunit alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
LDLR2.429e-1538.46low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR3.386e-1538.46low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR4.451e-1538.46low density lipoprotein receptor [Source:HGNC Symb... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-525.769e-4227.31Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.184e-3925.78Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.200e-3926.06Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.432e-3926.06Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.500e-3926.06Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol1.803e-4526.48gene:FBgn0284408 transcript:FBtr0342810[more]
trol2.556e-4526.48gene:FBgn0284408 transcript:FBtr0342808[more]
trol2.739e-4526.48gene:FBgn0284408 transcript:FBtr0342816[more]
trol2.877e-4526.48gene:FBgn0284408 transcript:FBtr0342814[more]
trol2.983e-4526.48gene:FBgn0284408 transcript:FBtr0342819[more]
back to top
BLAST of SMED30010499 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg25.945e-6227.27heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg27.437e-6227.27heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg28.147e-6227.27heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lama12.705e-1622.57laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-... [more]
lrp1ba5.854e-1640.00low density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel1l1.605e-6028.76SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l1.840e-5828.76SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l2.231e-5828.76SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
LAMA52.009e-1424.68laminin subunit alpha 5 [Source:NCBI gene;Acc:1001... [more]
rabggtb2.561e-1336.36Rab geranylgeranyltransferase subunit beta [Source... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspg21.976e-5927.46perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Hspg21.976e-5927.46perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Ldlr5.760e-1639.23low density lipoprotein receptor [Source:MGI Symbo... [more]
Ldlr5.954e-1639.23low density lipoprotein receptor [Source:MGI Symbo... [more]
Lama19.045e-1624.73laminin, alpha 1 [Source:MGI Symbol;Acc:MGI:99892][more]
back to top
BLAST of SMED30010499 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98160|PGBM_HUMAN6.918e-5927.90Basement membrane-specific heparan sulfate proteog... [more]
sp|Q05793|PGBM_MOUSE4.857e-5827.46Basement membrane-specific heparan sulfate proteog... [more]
sp|Q06561|UNC52_CAEEL1.109e-3726.06Basement membrane proteoglycan OS=Caenorhabditis e... [more]
sp|P35952|LDLR_RAT1.144e-1539.53Low-density lipoprotein receptor OS=Rattus norvegi... [more]
sp|C0HL13|LRP2_PIG2.348e-1537.40Low-density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of SMED30010499 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6G2K60.000e+099.32Plc (Fragment) OS=Schmidtea mediterranea OX=79327 ... [more]
A0A5K4F3225.197e-935.66Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F4U54.943e-935.66Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0S4941.286e-1334.48Basement membrane-specific heparan sulfate proteog... [more]
A0A4S2KYA68.252e-1134.21Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg21.359e-6327.43heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.477e-6327.43heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg23.329e-6327.13heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg25.081e-6327.13heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lama15.383e-1726.97laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp1ab5.827e-1436.29low density lipoprotein receptor-related protein 1... [more]
lrp2a6.143e-1333.59low density lipoprotein receptor-related protein 2... [more]
ENSPMAT00000001137.17.868e-1335.56pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
ENSPMAT00000008925.17.950e-1324.41pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
sorl12.024e-1235.14sortilin-related receptor, L(DLR class) A repeats ... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010499 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494981.198e-1434.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494991.947e-1441.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437262.404e-1331.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311033.771e-1326.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452181.091e-1236.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010499 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg23.922e-6628.18heparan sulfate proteoglycan 2 [Source:NCBI gene;A... [more]
ldlrb2.291e-1541.09low-density lipoprotein receptor [Source:NCBI gene... [more]
lrp2b5.134e-1436.75low density lipoprotein receptor-related protein 2... [more]
ENSORLT00000033251.19.965e-1431.55pep primary_assembly:ASM223467v1:8:21242553:212489... [more]
lrp2a9.779e-1334.88LDL receptor related protein 2 [Source:NCBI gene;A... [more]
back to top
BLAST of SMED30010499 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055070.11.168e-16698.89SMESG000055070.1[more]
SMESG000055070.11.168e-16698.89SMESG000055070.1[more]
SMESG000055070.11.168e-16698.89SMESG000055070.1[more]
SMESG000055070.11.168e-16698.89SMESG000055070.1[more]
SMESG000055070.11.127e-16698.89SMESG000055070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010499 ID=SMED30010499|Name=SMED30010499|organism=Schmidtea mediterranea sexual|type=transcript|length=9532bp
TCTTTTTCAATTAAATTTTCGGCTAAATCTTTTATTGGATAACGTAGATT
TGTTTGCGTTTCAACGAACCAATCAAATTTGAAATCTTTTGAAACATCTT
TATTACTGTCAGTCTCTTTGACAGAACAAATTAATTGTCGGTTTGATCCT
TGCAAAGGGGTAAACATTGAGCCTTCGTGATCCAGGCCGAATACATCCAC
CGTTATTATTGGTTTGACATATATGATGTTTACGGAGTCTGAGAATTCTC
TGCCAGCTGAATCTTTCACAAAGCACTTCAATTTAAAATTCATAACTTGC
GTAATATTTTCAGTTCGGATAGACAATATATCTGATCGTTTTTCAAAAAC
TTTATATTTTTTTACAGAATCGCCTCTCGGTAATTTGCGCATTTCAGAAT
TCTTTTCCAAGAACCAGTCAGCCACAAGAGGCGGCTTTCCTCCAGAATAC
AGACAATCGATTTCATTAAGTAATCCAATGCTTGATTTAATATATTTCAT
TCCGGATTCTTTTGAAATTGGTCCAGATTTAGTAATGATGTTGATAGAAA
TTTGGGGATACCTTTGAACATATTTCACATCAACTATTCGATGATCAGTT
CCGAATTTGTTTTCGGCTTTGCACTCATATGATCCAATAAATTTCAGTGG
ATTTTCAGAATTGATTGGCAGAATTAATTCAACAGAATTTTTATTTTTGT
TGACTTTGATATCTGACGAAGATCCACTTAAAAATGTTACTTGAATATTC
GTCATTTCTCCGCTTTGATCCAGACATTCTAATGCTTTGATTATTCCAGT
TTTTTCATCTACTGAGTAGTTGGCAATCAATTTCGGCTTCCTCAAGGCAT
CTTCATTTGTAAAAACTTCAAAATACTTTGAGAAATATTTCTTTCCCTGA
ACTATTACAATACATCGACCTCGAAGATTTTTATTTGGTTTCACAACGTT
AAGGATCAATGTTCCTTTATCAAAAACTTTAGATTCAGAAAGAGTTTCAA
TGTTAGTTTGTTTCCCATTATTTTCTTCAATTTCCCATAAATATTGGAAT
GTATTGTTTTCTTTTTTCGTCACAGAATCCAAACCAAAACACTGCAAAGT
CTTATTAGATCCTTGAGTTAGTTGAAGGTTGTTGTTGGTATCAAGTCCTT
TAATGGTGACATCAATCCCTGGTATTATTCCTTTTATATTCAATCTGTCC
GACAGAGAGTGAGTAGCATTCCTTGATCTGCATAAATAATTTCCTGATTG
CGTTTTAGCGTCAAATTCATTGATTTGCACTGCAGCATAGTATTGGGAAT
AATTTGAAAATAGCACCGGCTTCTTTACTACAAACAAATCTCCAGATTTA
GCTTCGTAAACTATTTCTACGTCAATCATTGGAGCTTCGGTTCCGTAATA
ATTGCATGAAATCAGGAGTTTATTTCCATTTATTATTTCAAGAGTTTTCT
TGTTCTCTTCAACTTTAATTTCATTGACTCTTGATTCAAATTGAACATAT
TCATTCATAGGAGTGGTTGTTTCACGTTTTTCTGGAAGAACAGTGTAAAT
GAATCGTTGTTTGTACCGATTTGTTCCGATACATTTATATGTTCCTTGAT
CGAAGAATGGTGAAAACGGATGTGAGTTCCAGTCAAGAGTTCCTTCATTA
TGTGTCAAGTAAATATTAACCTTCTCGTTGTTTATTCCGGTTTCCTTAAC
GACTTGGACTTTAGATGATACTCCAGTCTTATCCTTACAGATAAGCTTTT
GGGGATAGAATGGACTTTCTTTTGAATATTCAGTTACAAAAACCAAATCA
GGGTGAAGAAGTTCATTTTCAATAATATTGACAACAACAGTTTTGGATGC
ATAGTCAGTTGTGCCGTTACGTATTCGTACTCGGATTTCCATGTTTTTCA
AAACAGAAACATCTTTTATGACAATTTTCTTCCCGGTTACTTCGAATTTT
GCATTAACTTTATCTGTGGTGAGAAGCGAATAATTTGTCATTCCAGGATG
TCGGATCTCCCAGACCCCCGAGAATTTAGTGGGTTTTGAATTGTCGCTTA
AATCAGTCTCATTGTAAATGAAAACAATATTTTCTCCTTGCTTTTTCACA
ATCACCTCTGGAACTTCCTTACCTTCTTCATTCAGTAAGTCTATTTCTAA
TCCATAACCGAAACTTTCTACTTGAACTTTTTTCGTTAATAAGCCTTGAT
GGCTGATTGCCTGGCATGTATATTCTCCGCTGTTAATCTTTCGATCAAAT
TTATCATATATTAGTGAGGTTACGTAATCCGATGATTCAACTGTAGCGCC
GCTTAACTGATATTCATTTACTGGAGACCACTTCAGGCTTATAGGATATG
GATGGCCGAAATAAACACATATTATTTTCAAACTAGTGTCTCCTTGAATT
CTGATTTTATCGTTGATTACTGGAGAAGTTGAGAAAATAGAGAGTTCCGC
TGGGAATATGTTATTTGTATTATTATGCTGAGGCAGCAAAATTGTCTTTG
AATCTGTCCCAAATTTATTAGTAGCAATAAATGTATATTTTCCCGAATTA
TTATAGGGATTAAATTTTGTATTATTTTCTGTAAAATTAATCATTAGGAA
TCCAGGTTTCGACAGAACTCTTTTTTGATCAAAGTATTTATTAAATACGT
CGACTGTAATGTTTGACGTGGAGTTAGGTCGTGAATCTTTGCAGACCACA
GCCACAGGATACGGTGGCTTATTTGGATCGTATATTACGTTGACAGAAAG
TTGAGGGGTTTCAGTTCGATCCTTTTTTATCACTTTAAAAGAAAATGGTT
CCGAGTACATAATCGTGTTGAAATAATCAGCTTTACAAACACCGACAGCT
GAATTGTCGGCCGGATGATAAATTAATCCACCGAATGTAATTTTGTCATT
ATCTTCAATCAGCTTTTTCCAGTTCACAACACTATTAATGTGTGTCATGT
TCCATGAATATTTTACCCCTGGCAATGCCCTATTTGATCTGGCATCATAA
GCTTGACAAATGACCTGACTTGTATCTTCTTCCACATTGGAAACGAATTT
ATTGTCGATTAGTCCGAGAAGTCTGACTTTCATGTCAATATTCTTCTGGT
TGACATCGAAGAAAATAAACCTTGATTCATAGTTTTTGTTTTCATACGTC
CCTGTGCACTGGCCTATGTATGAGTTCAGTGTTCGATTGGCTTTCGAAAT
TTTCAGTTCTTTGGGGGTGATTTCTTTGGTAAACCCTGGTAACTCCGATA
CCGGTATCTGTTGACCCATTGTCGTTTTTATTTTCCACACAATGTTTGCG
TCTATTATTTCAGATTCTTCACCTTTAACTGATTTTATGAGGCTGCACCT
TACTGATTTGGTATCTCCTTCTAATATTGTCATATTCCCTGACGGATTAA
TGCCGTCGACTTTCAAATAAATTGAAGTTTCTTTCGGATAGGAGATTTCA
ATTTTTCGTGATATTACTGTTCCGTTTTCTAGTTTGACTCTGACTTCATA
AATTCCCAAATGATCTTGGTCTTTCACTTCAGAAATAACGAGTTTTGAAT
AGTATTTGCTTCGACTTATGGGTTCAGTGATCTTTCCGTTGACAAGCCAT
TCCAGTTGAGAATCATTTGCAGGATTTCCAAATAATTCAGCAGTAATTTC
AAGTCTTTGCTTTTTGGTGACGAAAATTGATAAAGCTTGTTGTTGTTTGA
AAATAGGATTAGTTGAACTAGTGATGTTGATTGTTCCGGGATATTTCGAG
TGTCTTGATCCGGATGTTTTCGAATCTGGAACTGGCACTGACTTTGAGGC
ACTGTTGAATGAATTGTTGATTCTGCATGTGTAAATTCCTTCGTGTAAAT
CAAGTGAAAATCCCCCAACAATTTTCCAATTTATTGTAGAGCTCGAATTT
GTATTAATAACTAAGTTTTTATCAACTGGTTTCCCTTTGAAGTACCAGAC
AACAGAGGAGGGATGGGCAGTGTTGTTATCTCGACATTCCATTGAAACTG
GATAAACTGAAGTTTCAAATTTCTTTTTGATTTCAACGACGGGAAATTTT
GAATCAATAGTGATTTTAATTTTTCCTTTCATGTCTATTTCAGGAATGAC
AGAGCATCTAAAACGTATAACTTGTCCAATTGAGAGTTCACGGTCAATTA
TTATTTCTTTATCTGAGACTTTTCGTACGAGATGTGTAATGTCGATTGGT
TTGGTTTTCGGATCAACGAGCTCCCAGGACTGACTAGGACATTTGATCGG
ATCTGGCACATAGAGAGAAATACTGGCATTTCTGGGTTCGGTTGTATTCA
ATATTTCTTTATTCACAACAGGTCTCATTGGTGCAACTTTTACCGTGGTT
TCAACCTTCCCAACTTTTGTCCCTTCATCGGAATTAATTATGTAACCAAC
ATATCGGCCATTGTGATTGTCACCAGCTGACCAGATTAATAAATCATTTA
CATCTTTTGTAACTCCATTCGGTAAAGGATGCTCCGAACCATCTTCATTT
ACCTTGTACCAAAATGTTTCCGTTCTTATTTTAGGATTTACCAATACTCT
GACTCTTGCAGATTCTAGAAAATTCACTTCCAAAACCGGTTTGTCCACAG
AAACCTTCAATTGATCTGAGTTTATGCTGAGATTTCTTTTTATATTTTCC
TCAATAACAAAACGGAATGGGTTTTCCACTCGACTTCCAACTATTACTCC
CTTTAATTTAACTCCCGTTGTGACATTCGTTGGCACTTCAATGTCGATTT
TATAGACTTTGTTTTCAGTTGTCATACTGATTTTAGATGAAGTTTCTTTT
GCATCCTTTTCACCATCTTTCACTAAGAACCAAAAAACTTTATAATCCGT
TGGCTTTTGAGGCGAATCTACAGTAACATTGACTTGAGTTTTAACTTTAT
CAATAGTTGTAACTGAAATTTCCACAGCAAGACGCGGCGGTTTTTCTTCA
ACAATGATAAAGAACTCCTCAGATGCATTGCTAACCGAATTGACTGCTTC
ACAAACATACAAACCTCCATCAGACATTTGGATTTTTTTGAAATTCAGAA
TAAGATTTGATGACTTGTCCTCTGTCATTTCGTGAGTAACATTAAGATGA
GTCGATTCAGAAACTTTATTCCATTTATGGATGGCGATCCCACCTCTGTG
TGATTTAGCCGTACAAGGTATCCGTATACTCTCATCCTTATTTACATAAA
TAATTCTCCCTTTTGTCATCATTTCAATACCAATTTGGCAGGTTGAAAAG
TTTTTGTTCAACACAAAATCGTATTTGTAAGTTCCTTCTTTGCAGTCAGC
ACAATCTGGAGAGTCACACCGGCCACATACAATATCCGGCAAATTAGGAG
ATACGTTGATGACGTTTTCATATCCAACTTTATTACAGGCTTCACATTTA
ATTCCTGGATTACCTTTAGGACAAAGACACATTTCTACTGGAGCTATTTT
TCCCAAATCGTTCATCCATTTTGCATGTTCAATTGTCAAATCTCGAAGAC
GAACATCCTTCACAAATCCATTGTCAAATGGAAATCCAATCGAGAGATGT
TGAGCAGTCATCAACGCTCGAATGAATGTTTCTCTATCTTCCAGCAACTT
TCCTTCTTTGCCTATTCTCCATTTTGGAAAATTATCTTCCATAAATAGGG
ATTCCATGGTTTTCGTTTTCTCATTAAAGCTCAAAACTGTCCACAATCTT
CCAAATTTCTTACTCTCGATTTCAATGAATGGAGTCACGTCACTGAAAAC
TAAATCTTTCAACAGATCGGTATTGTATTCGAATGTAAAGCTTATCTTTC
CTCCATACAGCAAGGTATATTTGTGAATATCATCGGGAACTGTCGAATTC
GTTAACTTCAGAGTAACGTAAACAAGGCCTATCTGATTAGGATTTCTTTT
GACAAGAATTATATTTTCAGTTCGGTTTACTAATAATTGGTTATTTGTAT
TTTGGGCTTCGTATACCCCTGATATTTGACGGTTTGAGAGGACAACATCC
AATTTGATATCAGCAGAGTTCAATGTTAAATTTGAAAAGCGATACTGATC
GGATTCTTTACATTCTTGCGTTTTGTTTGAACAAAAACATTTCAAGCACT
TTTTCTGAAATGAAAAAAATCCAGGAGAACATTCAGAACAGTTTGGGCCT
TTGTAATTTTCTTTGCATTTGCATTTTCCATCGACAATATTTTCGGTTCC
TAAAGAATTACAGTTTTTATTTTCGGATAGATCTCGTTTTTTTGCAGTCT
CGTTCATCAGCAATTGACAAAGGTTCCTGTAGGCATTTATCACACAAGGG
ATCATTTCGTTCTCGACCGGTGCACTTACACACGATTGCTCCCTGGCCGG
TTAAATCTCTCATGCAAATGTTCGATACCAGAGTATTGTTTAGCTGAGAA
TAACAATTGCATTCTGTGCAATCTGAACTCAGTTTCTCTCCATAAAGTCT
TACGAATCCAGGTTTGCATTCCAGACATTTCGGTCCACTTCGTTGCCCAG
TACACCGATTGCAGTTTCCATTTTTATCACATTCAACACAGTTTATTGGG
CATTTTTTCACGCATTGGTTTTGATCATTCTTTTCATAGCCAGCCAAACA
TTTCTCACAAGATAATCCCGTGTAAGGAGTAGGACAATTGCACTTTTCTA
TTCTTGGTGCATAGATATTATTGCCCATGGAATCCGGATTCGTGATAACG
TGATCAACAGTCGCATTGAAAAACTCAAATCCCGTTTGATTCGAATAGTA
TTTGATCCGAATTAGCAAATATTTAATATCAGATAATACAGCAAGAATGT
CTGGTCTCATGGCTGATGTCTCACAGGTACTGTCAATGAACCAGTTCTCC
TTCTCCCATAAGGATATCTTCAATTGGTTATAGAACCCCTCTGGATTGGA
ATAGATAACTTCACTATTGTCGTTTGTGCACCAGTACAGACTTTTCCCAT
TCACGTTTTGAAGGATGACTTTAGGTCCTGGAATATCGTCTTTACTTTCA
CCAAAGAGCCTTATATTAATTTTCAAATAATAAGAATAAGATTCAAGCCA
AGATCCGTCCATTCCAAAATCACTTGTTAGAAAAACATTTGGATCGACAA
CGAAGTCTTGATACATTTTTCCAACGAACTTGTAACTTTTACTATTGACA
TCGTAAATGGATTTCGCATAAGAAACTTCGAGAATTTTCTGAGATTTGAA
GTTCATCAGCAAACCCTTGGTACGTGTTGAGGTTTTGGGGTTTGGACTCT
GGTAATACCCCATAGCACTTGAACAGTCATCGGTTTGGCCGGAACAAAAG
CACTTCAAGCACATTGACACGAACATGGCTGCGTTATTGAACATAGGCTT
TTCGCATAATGTTTTTGAAGTAACAAAGATGGTGTAATCTTTGGCCATGG
CTCGTTTTGTAGAAAGTGCCTCACAAGTATAAATTCCAGCAAAATCTGGA
CTCATGTTATTTATGGTGAGAACATTTGTGATTCTGTTGCAATCTTTTCC
CGTTTGGTGAACGGTGAAATTTAACCGTTGTGGCAATCGTCCCCAGTTGA
ATCTCCAATTTATTGTCGATGTTGGAACGCTTACAACTTCACATTTGAGT
GAAATTGAGGAGTTGGCGTGAACGACATATGTGGTTTCTTGATTTGGAAT
AACGACTTCAGGATGTCTGCAATTTTTCTCGTCCTCTCCATTTAGACAAT
TCGGATTTTCATCACACCATGCTGATCTGGGAATTAATGTTACATTATCA
TCACAAGCAAAATGACTGCCAAGACAAGTGTTTTTATCCAATTTAATACA
GTTCAATTCATCATATCCATTTCCACAGTCATTTTCGCCATCACAACGCC
AATAGTTGGCAACACATTTTTGATGTGGTGGTTTACCGCCGACAGTATGA
CAAGAAAATTGATTCGGTTCACATTGAGCGCATGTATTTATCTCTTCGTC
GAATCCATCCTCACAATCCTTAATGCCGTTGCAAAATTTATTCTCATCTA
TGCAAATGCTGTTGCGACAAGCCCGTTGATTGAAAGAGCAAAAGTCTTTC
ACTATCAATGTTGCTTTTATTAGAAGATTATTATGTACACATTCATATAC
AGTTCCATTCATTTCTTTTGTAGCAGTGTTTACTATCAATAGCGCTTGAG
TTTCTCCACCAACTCTTGATTCTACATCAATTTGAAAACTCTTTTTATCT
TCTCTTCTCCAAATAACCGTTCCAGAAGCCCCAATCAGTTGACACAAAAA
TCTAGCAGAGCTTCCCGGTCTGACAATCATTTCAGTGGGTGTCACAAGCA
AAGTTGGTTTGGGTAAGACATTCAATACAGCAGATGCTACATTCTTTTTT
GCATCACAGTAATATGTTCCTGCATGGAAAGGTTTGACTGAATTAATATT
CACTGTGGAATTAAAAGAGTTGTGACGAATGACGGCATCTTTCGATAAAT
TTGTTTCTACATTAGATGCCAAATTCTTGAATGTCCACAACGAGCCATAA
TTAAAGGTATTATTGCACAAAAATTCGACAGGCATATCTTCAAACACTGA
GACATTATTTGGATAAATATTGACGGAAAATGTTTTTTTTTGCCATTTCA
AGTGAATGGAACAATACTTTGTTAGAATATTGAAAATTTGGATCGCTTCT
GTCTGTTACTTGGTTGAAGAATTCATCATTTAAATATTGTGGCGTGAATA
CGAAAACATAGAAAGATCTTCCTTGATTTAATAAAACCAGTCCAATAGGT
TGTTCCCAGATTACCCTTCTTGTGGTTGTGAAACCTCTGTTTGTGAGATA
CTGAAGACTTTCTCCAAGTGGGCTGGTTGGAAAATTTGTACTTTGGACGG
TTTTTCTAGACAATGCATTGTATTCCACAGTTGGCAGCTTCACAATAATC
CTTTTTGCAAGTAAAATTGTCTCAATGATGTTCAACTCATCTGCACAAAA
GTAAGAACCCAAATCTGTAACTTTGACCGAATTTATGGTTAGTGTATTTT
CTGTATGGTTAAATTGCAATAAATCCGGTCCAAACCAAATCGTTTTGATG
TTTGGTTTAGTATTATTGCAAGTAATAGTTAATGGTTGATCTAATTCTGT
ATTAATTATTTCTACTGGAGTCCATGAATAGGCCAACTGTTGAATATCTT
GATATTTGTTTTCCTTGTCAAAATAGAACTTAACAGATTCTTCACTGCCA
TCAGCTTTATGTTTTACCGTACAGTAATAAGTTGTTAGAGTTTTTTCCGA
AGCTACATCAACGATTGTACTATCTTTGCTTTCTCCAAAATTCGGTATTG
GAATTATTATTCCTGAATATTCACCCAAAAACGTTATCGTATCATCCTCT
GACCATGCTAACGGACACCGAATCATTACGTGGGTAAACAATTGATCTGA
AGTTTTTACTGAAAAAACTCTAAATCTTTCAATTCCATTAAGGCTGTTTA
TTATCGTCAGCAATGTTAAAATGAATATCGGGTTTATACTACTCATTGAG
AATGATAAATTTTCCCAGACAGTATAAAATTG
back to top

protein sequence of SMED30010499-orf-1

>SMED30010499-orf-1 ID=SMED30010499-orf-1|Name=SMED30010499-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
QFYTVWENLSFSMSSINPIFILTLLTIINSLNGIERFRVFSVKTSDQLFT
HVMIRCPLAWSEDDTITFLGEYSGIIIPIPNFGESKDSTIVDVASEKTLT
TYYCTVKHKADGSEESVKFYFDKENKYQDIQQLAYSWTPVEIINTELDQP
LTITCNNTKPNIKTIWFGPDLLQFNHTENTLTINSVKVTDLGSYFCADEL
NIIETILLAKRIIVKLPTVEYNALSRKTVQSTNFPTSPLGESLQYLTNRG
FTTTRRVIWEQPIGLVLLNQGRSFYVFVFTPQYLNDEFFNQVTDRSDPNF
QYSNKVLFHSLEMAKKNIFRQYLSK*
back to top

protein sequence of SMED30010499-orf-2

>SMED30010499-orf-2 ID=SMED30010499-orf-2|Name=SMED30010499-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2101bp
MIPCVINAYRNLCQLLMNETAKKRDLSENKNCNSLGTENIVDGKCKCKEN
YKGPNCSECSPGFFSFQKKCLKCFCSNKTQECKESDQYRFSNLTLNSADI
KLDVVLSNRQISGVYEAQNTNNQLLVNRTENIILVKRNPNQIGLVYVTLK
LTNSTVPDDIHKYTLLYGGKISFTFEYNTDLLKDLVFSDVTPFIEIESKK
FGRLWTVLSFNEKTKTMESLFMEDNFPKWRIGKEGKLLEDRETFIRALMT
AQHLSIGFPFDNGFVKDVRLRDLTIEHAKWMNDLGKIAPVEMCLCPKGNP
GIKCEACNKVGYENVINVSPNLPDIVCGRCDSPDCADCKEGTYKYDFVLN
KNFSTCQIGIEMMTKGRIIYVNKDESIRIPCTAKSHRGGIAIHKWNKVSE
STHLNVTHEMTEDKSSNLILNFKKIQMSDGGLYVCEAVNSVSNASEEFFI
IVEEKPPRLAVEISVTTIDKVKTQVNVTVDSPQKPTDYKVFWFLVKDGEK
DAKETSSKISMTTENKVYKIDIEVPTNVTTGVKLKGVIVGSRVENPFRFV
IEENIKRNLSINSDQLKVSVDKPVLEVNFLESARVRVLVNPKIRTETFWY
KVNEDGSEHPLPNGVTKDVNDLLIWSAGDNHNGRYVGYIINSDEGTKVGK
VETTVKVAPMRPVVNKEILNTTEPRNASISLYVPDPIKCPSQSWELVDPK
TKPIDITHLVRKVSDKEIIIDRELSIGQVIRFRCSVIPEIDMKGKIKITI
DSKFPVVEIKKKFETSVYPVSMECRDNNTAHPSSVVWYFKGKPVDKNLVI
NTNSSSTINWKIVGGFSLDLHEGIYTCRINNSFNSASKSVPVPDSKTSGS
RHSKYPGTINITSSTNPIFKQQQALSIFVTKKQRLEITAELFGNPANDSQ
LEWLVNGKITEPISRSKYYSKLVISEVKDQDHLGIYEVRVKLENGTVISR
KIEISYPKETSIYLKVDGINPSGNMTILEGDTKSVRCSLIKSVKGEESEI
IDANIVWKIKTTMGQQIPVSELPGFTKEITPKELKISKANRTLNSYIGQC
TGTYENKNYESRFIFFDVNQKNIDMKVRLLGLIDNKFVSNVEEDTSQVIC
QAYDARSNRALPGVKYSWNMTHINSVVNWKKLIEDNDKITFGGLIYHPAD
NSAVGVCKADYFNTIMYSEPFSFKVIKKDRTETPQLSVNVIYDPNKPPYP
VAVVCKDSRPNSTSNITVDVFNKYFDQKRVLSKPGFLMINFTENNTKFNP
YNNSGKYTFIATNKFGTDSKTILLPQHNNTNNIFPAELSIFSTSPVINDK
IRIQGDTSLKIICVYFGHPYPISLKWSPVNEYQLSGATVESSDYVTSLIY
DKFDRKINSGEYTCQAISHQGLLTKKVQVESFGYGLEIDLLNEEGKEVPE
VIVKKQGENIVFIYNETDLSDNSKPTKFSGVWEIRHPGMTNYSLLTTDKV
NAKFEVTGKKIVIKDVSVLKNMEIRVRIRNGTTDYASKTVVVNIIENELL
HPDLVFVTEYSKESPFYPQKLICKDKTGVSSKVQVVKETGINNEKVNIYL
THNEGTLDWNSHPFSPFFDQGTYKCIGTNRYKQRFIYTVLPEKRETTTPM
NEYVQFESRVNEIKVEENKKTLEIINGNKLLISCNYYGTEAPMIDVEIVY
EAKSGDLFVVKKPVLFSNYSQYYAAVQINEFDAKTQSGNYLCRSRNATHS
LSDRLNIKGIIPGIDVTIKGLDTNNNLQLTQGSNKTLQCFGLDSVTKKEN
NTFQYLWEIEENNGKQTNIETLSESKVFDKGTLILNVVKPNKNLRGRCIV
IVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGE
MTNIQVTFLSGSSSDIKVNKNKNSVELILPINSENPLKFIGSYECKAENK
FGTDHRIVDVKYVQRYPQISINIITKSGPISKESGMKYIKSSIGLLNEID
CLYSGGKPPLVADWFLEKNSEMRKLPRGDSVKKYKVFEKRSDILSIRTEN
ITQVMNFKLKCFVKDSAGREFSDSVNIIYVKPIITVDVFGLDHEGSMFTP
LQGSNRQLICSVKETDSNKDVSKDFKFDWFVETQTNLRYPIKDLAENLIE
K
back to top

protein sequence of SMED30010499-orf-3

>SMED30010499-orf-3 ID=SMED30010499-orf-3|Name=SMED30010499-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=773bp
MPVEFLCNNTFNYGSLWTFKNLASNVETNLSKDAVIRHNSFNSTVNINSV
KPFHAGTYYCDAKKNVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQL
IGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECV
HNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEIN
TCAQCEPNQFSCHTVGGKPPHQKCVANYWRCDGENDCGNGYDELNCIKLD
KNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQE
TTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCN
RITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFN
NAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTSTRTKGLLMNFKSQK
ILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESY
SYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEG
FYNQLKISLWEKENWFIDSTCETSAMRPDILAVLSDIKYLLIRIKYYSNQ
TGFEFFNATVDHVITNPDSMGNNIYAPRIEKCNCPTPYTGLSCEKCLAGY
EKNDQNQCVKKCPINCVECDKNGNCNRCTGQRSGPKCLECKPGFVRLYGE
KLSSDCTECNCYSQLNNTLVSNICMRDLTGQGAIVCKCTGRERNDPLCDK
CLQEPLSIADERDCKKTRSIRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR036179Ig-like_dom_sf
IPR002172LDrepeatLR_classA_rpt
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR000034Laminin_IV
IPR002049Laminin_EGF
IPR023415LDLR_class-A_CS
IPR007110Ig-like_dom
IPR013151Immunoglobulin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 222..243
score: 49.0
coord: 265..286
score: 38.03
coord: 176..197
score: 41.02
coord: 660..681
score: 19.51
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 253..291
e-value: 2.0E-6
score: 37.3
coord: 165..202
e-value: 5.8E-4
score: 29.2
coord: 204..248
e-value: 3.9E-11
score: 53.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 253..289
e-value: 1.4E-5
score: 25.2
coord: 204..246
e-value: 4.5E-9
score: 36.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 204..247
score: 12.7
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 165..203
score: 10.938
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 253..290
score: 9.562
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 166..198
e-value: 1.75971E-6
score: 42.9642
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 254..289
e-value: 3.27706E-4
score: 36.4158
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 205..246
e-value: 1.06639E-8
score: 49.1274
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 83..163
e-value: 0.096
score: 21.8
coord: 300..389
e-value: 3.4E-7
score: 39.9
coord: 2..74
e-value: 190.0
score: 0.4
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 306..378
e-value: 1.6E-4
score: 31.1
IPR000034Laminin IVPFAMPF00052Laminin_Bcoord: 494..603
e-value: 7.7E-8
score: 32.3
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 165..208
e-value: 1.3E-7
score: 33.7
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 209..243
e-value: 1.2E-9
score: 40.0
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 249..288
e-value: 2.7E-7
score: 32.6
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 163..198
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 204..247
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 253..298
NoneNo IPR availablePFAMPF13927Ig_3coord: 292..373
e-value: 2.6E-10
score: 40.8
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 166..427
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 166..427
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 289..390
e-value: 1.2E-11
score: 46.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 70..163
e-value: 2.9E-6
score: 29.3
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 178..202
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 675..709
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 292..381
score: 10.299
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 77..149
score: 9.718
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 299..376
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 73..155
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 28..82