Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30010487
Length (bp)2206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30010487) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30010487) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30010487) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30010487) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010487

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010487h1SMcG0016548 dd_Smed_v4_11271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010487h1SMcG0016548 dd_Smed_v4_11271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010487h1SMcG0016548 dd_Smed_v6_11271_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010487h1SMcG0016548 dd_Smed_v4_11271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17B (serine/threonine kinase 17b [Source:HGNC Symbol;Acc:HGNC:11396])

HSP 1 Score: 187.963 bits (476), Expect = 1.561e-52
Identity = 99/275 (36.00%), Postives = 162/275 (58.91%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            YI+  KE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    K+   VI L+E YE  SE+ILI E+A GG +++L + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++    +H W     + N+ +P
Sbjct:   32 YILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELA--KSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHP 304          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17B (serine/threonine kinase 17b [Source:HGNC Symbol;Acc:HGNC:11396])

HSP 1 Score: 187.963 bits (476), Expect = 1.561e-52
Identity = 99/275 (36.00%), Postives = 162/275 (58.91%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            YI+  KE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    K+   VI L+E YE  SE+ILI E+A GG +++L + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++    +H W     + N+ +P
Sbjct:   32 YILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELA--KSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHP 304          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17A (serine/threonine kinase 17a [Source:HGNC Symbol;Acc:HGNC:11395])

HSP 1 Score: 181.8 bits (460), Expect = 6.226e-50
Identity = 101/282 (35.82%), Postives = 164/282 (58.16%), Query Frame = 3
Query:  144 LNEIDEFEKRHDWRKNYIVKP-KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            L EI    +   ++  Y + P +E+GRG F+ V +   K   K FAAK +R+++ G D   +I  E  +++   D     VI L+E YET SE+IL+ E+A GG +++  + +      +  ++ ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  LK     ++++GTP+Y+APEI++Y+ I+   DMWS+GVL Y + TG+SPF+G+ K ET +N+S++ +S+    FD    S   D I +L VK P  R ++     H W 
Sbjct:   43 LTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDN--PWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAV-DFIRTLLVKKPEDRATAEECLKHPWL 321          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17A (serine/threonine kinase 17a [Source:HGNC Symbol;Acc:HGNC:11395])

HSP 1 Score: 181.8 bits (460), Expect = 6.226e-50
Identity = 101/282 (35.82%), Postives = 164/282 (58.16%), Query Frame = 3
Query:  144 LNEIDEFEKRHDWRKNYIVKP-KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            L EI    +   ++  Y + P +E+GRG F+ V +   K   K FAAK +R+++ G D   +I  E  +++   D     VI L+E YET SE+IL+ E+A GG +++  + +      +  ++ ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  LK     ++++GTP+Y+APEI++Y+ I+   DMWS+GVL Y + TG+SPF+G+ K ET +N+S++ +S+    FD    S   D I +L VK P  R ++     H W 
Sbjct:   43 LTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDN--PWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAV-DFIRTLLVKKPEDRATAEECLKHPWL 321          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK2 (death associated protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:2675])

HSP 1 Score: 171.785 bits (434), Expect = 9.757e-47
Identity = 97/266 (36.47%), Postives = 151/266 (56.77%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRKKG-----GIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +IG    S  F +  K REKS    +AAK I++++      G+ R ++I RE  I++++       VI L++ YE  ++V+LI E   GG L++ + +    L++      I +IL  +  +H + I H D+K +NI+L +   P  +I + DFGLA E++ G+ +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N++ V   F   F +      KD I  L VK    RL+   A  H W
Sbjct:   24 DIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSR-EEIEREVSILRQVLHHN---VITLHDVYENRTDVVLILELVSGGELFDFLAQ-KESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW 284          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 165.236 bits (417), Expect = 8.231e-42
Identity = 91/261 (34.87%), Postives = 149/261 (57.09%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIR----REAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            E+G G F+ V +V  +   + +AAK I++++    R    R    RE  +++K+     S V++L+  YET S+VI++ E   GG L++ +      L++      I +IL A+  +H  +IVHLDIK +N++L++    S I I DFGL+ E++ G   KD+VGTP+++APE++NYE ++   DMW+VGV+ Y L +G SPF+G  +DET  N+++V+  F   +      + KD I  L V+    R +      H W 
Sbjct:   33 ELGSGQFAVVRRVRDRKTGEKYAAKFIKKRRYATSRRGVTRQNIEREVRVLQKIRGN--SNVVELHAVYETASDVIIVLELVSGGELFDHVCA-KECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQ-RGDSQIKIIDFGLSREIEPGAVVKDMVGTPEFVAPEVVNYEALSPATDMWAVGVVTYILLSGGSPFLGDNRDETFSNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWI 289          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 160.614 bits (405), Expect = 3.872e-40
Identity = 94/275 (34.18%), Postives = 156/275 (56.73%), Query Frame = 3
Query:  174 HDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEI--IKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN----TKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            +D +  YI+  +E+G+G +  V++ T K   K++AAK+++ + G       +++E  I  I  +N      ++ L+E ++  +E+ LI EF  GG L+  I E    +++  ++  +++IL  +  MH   IVHLD+K +NILL+    S+ + I DFGLA +L    + K L GTP++ APE++NY+ +  + DMW+VGV+ Y L +GLSPF+G + ++TL NVS         FD+P + +     KD I  L +K    R+S   A  H W 
Sbjct: 5224 NDLQAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPG-------VKKENVIHEISMMNQLHHEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKN-SNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWD----FDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWI 5485          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 160.614 bits (405), Expect = 3.872e-40
Identity = 94/275 (34.18%), Postives = 156/275 (56.73%), Query Frame = 3
Query:  174 HDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEI--IKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN----TKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            +D +  YI+  +E+G+G +  V++ T K   K++AAK+++ + G       +++E  I  I  +N      ++ L+E ++  +E+ LI EF  GG L+  I E    +++  ++  +++IL  +  MH   IVHLD+K +NILL+    S+ + I DFGLA +L    + K L GTP++ APE++NY+ +  + DMW+VGV+ Y L +GLSPF+G + ++TL NVS         FD+P + +     KD I  L +K    R+S   A  H W 
Sbjct: 5224 NDLQAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPG-------VKKENVIHEISMMNQLHHEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKN-SNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWD----FDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWI 5485          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 160.614 bits (405), Expect = 3.942e-40
Identity = 94/275 (34.18%), Postives = 156/275 (56.73%), Query Frame = 3
Query:  174 HDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEI--IKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN----TKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            +D +  YI+  +E+G+G +  V++ T K   K++AAK+++ + G       +++E  I  I  +N      ++ L+E ++  +E+ LI EF  GG L+  I E    +++  ++  +++IL  +  MH   IVHLD+K +NILL+    S+ + I DFGLA +L    + K L GTP++ APE++NY+ +  + DMW+VGV+ Y L +GLSPF+G + ++TL NVS         FD+P + +     KD I  L +K    R+S   A  H W 
Sbjct: 5224 NDLQAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPG-------VKKENVIHEISMMNQLHHEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKN-SNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWD----FDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWI 5485          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 160.614 bits (405), Expect = 3.942e-40
Identity = 94/275 (34.18%), Postives = 156/275 (56.73%), Query Frame = 3
Query:  174 HDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEI--IKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN----TKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            +D +  YI+  +E+G+G +  V++ T K   K++AAK+++ + G       +++E  I  I  +N      ++ L+E ++  +E+ LI EF  GG L+  I E    +++  ++  +++IL  +  MH   IVHLD+K +NILL+    S+ + I DFGLA +L    + K L GTP++ APE++NY+ +  + DMW+VGV+ Y L +GLSPF+G + ++TL NVS         FD+P + +     KD I  L +K    R+S   A  H W 
Sbjct: 5224 NDLQAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPG-------VKKENVIHEISMMNQLHHEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKN-SNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWD----FDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWI 5485          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sqa (gene:FBgn0259678 transcript:FBtr0299929)

HSP 1 Score: 150.599 bits (379), Expect = 7.281e-39
Identity = 94/270 (34.81%), Postives = 139/270 (51.48%), Query Frame = 3
Query:  177 DWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDK--IRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            D  K+Y V   E+GRG F  V++   K      AAK +   K    R DK  + RE EI+  L    I   IQLY  YE    + ++ E   GG L++ + +    L +   +  I ++ +A+  +H   IVHLD+K +NIL+      + I I DFGLA +       + L GTP+++APE++N++ I++  DMWSVGV+ Y L +GLSPFMG    ET+ NV+  K  F     N       D I+ L  K    R++++    HKW 
Sbjct:   29 DAHKHYDVL-GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK----REDKRNVEREVEIMNSLQHHLI---IQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0301020)

HSP 1 Score: 153.295 bits (386), Expect = 1.566e-38
Identity = 86/267 (32.21%), Postives = 145/267 (54.31%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHP--LFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDD 986
            Y V+     RG F+ V +   K     FAAK ++R++       +I+ E  ++     +    ++ L   +ET S+  L+ E A GG L  +++     L +   +  + ++LKAL+ +H  +I HLD+K  NILL        + +CDFG++  + +G+N +++ GTPDY+APE++ YE ++   D+WSVGVL Y L +G SPF G TK ET +N+S+  ++F P  LF          +  +L +K P  R++++   +H W  D
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVLMLCEGE--DNIVNLNAVHETRSDTALLLELATGGELQTILDN-EECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTF-PDNLFGGVSPVAIDFIRRALRIK-PNDRMNATGCLDHIWLKD 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0301021)

HSP 1 Score: 153.295 bits (386), Expect = 1.566e-38
Identity = 86/267 (32.21%), Postives = 145/267 (54.31%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHP--LFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDD 986
            Y V+     RG F+ V +   K     FAAK ++R++       +I+ E  ++     +    ++ L   +ET S+  L+ E A GG L  +++     L +   +  + ++LKAL+ +H  +I HLD+K  NILL        + +CDFG++  + +G+N +++ GTPDY+APE++ YE ++   D+WSVGVL Y L +G SPF G TK ET +N+S+  ++F P  LF          +  +L +K P  R++++   +H W  D
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVLMLCEGE--DNIVNLNAVHETRSDTALLLELATGGELQTILDN-EECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTF-PDNLFGGVSPVAIDFIRRALRIK-PNDRMNATGCLDHIWLKD 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0340295)

HSP 1 Score: 153.295 bits (386), Expect = 1.566e-38
Identity = 86/267 (32.21%), Postives = 145/267 (54.31%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHP--LFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDD 986
            Y V+     RG F+ V +   K     FAAK ++R++       +I+ E  ++     +    ++ L   +ET S+  L+ E A GG L  +++     L +   +  + ++LKAL+ +H  +I HLD+K  NILL        + +CDFG++  + +G+N +++ GTPDY+APE++ YE ++   D+WSVGVL Y L +G SPF G TK ET +N+S+  ++F P  LF          +  +L +K P  R++++   +H W  D
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVLMLCEGE--DNIVNLNAVHETRSDTALLLELATGGELQTILDN-EECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTF-PDNLFGGVSPVAIDFIRRALRIK-PNDRMNATGCLDHIWLKD 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sqa (gene:FBgn0259678 transcript:FBtr0310326)

HSP 1 Score: 152.14 bits (383), Expect = 8.302e-38
Identity = 94/270 (34.81%), Postives = 139/270 (51.48%), Query Frame = 3
Query:  177 DWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDK--IRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            D  K+Y V   E+GRG F  V++   K      AAK +   K    R DK  + RE EI+  L    I   IQLY  YE    + ++ E   GG L++ + +    L +   +  I ++ +A+  +H   IVHLD+K +NIL+      + I I DFGLA +       + L GTP+++APE++N++ I++  DMWSVGV+ Y L +GLSPFMG    ET+ NV+  K  F     N       D I+ L  K    R++++    HKW 
Sbjct:   29 DAHKHYDVL-GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK----REDKRNVEREVEIMNSLQHHLI---IQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17a (serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-GENE-030131-5556])

HSP 1 Score: 182.956 bits (463), Expect = 6.037e-51
Identity = 97/275 (35.27%), Postives = 161/275 (58.55%), Query Frame = 3
Query:  162 FEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            F +R+D     ++  KE+GRG F+ V +   K+  K FAAK +R+++ G D   +I  E  +++         V+ L+E YE  SE++L+ E+A GG ++N  + +      +  +K ++ +IL+ +  +H  N+VHLD+K  NILL    P  +I I DFGL+  L      ++++GTP+Y+APE++NYE I+   DMWS+GVL+Y + TG+SPF+G  K ET +N+S++ +S+     +  D S  +  I SL +K P  R ++     H+W 
Sbjct:   39 FTERYD-----VIPGKELGRGKFAVVRKCVEKSSGKEFAAKYMRKRRKGQDCRTEIIHEIAVLELA--AACPRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDEAFTEQEVKRLMKQILEGVSFLHNNNVVHLDLKPQNILLTSESPLGDIKIVDFGLSRLLSNSHEVREIMGTPEYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEQLDGSAIR-FIKSLLIKEPENRATAEDCLKHQWL 305          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17al (serine/threonine kinase 17a like [Source:ZFIN;Acc:ZDB-GENE-061103-427])

HSP 1 Score: 177.178 bits (448), Expect = 5.179e-49
Identity = 100/278 (35.97%), Postives = 155/278 (55.76%), Query Frame = 3
Query:  180 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDL----ISSLCVKLPGLRLSSSTAQNHKW--FDDIH 992
            ++ NY +  +E+GRG F+ V +   KT  K  AAK +R+++ G D    I  E  +++  + +    V+ L+E YET SE+IL+ E A GG ++N  + +      +  +  +  +IL  + C+H  NIVHLD+K  NILL    P  +I I DFGL+  +      ++++GTP+Y+APEI++YE I+   DMWS+GVL Y + TG SPF+G  K ET +N+S+V +     +    +    DL    I SL +K P  R +     NH W   D +H
Sbjct:   20 FKNNYDLVGRELGRGKFAVVKKCVEKTTGKEHAAKFLRKRRKGQDCRGDILNEIAVLE--SAEANPYVVGLHEVYETTSEIILVLECAAGGEIFNQCVADNDEAFTEKDVIRLARQILMGVSCLHQNNIVHLDLKPQNILLTSAQPLGDIRIVDFGLSRRVDSVSEVREILGTPEYVAPEILDYEPISTATDMWSIGVLTYVMLTGESPFLGEEKQETFLNISQVNVD----YSQDVFQGISDLAVNFIQSLLIKNPRKRSTVEQCLNHSWLRLDSLH 291          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 172.94 bits (437), Expect = 1.937e-47
Identity = 102/261 (39.08%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGID-RLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN--LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            KE+GRG F+ V +   KT  K FAAK I++++ G D R D I   A +    N+     V+ L   YET  +++L+ EFA GG ++N  + +E    L +  I  +I ++L+ +  +H  ++VHLD+K  NILL    P  +I I DFGLA  L      ++++GTP+Y+APEI+NYE IT   D+WSVGV+ Y L TG SPF G  K ET +NVS+V + +     +       D I  L VK P  R S++    H W 
Sbjct:   36 KELGRGKFAVVKRCVEKTTGKVFAAKFIKKRRRGRDCRADVIHEIAVLEAAKNNPR---VVNLNAVYETDYDLVLMLEFAAGGEIFNHCVSDEL---LPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGDIKIVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLLVKAPEDRPSAADCMTHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 172.94 bits (437), Expect = 1.937e-47
Identity = 102/261 (39.08%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGID-RLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN--LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            KE+GRG F+ V +   KT  K FAAK I++++ G D R D I   A +    N+     V+ L   YET  +++L+ EFA GG ++N  + +E    L +  I  +I ++L+ +  +H  ++VHLD+K  NILL    P  +I I DFGLA  L      ++++GTP+Y+APEI+NYE IT   D+WSVGV+ Y L TG SPF G  K ET +NVS+V + +     +       D I  L VK P  R S++    H W 
Sbjct:   36 KELGRGKFAVVKRCVEKTTGKVFAAKFIKKRRRGRDCRADVIHEIAVLEAAKNNPR---VVNLNAVYETDYDLVLMLEFAAGGEIFNHCVSDEL---LPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGDIKIVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLLVKAPEDRPSAADCMTHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: si:dkey-240h12.4 (si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-406])

HSP 1 Score: 171.785 bits (434), Expect = 5.147e-47
Identity = 95/260 (36.54%), Postives = 144/260 (55.38%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLD----KIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPY-PSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +G G F +V +V  +     +A K ++ KKG   RL      + +E EI++ L  + I A+    + +E+ +E++LI E   GG L++ I E    L +      + +IL+ +  MH +N+ H D+K +NI+L + + P  +I I DFG+A    +G  YK L GTP Y+APEIINYE +   ADMWS+GV+ Y L +GLSPF G T +ETL N+  +   F P F +   +  KD I  L VK    R+++     H W
Sbjct:   19 LGSGHFGQVREVRERATGVLWAGKFLKLKKGAGSRLGLERKSVEKEVEILQSLQHQNIMAI---RDVFESRAEIVLIVELIKGGELFDFIAE-KENLTETEAIEFMKQILEGVNYMHQKNVAHFDLKPENIMLSDKHDPHPDIKIIDFGMAHHFIQGEEYKSLGGTPQYIAPEIINYEPLGTAADMWSIGVITYILLSGLSPFQGETDEETLRNIVSMNYEFEPHFFSQTTNMAKDFIQKLLVKDQSERMTAEECLIHPW 274          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:Xenbase;Acc:XB-GENE-480800])

HSP 1 Score: 177.563 bits (449), Expect = 2.375e-48
Identity = 96/266 (36.09%), Postives = 154/266 (57.89%), Query Frame = 3
Query:  192 YIVKP-KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHP-LFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            Y + P  E+GRG F+ V +   K   K FAAK +R+++ G D   +I  E  +++         VI+L+E YET +E+IL+ E+A GG ++N  + E      +  ++ ++ +ILK +  +H  N+VHLD+K  N+LL    P  +I + DFGL+  L      ++++GTP+Y+APEI++YE I+   DMWSVGVL Y + TG SPF+G  K +T +N+S++ +++    FD    S   D I +L ++ P  R S+     H W 
Sbjct:   53 YSISPGHELGRGKFAVVRKCVEKETGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELARGSPW--VIKLHEVYETATEMILVLEYAAGGEIFNQCVAEREEAFKEKDVRRLMRQILKGVAFLHRHNVVHLDLKPQNVLLTSACPLGDIKVVDFGLSRILNNNEELREIMGTPEYVAPEILSYEPISTATDMWSVGVLAYVMLTGTSPFLGDDKQQTFLNISQLNVTYSSEEFDGISDSAI-DFIKALLIRKPEARSSAVDCLQHPWL 315          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: ENSXETT00000029423.1 (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:101732252])

HSP 1 Score: 174.481 bits (441), Expect = 5.918e-48
Identity = 95/270 (35.19%), Postives = 154/270 (57.04%), Query Frame = 3
Query:  189 NYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLY-NLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTK----DLISSLCVKLPGLRLSSSTAQNHKWFD 983
            +Y +  KE+GRG F+ V +    +  K +AAK +R+++ G D    I  E  I++    +    V+ L+E YET SE++L+ E+A GG ++   + +      +  +  +I +IL+ +  +H  N+VHLD+K  NILL    P  +I I DFGL+ ++      ++++GTP+Y+APE+++YE I+   DMWSVGVL Y + TG+SPF+G TK ET +N+S+V +     +   D+        D I SL VK P  R+ +     H W +
Sbjct:   22 SYRLVGKELGRGKFAVVRKCVELSSGKEYAAKFLRKRRKGEDCRSDIINEIAILEM--ARLSPYVVDLHEVYETNSEIVLVMEYAAGGEIFEQCVADQDEAFTEKDVVRLISQILQGVLHLHRSNVVHLDLKPQNILLTSSSPLGDIRIVDFGLSRQVDAIKEIREILGTPEYVAPEVLSYEPISTATDMWSVGVLTYVMLTGVSPFLGDTKQETFLNISQVNIQ----YSQEDFQGISEPAIDFIKSLLVKNPRKRIRADQCLKHPWLN 285          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: dapk3 (death-associated protein kinase 3 [Source:NCBI gene;Acc:549766])

HSP 1 Score: 174.481 bits (441), Expect = 6.020e-47
Identity = 100/281 (35.59%), Postives = 159/281 (56.58%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNI-LLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNT----KDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEY 1010
            E+G    S  F +  K RE+S    +AAK I++++      G+ R ++I RE +I++++    I   I L++ +E  ++V+LI E   GG L++ + +    L++      + +IL  +  +H +NI H D+K +NI LL    PS  I + DFG+A +++ G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V       FD   +SNT    KD I  L VK P  R++   +  H W   I   N+ +
Sbjct:   14 EMGEELGSGQFAIVRKCRERSTGVEYAAKFIKKRRLSSSRRGVSR-EEIEREVDILREIQHPNI---ITLHDVFENRTDVVLILELVSGGELFDFLAQ-KESLSEEEATMFLKQILDGVHYLHHKNIAHFDLKPENIMLLDHSSPSPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLTNISGVNYD----FDEEYFSNTSELAKDFIRRLLVKDPKKRMTIDQSLEHSWIKAIKRRNVRH 285          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:100144678])

HSP 1 Score: 169.088 bits (427), Expect = 3.719e-46
Identity = 101/266 (37.97%), Postives = 147/266 (55.26%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRKKG-----GIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +IG    S  F V  K +EKS    +AAK I++++      G+ R D I RE  I+K++       VI L+E YE  ++VILI E   GG L++ + E    L +      I +IL  +  +H  +I H D+K +NI+L +   P+  I I DFGLA  +  G  +K++ GTP+++APEI+NYE +   +DMWS+GV+ Y L +G SPF+G TK ETL N+S V   F   F +      KD I  L VK P  R++   +  H W
Sbjct:   14 DIGEELGSGQFAVVKKCQEKSTGVHYAAKFIKKRRTKSSRRGVTRED-IEREVSILKEIQHPN---VITLHEVYENKADVILILELVAGGELFDFLAE-KESLTEEEATEFIKQILNGVNYLHSLHIAHFDLKPENIMLLDRNAPNPRIKIIDFGLAHRIDSGNEFKNIFGTPEFVAPEIVNYEPLGLESDMWSIGVITYILLSGASPFLGETKQETLANISAVSYDFEEEFFSSTSDLAKDFIRRLLVKDPKKRMTIQDSLCHPW 274          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: c7orf26 (chromosome 7 open reading frame 26 [Source:Xenbase;Acc:XB-GENE-5734232])

HSP 1 Score: 164.081 bits (414), Expect = 4.921e-44
Identity = 96/263 (36.50%), Postives = 147/263 (55.89%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS--FAAKVIRRKKGGIDRLDKIR----REAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNI-LLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            E+G G F+ V +  C+ R+    +AAK I++++    R   IR    RE +I+K +  + I   I L + YE  ++V+LI E   GG L++ + +    L++      I +IL+ +  +H   I H D+K +NI LL +  P  +I + DFGLA  ++ G+ +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G  K ETL N++ V   F   F +      KD I  L VK    RLS   A  H W
Sbjct:   23 ELGSGQFAIVKR--CRERKTGVEYAAKFIKKRQSPASRRGVIRGEIEREVDILKDIQHQNI---ITLQDVYENKTDVVLILELVSGGELFDFLAQ-KESLSEEEATRFIKQILEGVNYLHTRKIAHFDLKPENIMLLDKTIPMPHIKLIDFGLAHTIEDGVEFKNIFGTPEFVAPEIVNYEPLGLAADMWSIGVITYILLSGASPFLGENKQETLSNITAVNYEFDEEFFSHTSELAKDFIRKLLVKDTRKRLSIQEALRHPW 279          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:MGI Symbol;Acc:MGI:2138162])

HSP 1 Score: 188.348 bits (477), Expect = 7.090e-53
Identity = 96/275 (34.91%), Postives = 163/275 (59.27%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            Y + PKE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    ++   VI L+E YE  +E+IL+ E+A GG ++NL + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++ +  +H W     + ++ +P
Sbjct:   32 YTLTPKELGRGKFAVVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLELA--RSCPHVINLHEVYENATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHP 304          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk2 (death-associated protein kinase 2 [Source:MGI Symbol;Acc:MGI:1341297])

HSP 1 Score: 170.244 bits (430), Expect = 2.481e-46
Identity = 96/265 (36.23%), Postives = 149/265 (56.23%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRKKGGIDRL----DKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +IG    S  F +  K REKS    +AAK I++++    R     ++I RE  I++++    I   I L++ YE  ++V+LI E   GG L++ + +    L++      I +IL  +  +H + I H D+K +NI+L +   P  +I + DFGLA E++ G+ +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N++ V   F   F +      KD I  L VK    RL+   A  H W
Sbjct:   24 DIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIEREVSILRQVLHPNI---ITLHDVYENRTDVVLILELVSGGELFDFLAQ-KESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW 284          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk2 (death-associated protein kinase 2 [Source:MGI Symbol;Acc:MGI:1341297])

HSP 1 Score: 171.014 bits (432), Expect = 1.426e-45
Identity = 96/265 (36.23%), Postives = 149/265 (56.23%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRKKGGIDRL----DKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +IG    S  F +  K REKS    +AAK I++++    R     ++I RE  I++++    I   I L++ YE  ++V+LI E   GG L++ + +    L++      I +IL  +  +H + I H D+K +NI+L +   P  +I + DFGLA E++ G+ +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N++ V   F   F +      KD I  L VK    RL+   A  H W
Sbjct:   24 DIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIEREVSILRQVLHPNI---ITLHDVYENRTDVVLILELVSGGELFDFLAQ-KESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW 284          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 166.777 bits (421), Expect = 2.283e-44
Identity = 90/263 (34.22%), Postives = 151/263 (57.41%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSS-NIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +E+G G F+ V +   K     +AAK I++++      G+ R ++I RE  I++++    I   I L++ +E  ++V+LI E   GG L++ + E    L ++     + +IL  +  +H + I H D+K +NI+L + + +S  I + DFG+A  ++ G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V   F   + +      KD I  L VK P  R++ + +  H W
Sbjct:   17 EELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSR-EEIEREVSILREIRHPNI---ITLHDVFENKTDVVLILELVSGGELFDFLAE-KESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSW 274          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 166.777 bits (421), Expect = 2.283e-44
Identity = 90/263 (34.22%), Postives = 151/263 (57.41%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSS-NIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            +E+G G F+ V +   K     +AAK I++++      G+ R ++I RE  I++++    I   I L++ +E  ++V+LI E   GG L++ + E    L ++     + +IL  +  +H + I H D+K +NI+L + + +S  I + DFG+A  ++ G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V   F   + +      KD I  L VK P  R++ + +  H W
Sbjct:   17 EELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSR-EEIEREVSILREIRHPNI---ITLHDVFENKTDVVLILELVSGGELFDFLAE-KESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSW 274          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q91XS8|ST17B_RAT (Serine/threonine-protein kinase 17B OS=Rattus norvegicus OX=10116 GN=Stk17b PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.613e-53
Identity = 97/275 (35.27%), Postives = 164/275 (59.64%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            Y + PKE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    ++   VI L+E YET +E+IL+ E+A GG ++NL + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++ +  +H W     + ++ +P
Sbjct:   32 YTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELA--RSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHP 304          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8BG48|ST17B_MOUSE (Serine/threonine-protein kinase 17B OS=Mus musculus OX=10090 GN=Stk17b PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 4.959e-52
Identity = 96/275 (34.91%), Postives = 163/275 (59.27%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            Y + PKE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    ++   VI L+E YE  +E+IL+ E+A GG ++NL + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++ +  +H W     + ++ +P
Sbjct:   32 YTLTPKELGRGKFAVVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLELA--RSCPHVINLHEVYENATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHP 304          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O94768|ST17B_HUMAN (Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 7.496e-52
Identity = 99/275 (36.00%), Postives = 162/275 (58.91%), Query Frame = 3
Query:  192 YIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNL-IEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYP 1013
            YI+  KE+GRG F+ V Q   K+  + +AAK +++++ G D   +I  E  +++    K+   VI L+E YE  SE+ILI E+A GG +++L + E    +++N +  +I +IL+ +  +H  NIVHLD+K  NILL   YP  +I I DFG++ ++      ++++GTP+Y+APEI+NY+ IT   DMW++G++ Y L T  SPF+G    ET +N+S+V + +     +       D I SL VK P  R ++    +H W     + N+ +P
Sbjct:   32 YILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELA--KSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHP 304          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9UEE5|ST17A_HUMAN (Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 2.990e-49
Identity = 101/282 (35.82%), Postives = 164/282 (58.16%), Query Frame = 3
Query:  144 LNEIDEFEKRHDWRKNYIVKP-KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            L EI    +   ++  Y + P +E+GRG F+ V +   K   K FAAK +R+++ G D   +I  E  +++   D     VI L+E YET SE+IL+ E+A GG +++  + +      +  ++ ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  LK     ++++GTP+Y+APEI++Y+ I+   DMWS+GVL Y + TG+SPF+G+ K ET +N+S++ +S+    FD    S   D I +L VK P  R ++     H W 
Sbjct:   43 LTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDN--PWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAV-DFIRTLLVKKPEDRATAEECLKHPWL 321          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9GM70|ST17A_RABIT (Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus OX=9986 GN=STK17A PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.216e-49
Identity = 101/282 (35.82%), Postives = 162/282 (57.45%), Query Frame = 3
Query:  144 LNEIDEFEKRHDWRKNYIVKP-KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            L EI    +   ++  Y + P +E+GRG F+ V +   K   K FAAK +R+++ G D   +I  E  +++   D     VI L+E YET SE+IL+ E+A GG + +  + +     N+  ++ ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  +K     ++++GTP+Y+APEI++Y+ I+   DMWS+GVL Y + TG+SPF+G  K ET +N+S++ +S+    FD    S   D I  L VK P  R ++     H W 
Sbjct:   26 LTEIRTAIRTEPFQDCYSLSPGRELGRGKFAVVRKCIQKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDN--PWVINLHEVYETSSEMILVLEYAAGGEISDQCVADRDEAFNEKDVQRLMRQILEGVHFLHTHDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRIVKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGDNKQETFLNISQMNLSYSEEEFDTVSESAV-DFIKKLLVKKPEDRATAEECLKHPWL 304          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A504Z2A4 (Serine/threonine kinase OS=Fasciola gigantica OX=46835 GN=FGIG_02050 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.515e-57
Identity = 111/272 (40.81%), Postives = 161/272 (59.19%), Query Frame = 3
Query:  165 EKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            E + D+   Y  K  EIGRG F+KV +V  +   +SFAAKVIRR + G D L  + RE  I +     +   V Q+ + +    EVILI E A+GG LY+L+ +    L  ++++  ++++L+A+  +H  ++VHLD+K +NILLR P P  ++ +CDFGLA  L+ G   +DLVGTPDY APEI++Y  I  N D+WSVG + YYL TG+SPF   TK++T  NV   ++S+             + I  L VK P LR S++   N  WF
Sbjct:   22 EGQEDFSSKYTFK-SEIGRGRFAKVNRVVNRNSNESFAAKVIRRWRNGRDTLQNVMREIRIAQICC--SCDRVAQIRDYHIGQREVILIFEHAVGGDLYHLVNDSDLNLPVDFVQSAVFQLLRAVSFLHSHSVVHLDVKPENILLRRPLPDCDVVLCDFGLAKFLENGCLVRDLVGTPDYAAPEILDYNPIHLNTDIWSVGAVTYYLLTGISPFWAPTKEQTFENVCLQRISYPEDLFGEVPREAVEFIRKLLVKNPRLRPSAADCLNDPWF 290          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4E0RZ56 (Serine/threonine kinase OS=Fasciola hepatica OX=6192 GN=D915_004404 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.215e-57
Identity = 113/272 (41.54%), Postives = 159/272 (58.46%), Query Frame = 3
Query:  165 EKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            E + D+   Y  K  EIGRG F+KV +V  +   +SFAAKVIRR + G D L  + RE  I +        A I+ Y   E   EVILI E A+GG LY+L+ +    L  ++++  ++++L+A+  +H  ++VHLD+K +NILLR P P  ++ +CDFGLA  L  G   +DLVGTPDY APEI++Y  I  N D+WSVG + YYL TG+SPF   TK++T  NV   ++S+             + I  L VK P LR S++   N  WF
Sbjct:   22 EGQEDFSSKYTFK-SEIGRGRFAKVNRVVNRNSNESFAAKVIRRWRNGKDTLQNVMREIRIAQICCSCDRVAQIRDYHIGE--REVILIFEHAVGGDLYHLVNDSDLNLPVDFVQSAVFQLLRAVSFLHSHSVVHLDVKPENILLRRPLPDCDVVLCDFGLAKFLDNGCLVRDLVGTPDYAAPEILDYNPIHLNTDIWSVGAVTYYLLTGVSPFWAPTKEQTFENVCLQRISYPEDLFGEVPREAVEFIRKLLVKNPRLRPSAADCLNDPWF 290          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G7YNG0 (Serine/threonine-protein kinase 17A OS=Clonorchis sinensis OX=79923 GN=STK17A PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 8.574e-57
Identity = 110/261 (42.15%), Postives = 161/261 (61.69%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            EIGRG F++V QV  K   ++FAAK+IRR + G D ++ + RE +II++   K    ++ + E Y   ++ ++I E A GG LY++   F    +  ++K  + + L+AL+ +H  +IVHLD+K DNILLR+PYP  +I +CDFGL+  L +    +DLVGTPDY APEI++Y  I    D+WS+GVL YYL TG SPF   TK++T  NVS++ +SF   LF +   +  +  I  + VK P  R S+S      WF DI
Sbjct:   37 EIGRGRFARVCQVRHKRSGETFAAKIIRRWRNGKDTMETLMRELDIIER--GKISRRIVSMKEYYVRATDFVIILEHACGGDLYSMTHYFEINPSVAFVKSAVQQSLEALDFLHERSIVHLDVKPDNILLRQPYPECDIILCDFGLSKFLSQEKVTRDLVGTPDYAAPEILDYNPIHLTTDIWSIGVLTYYLLTGTSPFWAPTKEQTCANVSQLLLSFPDGLFLDIPQAAVR-FIQRILVKNPNDRPSASQCLLDPWFSDI 294          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2LQB3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005630 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.246e-56
Identity = 110/261 (42.15%), Postives = 161/261 (61.69%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            EIGRG F++V QV  K   ++FAAK+IRR + G D ++ + RE +II++   K    ++ + E Y   ++ ++I E A GG LY++   F    +  ++K  + + L+AL+ +H  +IVHLD+K DNILLR+PYP  +I +CDFGL+  L +    +DLVGTPDY APEI++Y  I    D+WS+GVL YYL TG SPF   TK++T  NVS++ +SF   LF +   +  +  I  + VK P  R S+S      WF DI
Sbjct:   37 EIGRGRFARVCQVRHKRSGETFAAKIIRRWRNGKDTIETLMRELDIIER--GKLSRRIVSMNEYYVRATDFVIILEHACGGDLYSMTHYFEINPSVAFVKSAVQQSLEALDFLHERSIVHLDVKPDNILLRQPYPDCDIILCDFGLSKFLSQEKVTRDLVGTPDYAAPEILDYNPIHLTTDIWSIGVLTYYLLTGTSPFWAPTKEQTCANVSQLLLSFPDDLFLDIPQAAVR-FIQRILVKNPNDRPSASQCLLDPWFSDI 294          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A067RRE9 (Protein kinase domain-containing protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_01989 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.823e-52
Identity = 101/254 (39.76%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  222 GFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            G F+ V + T K     +AAK IR+++   D+   I  E  ++K   D   + +++L+E YET +E+ LI E A GG L  +++    GL + ++  V+ +IL+ L  +H  NI HLD+K  N+LL   YP  +I +CDFG++  +K G+  ++++GTPDY+APE++ YE I+   D+WSVGVL Y L +G SPF G+TK ET  N+S+  +SF   LFD    S  KD I +  VK P  RL+S     H W 
Sbjct:    1 GKFAAVRKCTHKETGVEYAAKFIRKRRRATDQRKGILHEVAVLKIAADS--ARIVRLHEVYETSTEMALILELAAGGELQRVLDA-EEGLEEQHVARVMRQILEGLCYLHDNNIAHLDLKPQNLLLTGAYPDCDIKLCDFGISRVIKSGVEVREILGTPDYVAPEVLGYEPISLATDIWSVGVLTYVLLSGYSPFAGNTKQETFCNISQCCLSFPDELFDGVS-SVAKDFIQATLVKDPSKRLTSHQCLEHPWL 250          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17a (serine/threonine kinase 17a [Source:NCBI gene;Acc:103045004])

HSP 1 Score: 179.489 bits (454), Expect = 1.628e-49
Identity = 95/286 (33.22%), Postives = 165/286 (57.69%), Query Frame = 3
Query:  195 IVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISESVALN 1046
            ++  KE+GRG F+ V +   K+  + +AAK +R+++ G D   +I  E  +++     +   V+ L+E YE  SE++L+ EFA GG ++N  + E      +  +K ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  +      ++++GTP+Y+APE++NYE I+   DMWS+GVL Y + TG+SPF+G  K ET +N+S++ +S+     +  D +  +  I SL +K P  R ++     H+W       ++E P    S S +++
Sbjct:   40 LIPGKELGRGKFAVVRKCVEKSTGREYAAKFMRKRRKGQDCRTEIIHEIAVLELA--ASCQRVVNLHEVYELPSEMVLVLEFAAGGEIFNQCVAERDEAFKEEDVKRLLRQILEGVSFLHKRDVVHLDLKPQNILLTSNDPLGDIKIVDFGLSRMVSNNQEIREIMGTPEYVAPEVLNYEPISTATDMWSIGVLAYVMLTGISPFLGDDKQETFLNISQINISYTEEELEQLDKAAIQ-FIKSLLIKEPEGRATAEECLKHQWLQTQEKNSVEEPAMQKSASTSVS 322          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000046763.1 (death-associated protein kinase 3 [Source:NCBI gene;Acc:103038916])

HSP 1 Score: 174.481 bits (441), Expect = 3.877e-47
Identity = 103/289 (35.64%), Postives = 163/289 (56.40%), Query Frame = 3
Query:  180 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKS----FAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNT----KDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINM 1004
            +R+  + K  E+G    S  F +  K REKS    +AAK I++++      G+ R ++I RE  I++++     S +I L++ +E  ++VILI E   GG L++ + E    L +      + +IL  +  +H ++I H D+K +NI+L +   P+  I + DFG+A ++K G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V       FD   +SNT    KD I  L VK P  R++   +  H W   I   N+
Sbjct:    4 FRQEDVEKFYEMGEELGSGQFAIVRKCREKSTGAEYAAKFIKKRRLSSSRRGVSR-EEIEREVNILREIQH---SNIITLHDIFENKTDVILILELVSGGELFDFLAE-KESLTEEEATQFLKQILDGVHYLHSKHIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHQIKAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYD----FDEEYFSNTSELAKDFIRRLLVKDPKKRMTIEDSLEHPWIKVIKRRNV 283          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000037487.1 (death-associated protein kinase 3 [Source:NCBI gene;Acc:103038916])

HSP 1 Score: 174.481 bits (441), Expect = 3.877e-47
Identity = 103/289 (35.64%), Postives = 163/289 (56.40%), Query Frame = 3
Query:  180 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKS----FAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNT----KDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINM 1004
            +R+  + K  E+G    S  F +  K REKS    +AAK I++++      G+ R ++I RE  I++++     S +I L++ +E  ++VILI E   GG L++ + E    L +      + +IL  +  +H ++I H D+K +NI+L +   P+  I + DFG+A ++K G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V       FD   +SNT    KD I  L VK P  R++   +  H W   I   N+
Sbjct:    4 FRQEDVEKFYEMGEELGSGQFAIVRKCREKSTGAEYAAKFIKKRRLSSSRRGVSR-EEIEREVNILREIQH---SNIITLHDIFENKTDVILILELVSGGELFDFLAE-KESLTEEEATQFLKQILDGVHYLHSKHIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHQIKAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYD----FDEEYFSNTSELAKDFIRRLLVKDPKKRMTIEDSLEHPWIKVIKRRNV 283          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17al (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:103021349])

HSP 1 Score: 167.548 bits (423), Expect = 1.424e-45
Identity = 91/261 (34.87%), Postives = 149/261 (57.09%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDD 986
            +E+GRG F+ V +   K   K +AAK +R+++ G    + I  E  +++  + K    V+ L+E YET +E+IL+ E A GG +++  + +      +  +  +  +IL  +  +H +N+VHLD+K  NILL    P  +I I DFGL+  +      +++VGTP+Y+APEI++YEKI+   DMWS+GVL Y + TG SPF+G+   ET +N+S+V + +     +   S   D I SL  K P  R ++     H W ++
Sbjct:   34 RELGRGKFAVVKKCVEKATGKEYAAKFLRKRRKGKSCREDIMNEIAVLE--SAKANQYVVGLHEVYETSNEIILVLECAAGGEIFDQCVGDSDEAFTEKDVIRLARQILTGVAFLHKKNVVHLDLKPQNILLTCTQPLGDIRIVDFGLSRHVNSTSEVREIVGTPEYVAPEILDYEKISTATDMWSIGVLTYVMLTGESPFLGNDNQETYLNISQVNVDYSQDVFHGISSLAVDFIKSLLHKNPADRATAEQCLQHPWLNE 292          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:103028616])

HSP 1 Score: 165.622 bits (418), Expect = 5.809e-45
Identity = 93/263 (35.36%), Postives = 150/263 (57.03%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN--LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDL----ISSLCVKLPGLRLSSSTAQNHKWF 980
            E+GRG F+ V +   K   K FAAK +R+++ G D   ++  E  +++    K+   V+ L+  YET  +++L+ E+A GG ++   + +E    L++  +  +I + L+ +  +H  N+VHLD+K  NILL    P  +I + DFGLA  L      ++++GTP+Y+APEI+NYE IT  +D+WSVGV+ Y L TG SPF G  K +T +NVS+V +     +    ++   +L    I  L VK P  R S++   +H W 
Sbjct:   37 ELGRGKFAVVKKCVEKATGKVFAAKFVRKRRRGRDCKAEVIHEMAVLEA--AKSNPRVVNLHAAYETEHDIVLLLEYAAGGEIFEHCVSDEL---LSEGQVIRLIRQTLEGIHQLHQSNVVHLDLKPQNILLTSLNPLGDIKLVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTASDLWSVGVITYMLITGESPFAGEDKQQTFLNVSQVNVD----YSKEAFARVSELAVHFIRKLLVKAPEDRPSAADCLSHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 169.474 bits (428), Expect = 7.862e-47
Identity = 88/256 (34.38%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  219 RGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHP-LFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            RG F+ V +         FAAK +R+++ G D    +  E  I++    ++   +I L++ +ET +E+IL+ E+A+GG ++N  + E      +  ++ ++ +IL+ +  +H  ++VHLD+K  NILL    P  +I I DFGL+  +      ++++GTP+Y+APE++NYE I+   DMWSVGVL Y + TG SPF+G  K ET +NVS++ +S+ P +F+          I  L VK P  R ++     H W 
Sbjct:    3 RGKFAVVRRCVEVATGIEFAAKFLRKRRKGQDCRADVTHEMAILEAA--RSCPHIIDLHDAFETPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPFLGEDKQETFLNVSQLNVSYEPEVFEGVSVQAVA-FIQQLLVKAPHRRATAEHCLRHPWL 255          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 5.414e-43
Identity = 105/313 (33.55%), Postives = 163/313 (52.08%), Query Frame = 3
Query:  189 NYIVKPKEI-GRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN----TKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISESVALNFLDCEIDTQSNDNLNNYVNDSM 1112
            +Y +K K++ G G F +V +   +T   + AAKVI+ K  G+   D++  E  I+ +L    +   +QLY+ YE+ ++ +LI E+  GG L++ I    + L +      I +I + +  MH + I+HLD+K +NIL       + I I DFGLA   K     K   GTP+++APE++NY+ ++F  DMWS+GV+ Y L +GLSPFMG   +ETL N+  V       FD+  + N     KD IS L +K    R+S+S    H W            L N+SE        C++  +S   L+ Y+   M
Sbjct:   30 SYSIKQKDVLGGGRFGRVHKCVERTSGMTLAAKVIKAK--GVKEKDEVNNEISIMNQLKHNNL---LQLYDAYESKNDFVLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVN-RKGNQIKIIDFGLARRYKPREKLKVHFGTPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWD----FDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNW------------LVNLSERAK----KCKVRLKSQLLLHTYMVRRM 316          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 3.440e-41
Identity = 90/259 (34.75%), Postives = 144/259 (55.60%), Query Frame = 3
Query:  222 GFFSKVFQVTCKTREKSFAAKVIRRKKG-----GIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLRE-PYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGL-RLSSSTAQNHKW 977
            G F+ V +   K     FAAK I++++      G+   D I+RE  I+++L    I   I L+E YE  ++V LI E   GG L++ +      L+++     + +IL  +  +H   I H D+K +NI+L E   P +++ I DFGLA  +  G+ ++ + GTP+++ PEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK+ETL N+S V+  F   +     +  K+ I  L +K P   R++   A +H W
Sbjct:    4 GQFAVVKKCCEKKSGLEFAAKFIKKRRSRSSRRGVVPED-IKREVSILRELRHPNI---ISLHEVYENDTDVTLILELVSGGELFDFLAH-KESLSEDEATEFLKQILDGVSYLHCRRIAHFDLKPENIMLLENRAPKAHVKIIDFGLAQSIVDGVEFRHIFGTPEFVVPEIVNYEPLGVQADMWSIGVMTYILLSGASPFLGDTKEETLSNISAVEYKFDEEYFKQTSALAKNFIQRLLLKSPNRERMNVEEAIHHPW 257          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 147.902 bits (372), Expect = 8.531e-40
Identity = 92/257 (35.80%), Postives = 142/257 (55.25%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVK-LPGLRLSSSTAQNHKWF 980
            +G G F +V +   K+   + AAKVIR K       ++++ E  I+ +LN   +   +QL++ YE+ S++ LI E+  GG L+N I +   GL++      + +I + +  MH + I+HLD+K +NIL    +    I I DFGLA   K     K   GT +++APE++NYE ++F  DMWSVGV+ Y L +GLSPF+G  + ETL N+      F     +    + KD I++L VK     RLS+  A  H+W 
Sbjct:   33 LGGGRFGRVMRCQEKSSGLTLAAKVIRVKSP--KEKEEVKNEINIMNQLNHVNL---VQLFDAYESRSDITLIMEYVEGGELFNRIID-QSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRW-GYQIKIIDFGLARRYKPREKLKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGDDESETLNNIVTSNWEFDGEVFSEVSEDAKDFITNLLVKGKKRWRLSAKGALQHQWL 282          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 151.754 bits (382), Expect = 4.472e-38
Identity = 89/259 (34.36%), Postives = 146/259 (56.37%), Query Frame = 3
Query:  222 GFFSKVFQVTCKTREKSFAAKVIRRKKG------GIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            G F+ V +   KT  + FAAK+IR+ +       G+ R D I RE  +++ L       VI L++ +E+ ++VILI E   GG L++ + +    L++      I +IL  +  +H ++I H D+K    +L E   P+  I + DFGLA  +++G+ ++++ GTP+++APE++NYE +   ADMWS+GV+ Y L +G SPF+G +K ETL N++ VK  F   + +       D I  L VK P  R++     +H W
Sbjct:    2 GHFAVVKRCREKTSGEEFAAKLIRKSRSARSSRRGVVRED-IEREVNVLRGLRHPN---VIALHDVFESKADVILILELVSGGELFDFLAK-KDALSEEEATEFIKQILDGVHYLHSKHIAHFDLKKPFFMLLECNQPNPRIKLIDFGLAHIIEEGIEFRNIFGTPEFVAPEVVNYEPLGLEADMWSIGVITYILLSGASPFLGDSKQETLTNITGVKYEFDEEYFDQTSQLAMDFIRRLLVKDPKKRMTVKDCLSHPW 255          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 134.035 bits (336), Expect = 7.781e-33
Identity = 93/295 (31.53%), Postives = 148/295 (50.17%), Query Frame = 3
Query:  186 KNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHG-LNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFN-------------ADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNIS 1028
            K++ +  + +G+G F+ V +   +T  K+FA K+I ++K  I  +D + RE E+++KLN   I  +   YE  E++    ++ EF  GG L + +    HG + ++  + +  +IL A++ +H   I H D+K DNIL+ +  P   + I DFGLA     G   K   GT  Y+APE+I  +  + +              DMWS+G L+Y + TG  PF GST+D+    + +      PL D       +D I SL    P  R +++ A NH W      I M  PLG+ S
Sbjct:  195 KDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKV-IGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESY---YMVMEFVSGGDLMDFVA--AHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVL-VKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPW------IKMS-PLGSQS 475          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 115.931 bits (289), Expect = 3.286e-28
Identity = 76/263 (28.90%), Postives = 141/263 (53.61%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN-TKDLISS-LCVKLPGLRLSSSTAQNHKWFDDI 989
            + +G G F +V  +      + +A K +  KK  I +L ++    +  + L+  +   +I+++ T++   +V ++ ++  GG L++L+ + +        K    ++  ALE +H ++I++ D+K +NILL +   + +I I DFG A  +   + Y  L GTPDY+APE+++ +    + D WS GVLIY +  G +PF  S   +T  N+   ++ F P F +PD  +  K LI+  L  +L  L+  S   +NH WF+++
Sbjct:   92 RTLGTGSFGRVHLIRSNHNGRFYALKTL--KKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDK---NGHIKITDFGFAKYVPD-VTYT-LCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFF-HPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEV 345          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 114.39 bits (285), Expect = 9.704e-28
Identity = 74/266 (27.82%), Postives = 139/266 (52.26%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCV-----KLPGLRLSSSTAQNHKWFDDI 989
            + +G G F +V  +  +   + +A KV+  KK  + RL ++    +    L+  T   +I+++ T++   ++ +I ++  GG L++L+ + +        K    ++  ALE +H ++I++ D+K +NILL +   + +I I DFG A  +   + Y  L GTPDY+APE+++ +    + D WS G+LIY +  G +PF  S   +T   +   ++ F P F+     + KDL+S L       +L  L+  +   +NH WF ++
Sbjct:   91 RTLGTGSFGRVHLIRSRHNGRYYAMKVL--KKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDK---NGHIKITDFGFAKYVPD-VTYT-LCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFN----EDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEV 344          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 116.316 bits (290), Expect = 3.789e-27
Identity = 75/251 (29.88%), Postives = 137/251 (54.58%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATEL-KKGMNYKDLVGTPDYMAPEIINYEKITFNA--DMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCV-KLPGLRLSS 953
            IGRG F  V++       + +A KV+       D ++ ++RE + +  L  K IS + + Y +Y   + + +I E   GGSL +L+      +++ YI  ++ ++L AL+C+H +N++H DIKA N+L+       N+ +CDFG+A ++ +  +  + + GTP +MAPE+I  E + ++   D+WS+G+  Y ++TG  P+      E L  +  +  S  P  ++  YS +     +LC+ + P  RLS+
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDS-DEVEDVQREIQFLASL--KQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK--IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITN---EGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVI-MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV---EALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSA 267          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 112.079 bits (279), Expect = 4.591e-27
Identity = 73/266 (27.44%), Postives = 141/266 (53.01%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLI---EEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSN--TKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            + +G G F +V  V      + +A KV+++++  + ++ ++    +  + L       +I+++ T++    + ++ ++  GG L++L+   + F + + + Y   VI     ALE +H  NI++ D+K +NILL     + +I I DFG A E++       L GTPDY+APE+I  +    + D WS+GVLIY +  G +PF  +T  +T   + + K+ + P F +PD  +  +K + + L  ++  L+  S   + H WF ++
Sbjct:   74 RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQ--VVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL----ALEYLHAHNIIYRDLKPENILLDR---NGHIKITDFGFAKEVQTVT--WTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYF-HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEV 327          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO37024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH03])

HSP 1 Score: 166.777 bits (421), Expect = 6.653e-47
Identity = 99/263 (37.64%), Postives = 151/263 (57.41%), Query Frame = 3
Query:  219 RGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDK-TISAVIQLYETYETFSEVILICEFAIGGSLYNLI-----EEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLR--EPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            RG ++ V +VT KT    +AAK +R+++ G D   ++  E E++   N     + +IQL+E YET +E+IL+ E A+GG L+        +E     ++  +  ++ +IL+ +  +H +N VHLDIK +NILL   E YP   I I DFGLA  +K G     +VGTP+Y+APEI+ +E +   +D+WS+GVL Y + TG+SPF G  K ET  NVS   + F    FDN  Y+  +D I ++  + PG R +     +H W 
Sbjct:    1 RGQYAVVRRVTHKTTGLEYAAKFVRKRRKGQDCRSEVWHEVEVLWSTNHPYQHTKIIQLHEVYETRTELILVLELALGGDLHRHCVALDSDEPASSRSEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNILLMTDEIYP--EIKIIDFGLARRIKPGEQICLIVGTPEYVAPEILEFEPVGKPSDIWSIGVLAYVMLTGMSPFAGDDKHETCYNVSLCAIDFPESHFDNISYT-AQDFIRTVLQRCPGDRPTVEDCLSHPWL 260          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Z6])

HSP 1 Score: 155.992 bits (393), Expect = 5.297e-43
Identity = 86/246 (34.96%), Postives = 144/246 (58.54%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDR----LDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLP 935
            EIG G F+ V + + K+    FAAK +++++    R    L++I REA +++ +  +    +I L++ YET  E +LI E   GG L+  + E    L ++     + ++++A+E +H  +IVHLDIK +NI+L+      ++ + DFGLA ++ KG   ++++GTP+++APEII++E + F  DMWS+GVL Y + +G SPF+G   +ET  N+S V   F   +        KD I  L +K P
Sbjct:   22 EIGSGQFAVVKKCSEKSSGLEFAAKFMKKRRSKALRRGVTLEQIIREATVLRSVAHQ---GIIYLHDIYETKMEFVLILELLSGGELFEFLSE-QDFLTEDEAVGFLIQVIRAIEYLHDLSIVHLDIKPENIVLKNRTRPLHLKLIDFGLARKISKGEPVREMMGTPEFVAPEIIDFEVVGFPTDMWSIGVLTYIMLSGASPFLGDDNNETFSNISHVDYEFDDEYFKEISQPAKDFIEGLLIKKP 263          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 155.606 bits (392), Expect = 2.459e-42
Identity = 102/270 (37.78%), Postives = 151/270 (55.93%), Query Frame = 3
Query:  186 KNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFS--EVILICEFAIGGSLYNLI--EEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSF-HPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF 980
            K Y +K  E+G+G F  V +   K   K FAAK I+  K   DR D I  E EI+  +  K +   ++L + +ET S  E+IL+ E   GG L+  +  EEF   +++N +   + +IL+ LE MH + ++HLD+K +NI++ +   S  I + DFGLA +     N K + GTP+++APE++ Y++IT   DMWS+GV+ Y L +GLSPFMG    ETL NV   +  F  P+FD+      KD I  L V     R+S +    H W 
Sbjct:   19 KYYTIK-DELGKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQ-DREDVIH-EMEIMNTIRHKRL---LRLADAFETPSQQEMILVMELVTGGELFEKVVEEEF---ISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVK-QDSRQIKLIDFGLARKYNPKENLKVMFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGLSPFMGDNDAETLANVQTAEWDFDDPVFDDIS-DEAKDFIEKLLVLKATARISVAKCMEHPWL 277          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI47])

HSP 1 Score: 146.362 bits (368), Expect = 1.006e-39
Identity = 88/241 (36.51%), Postives = 138/241 (57.26%), Query Frame = 3
Query:  207 KEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVK 929
            +EIG+G +  V +   K   +++AAKV+      + +  +  RE E+++KL       ++ L + Y T  E+++I EF  GG L+  I E  + + ++ I  V +++L AL+ MH  NIVHLD+K +NI+  E   S+ I + DFGLA ELKK    K   GTPD++APE+I  + ++  +DMWS+GV+ Y L +GL PF G    +TL+ V+K +  F     +    + KD I  L VK
Sbjct:   16 EEIGKGAYGIVKKCVDKATGQTYAAKVVTTSNSNLRK--ETMREIEVMRKLGSH--KKLVGLIDAYHTPFEIVMILEFIPGGELFERIIEEDYLMEEDAIYYV-HQVLLALDYMHGNNIVHLDLKPENIMC-ESINSNQIKLVDFGLARELKKDEEVKSSFGTPDFVAPEVIRMKPVSTASDMWSLGVVTYVLLSGLMPFSGDNDHDTLVKVAKAEWDFDDECFDEVSEDAKDFIEGLLVK 250          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H1])

HSP 1 Score: 139.813 bits (351), Expect = 1.725e-37
Identity = 88/241 (36.51%), Postives = 135/241 (56.02%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKVIRRKKG--GIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVK 929
            I RG F  V +VT K     +AAK I+      G  R D + RE +I+ +++ K +   + L + Y+    +++I EF  GG L+  + +    L +      ++++L+ +E +H +N++HLD+K +NI+      S +I + DFGLA E K+G     L GTP++MAPE  N+E I+   DMWSVGV+ Y L +GLSPFMG   +ETL NV+  +  F     +      KD ISSL +K
Sbjct:    4 IVRGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSR-DDVMREIDIMSRMHHKRL---VGLLDAYDANRNIVMIMEFISGGELFERVVD-EDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCVSK-DSWDIKLIDFGLAQEYKEGFKMTALKGTPEFMAPEAANFEPISKATDMWSVGVIAYILLSGLSPFMGDDNNETLSNVNMCEWDFDDESFDVISDQAKDFISSLLIK 238          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk17al (serine/threonine-protein kinase 17A [Source:NCBI gene;Acc:101163818])

HSP 1 Score: 179.104 bits (453), Expect = 1.097e-49
Identity = 103/298 (34.56%), Postives = 168/298 (56.38%), Query Frame = 3
Query:  144 LNEIDEFEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGID-RLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYN-LIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISE 1031
            + EI+   ++  +  NY +  KE+GRG F+ V + T K   K +AAK +R+++ G D R+D I  E  +++  + K    V+ L+E YET SE+IL+ E A GG ++N  + +      +  +  +  +IL  +  +H  N+VHLD+K  NILL    P  +I I DFGL+  +      ++++GTP+Y+APE+++YE I+   DMWS+GVL Y + TG SPF+G  K +T +N+S+V + +         S   D I SL VK P  R ++     H W +   +++M  P  ++ E
Sbjct:    7 VTEINSRIRKEPFSANYELVGKELGRGKFAVVKKCTEKATGKQYAAKFLRKRRKGEDCRMD-IMNEIAVLE--SAKANPYVVALHEVYETTSEIILVLECAAGGEIFNQCVADNDEAFTEKDVIRLAKQILTGVAFLHRNNVVHLDLKPQNILLTCAKPLGDIRIVDFGLSRRMDNVREVREILGTPEYVAPEVLSYEPISTATDMWSIGVLTYVMLTGESPFLGDEKQQTFLNISQVNVDYSQDTFEGISSLAVDFIKSLLVKNPRKRATAEECLRHPWLNSHQHLHMR-PASSLDE 300          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 174.866 bits (442), Expect = 4.905e-48
Identity = 100/264 (37.88%), Postives = 146/264 (55.30%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKV--IRRKKGGIDRLDK--IRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPY-PSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            +G G F +V +V  +    S+A K   IRRK G +  +D+  + RE EI++ L    I   + L + +E+ SE++L+ E   GG L++ I E  + L    I+  + +IL+ L  MH  NI H D+K +NI+L E   P  N+ + DFGLA    +G  YK   GTP Y+APE+I++E ++  ADMWS+GV+ Y L +G+SPF G T +ETL NV  V   F  L+     S  KD I  L VK    R+++     H W   I
Sbjct:   19 LGSGHFGQVKKVRERATGTSWAGKFLKIRRKGGSLLGMDRTSVEREVEILQALKHPNI---VLLKDVFESRSEMVLVLELISGGELFDFIAEKDNLLETEAIQ-FMKQILEGLRFMHSNNIAHFDLKPENIMLSEKVSPQLNVKLIDFGLAYRFHQGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVVAVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTAEECLLHPWIKPI 278          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 174.866 bits (442), Expect = 4.905e-48
Identity = 100/264 (37.88%), Postives = 146/264 (55.30%), Query Frame = 3
Query:  213 IGRGFFSKVFQVTCKTREKSFAAKV--IRRKKGGIDRLDK--IRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPY-PSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            +G G F +V +V  +    S+A K   IRRK G +  +D+  + RE EI++ L    I   + L + +E+ SE++L+ E   GG L++ I E  + L    I+  + +IL+ L  MH  NI H D+K +NI+L E   P  N+ + DFGLA    +G  YK   GTP Y+APE+I++E ++  ADMWS+GV+ Y L +G+SPF G T +ETL NV  V   F  L+     S  KD I  L VK    R+++     H W   I
Sbjct:   19 LGSGHFGQVKKVRERATGTSWAGKFLKIRRKGGSLLGMDRTSVEREVEILQALKHPNI---VLLKDVFESRSEMVLVLELISGGELFDFIAEKDNLLETEAIQ-FMKQILEGLRFMHSNNIAHFDLKPENIMLSEKVSPQLNVKLIDFGLAYRFHQGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVVAVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTAEECLLHPWIKPI 278          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000027698.1 (death associated protein kinase 3 [Source:NCBI gene;Acc:101168492])

HSP 1 Score: 174.481 bits (441), Expect = 4.956e-47
Identity = 106/309 (34.30%), Postives = 169/309 (54.69%), Query Frame = 3
Query:  138 IALNEIDEFEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKS----FAAKVIRRKK-----GGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREP-YPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNT----KDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGN 1022
            +A+  I E      +R+  +    E+G    S  F +  K REKS    +AAK I++++      G+ R ++I RE  I++++     S +I L++ +E  ++VILI E   GG L++ + E    L +      + +IL  ++ +H + I H D+K +NI+L +   P+  I + DFG+A ++K G  +K++ GTP+++APEI+NYE +   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V       FD   +SNT    KD I  L VK P  R++   +  H W   I   N+    G+
Sbjct:    1 MAVTIISEVSSMAGFRQEDVELHYEMGEELGSGQFAIVRKCREKSTGGEYAAKFIKKRRLSSSRRGVSR-EEIEREVNILREIQH---SNIITLHDIFENKTDVILILELVSGGELFDFLAE-KESLTEEEATQFLKQILDGVQYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHQIKAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYD----FDEEYFSNTSELAKDFIRRLLVKDPKKRMTIDDSLEHPWIKVIKRRNVRPEEGD 300          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:101165975])

HSP 1 Score: 166.007 bits (419), Expect = 5.724e-45
Identity = 96/266 (36.09%), Postives = 150/266 (56.39%), Query Frame = 3
Query:  210 EIGRGFFSKVFQVTCKTREKS----FAAKVIRRK-----KGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPS-SNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKW 977
            E+G    S  F V  + +EKS    FAAK I+++     + G+ R ++I RE  I+++L    I A   L++ YE  ++V+LI E   GG L++ + +    L++      I +IL  ++ +H + I H D+K +NI+L +   S   I + DFGLA +++ G ++K++ GTP+++APEI+NYE++   ADMWS+GV+ Y L +G SPF+G TK ETL N+S V   F   F        K  I  L  K    R++   A NH W
Sbjct:   19 EMGEQLGSGQFAVVKRCKEKSSGTEFAAKFIKKRISRASRRGVKR-EEIEREVGILQQLQHPNIVA---LHDVYENRTDVVLIMELVSGGELFDFLAQ-KESLSEEEATQFIKQILDGVQYLHSKRIAHFDLKPENIMLLDRNASLPRIKLIDFGLAHQIEAGADFKNIFGTPEFVAPEIVNYEQLGLEADMWSIGVITYILLSGASPFLGDTKQETLGNISAVNYEFDEDFFGNTSELAKSFIRQLLEKDTRKRMAIEDALNHPW 279          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000035615.1 (SMESG000035615.1)

HSP 1 Score: 1342.41 bits (3473), Expect = 0.000e+0
Identity = 661/685 (96.50%), Postives = 664/685 (96.93%), Query Frame = 3
Query:   81 MIPSKNRYFNGARFKSSSLIALNEIDEFEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISESVALNFLDCEIDTQSNDNLNNYVNDSMNIKRSQSVDLWSVDMNSKFPLENPHSTFLATSDEVFIDNNDTISNSCENIDTAINNNNTPAPKRTLMNVDEVADETWYENKGKSPICEMEATNGKSNINYHCEYNSNPEIITQNIELQPNNVNNQLTNPISESHESSNETIQTNSDDIVSGISKEIIIRNLENIGFNNIGNGDYKHDQNSQLKCSEIEINPNHDSQQLIKSDLLTNCDQNDNKNVDNNIVSEISIDIIPCQVENRLENGDDKYDQNIQLKLSQINLDLPFDSQQSSKSDSLTGCNLKHKYLLSDPIDEYENISDSCDSKIILHPPEIQRNISTNSDYDEDDDFRYPSLLAHFRIYELCILM 2135
            MIPSKNRYFNGARFKSSSLIALNEIDEFEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISESVALNFLDCEIDTQSNDNLNNYVNDSMNIKRSQSVDLWSVDMNSKFPLENPHSTFLATSDEVFIDNNDTISNSCENIDTAINNNNTPAPKRTLMNVDEVADETWYENKGKSPICEMEATNGKSNINYHCEYNSNPEI+TQNIELQPNNVNNQLTNPISESHESSNETIQTNSDDI+SGISKEIIIRNLENIGFNNIGNGDYKHDQNSQLKCSEIEINPNHDSQQLIKSDLLTNCDQNDNKNVDNNIVSEISIDIIPCQVENRLENGDDKYDQNIQLKLSQINLDLPFDSQQS                     +EYENISDSCDSKIILHPPEIQRNISTNSDYDEDDDFRYPSLLAHFRIYELCILM
Sbjct:    1 MIPSKNRYFNGARFKSSSLIALNEIDEFEKRHDWRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISESVALNFLDCEIDTQSNDNLNNYVNDSMNIKRSQSVDLWSVDMNSKFPLENPHSTFLATSDEVFIDNNDTISNSCENIDTAINNNNTPAPKRTLMNVDEVADETWYENKGKSPICEMEATNGKSNINYHCEYNSNPEIVTQNIELQPNNVNNQLTNPISESHESSNETIQTNSDDIISGISKEIIIRNLENIGFNNIGNGDYKHDQNSQLKCSEIEINPNHDSQQLIKSDLLTNCDQNDNKNVDNNIVSEISIDIIPCQVENRLENGDDKYDQNIQLKLSQINLDLPFDSQQS---------------------NEYENISDSCDSKIILHPPEIQRNISTNSDYDEDDDFRYPSLLAHFRIYELCILM 664          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000061289.1 (SMESG000061289.1)

HSP 1 Score: 281.182 bits (718), Expect = 7.626e-84
Identity = 160/414 (38.65%), Postives = 236/414 (57.00%), Query Frame = 3
Query:   93 KNRYFNGARFKSSSLIALNEIDEFEKRHD-------WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISES-----VALNFLDCEIDTQSNDN--LNNYVNDSMNIK----RSQSV----DLWSVDMNSKFPLEN-PHSTFLATSDEVFIDNNDTISNSCENID 1265
            +NR    ++ KSSSL  LN+I  F    +       WR +Y   P  +GRG FSKV++  C +  K  A KVIRR++ G+D++D I RE EI++ LN    S  IQL + + + SEV ++ EFA GGS+YN+I E   GL + Y K ++ K++ AL  MH +NIVHLDIKADNILLR PYPS+++A+ DFGLA +L K   +K+++GTPDY+APE+ NY+ I+  +DMWSVGVL Y++ T +SPF   TK+ETL  V+K +  F     N +    +D I  L +K+P  RLS     +H +   +  +  EYP    +E      V    +DC    + N N  +   V    NI+     +Q V    DL   D     P+ N  +++F   +D   ++N   +  +C+N++
Sbjct:    8 RNRANFNSQMKSSSLYFLNDISNFNSTENLTSDVSNWRDSYTFNPVILGRGHFSKVYKAKCTSTGKYVAIKVIRRRRLGVDKIDDIMREIEIMQLLNQSMNSGFIQLLKFHTSVSEVAVLLEFASGGSIYNVIRESETGLPEAYTKIILSKVISALCIMHGQNIVHLDIKADNILLRHPYPSTDVALADFGLARKLSKSKVHKEMIGTPDYIAPEVANYDSISTKSDMWSVGVLTYFILTNISPFFADTKEETLNRVTKTQFEFLGQLKNDNLQAARDFIQKLLIKIPEKRLSVEDCHSHAFLSSVPIV--EYPANPNTEKTVPTIVVAPDIDCAPQVRENTNYKIRALVTSQYNIESFYGSAQLVNTKKDLLEPDHADCLPIVNMSNNSFDTQTDFDNVNNRPILVETCDNVE 419          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000064400.1 (SMESG000064400.1)

HSP 1 Score: 269.626 bits (688), Expect = 8.529e-84
Identity = 141/270 (52.22%), Postives = 189/270 (70.00%), Query Frame = 3
Query:  180 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 989
            WR  Y    KEIGRG FSKV++VT  T  K  A KVIRR++GGIDR+  IR+E +I++ L +K++ +VI+L   +E++ EV L+ E A GG L++++ E  +GL +NY++ +  ++L AL  MH  NIVHLDIKADNILLREPYPS++IA+CDFGLAT+L  G  +++LVGTPDY+APEIINYE+I+   DMWS+GVL YYL T  SPFM  TK+ T++NVSK+  SF            KD IS L VK P +RLS++ A  H W   +
Sbjct:   36 WRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVIRRRRGGIDRIQTIRQEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 305          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000061289.1 (SMESG000061289.1)

HSP 1 Score: 279.256 bits (713), Expect = 3.644e-83
Identity = 158/405 (39.01%), Postives = 231/405 (57.04%), Query Frame = 3
Query:  120 FKSSSLIALNEIDEFEKRHD-------WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDIHYINMEYPLGNISES-----VALNFLDCEIDTQSNDN--LNNYVNDSMNIK----RSQSV----DLWSVDMNSKFPLEN-PHSTFLATSDEVFIDNNDTISNSCENID 1265
             KSSSL  LN+I  F    +       WR +Y   P  +GRG FSKV++  C +  K  A KVIRR++ G+D++D I RE EI++ LN    S  IQL + + + SEV ++ EFA GGS+YN+I E   GL + Y K ++ K++ AL  MH +NIVHLDIKADNILLR PYPS+++A+ DFGLA +L K   +K+++GTPDY+APE+ NY+ I+  +DMWSVGVL Y++ T +SPF   TK+ETL  V+K +  F     N +    +D I  L +K+P  RLS     +H +   +  +  EYP    +E      V    +DC    + N N  +   V    NI+     +Q V    DL   D     P+ N  +++F   +D   ++N   +  +C+N++
Sbjct:    1 MKSSSLYFLNDISNFNSTENLTSDVSNWRDSYTFNPVILGRGHFSKVYKAKCTSTGKYVAIKVIRRRRLGVDKIDDIMREIEIMQLLNQSMNSGFIQLLKFHTSVSEVAVLLEFASGGSIYNVIRESETGLPEAYTKIILSKVISALCIMHGQNIVHLDIKADNILLRHPYPSTDVALADFGLARKLSKSKVHKEMIGTPDYIAPEVANYDSISTKSDMWSVGVLTYFILTNISPFFADTKEETLNRVTKTQFEFLGQLKNDNLQAARDFIQKLLIKIPEKRLSVEDCHSHAFLSSVPIV--EYPANPNTEKTVPTIVVAPDIDCAPQVRENTNYKIRALVTSQYNIESFYGSAQLVNTKKDLLEPDHADCLPIVNMSNNSFDTQTDFDNVNNRPILVETCDNVE 403          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000011366.1 (SMESG000011366.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.780e-37
Identity = 90/268 (33.58%), Postives = 144/268 (53.73%), Query Frame = 3
Query:  180 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRL----DKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNH 971
            + + YI+  + IG+G ++ V   T       +AAK I++K+  + R+    D I REA I+ KL+   I   IQ+YE ++     +LI E   GG L+  I      L++      + +IL  +  MH +NI+HLD+K +NIL+ +P  +  I I DFG + E+       +L GTP+++APE+INY+ +TF  DMWS+G++ Y + TG SPF   T+ E    +++ ++  +    +      K  +SSL VK P  RLS      H
Sbjct:    8 FEQKYILG-QHIGKGHYATVKMCTNIETNIDYAAKFIKKKRIAMSRIGTKTDDIVREARILSKLSHPNI---IQIYEAFDRKDMSVLILELVTGGELFEYISNKV-TLSEEEASKFMRQILLGVHHMHSKNILHLDLKPENILVEDP-DTQKIKIIDFGFSKEINDA-PILELQGTPEFVAPEVINYDPLTFATDMWSIGIIAYIMLTGNSPFYHETQSEVFNRITRCQLDLNDSTCSMMSDLAKSFLSSLIVKTPSKRLSCEDCLKH 268          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK17B1.561e-5236.00serine/threonine kinase 17b [Source:HGNC Symbol;Ac... [more]
STK17B1.561e-5236.00serine/threonine kinase 17b [Source:HGNC Symbol;Ac... [more]
STK17A6.226e-5035.82serine/threonine kinase 17a [Source:HGNC Symbol;Ac... [more]
STK17A6.226e-5035.82serine/threonine kinase 17a [Source:HGNC Symbol;Ac... [more]
DAPK29.757e-4736.47death associated protein kinase 2 [Source:HGNC Sym... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dapk-18.231e-4234.87Death-associated protein kinase dapk-1 [Source:Un... [more]
ttn-13.872e-4034.18Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-13.872e-4034.18Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-13.942e-4034.18Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-13.942e-4034.18Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sqa7.281e-3934.81gene:FBgn0259678 transcript:FBtr0299929[more]
Drak1.566e-3832.21gene:FBgn0052666 transcript:FBtr0301020[more]
Drak1.566e-3832.21gene:FBgn0052666 transcript:FBtr0301021[more]
Drak1.566e-3832.21gene:FBgn0052666 transcript:FBtr0340295[more]
sqa8.302e-3834.81gene:FBgn0259678 transcript:FBtr0310326[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17a6.037e-5135.27serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-G... [more]
stk17al5.179e-4935.97serine/threonine kinase 17a like [Source:ZFIN;Acc:... [more]
stk17b1.937e-4739.08serine/threonine kinase 17b (apoptosis-inducing) [... [more]
stk17b1.937e-4739.08serine/threonine kinase 17b (apoptosis-inducing) [... [more]
si:dkey-240h12.45.147e-4736.54si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd82.375e-4836.09frizzled class receptor 8 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000029423.15.918e-4835.19serine/threonine-protein kinase 17A-like [Source:N... [more]
dapk36.020e-4735.59death-associated protein kinase 3 [Source:NCBI gen... [more]
dapk13.719e-4637.97death associated protein kinase 1 [Source:NCBI gen... [more]
c7orf264.921e-4436.50chromosome 7 open reading frame 26 [Source:Xenbase... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk17b7.090e-5334.91serine/threonine kinase 17b (apoptosis-inducing) [... [more]
Dapk22.481e-4636.23death-associated protein kinase 2 [Source:MGI Symb... [more]
Dapk21.426e-4536.23death-associated protein kinase 2 [Source:MGI Symb... [more]
Dapk32.283e-4434.22death-associated protein kinase 3 [Source:MGI Symb... [more]
Dapk32.283e-4434.22death-associated protein kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91XS8|ST17B_RAT3.613e-5335.27Serine/threonine-protein kinase 17B OS=Rattus norv... [more]
sp|Q8BG48|ST17B_MOUSE4.959e-5234.91Serine/threonine-protein kinase 17B OS=Mus musculu... [more]
sp|O94768|ST17B_HUMAN7.496e-5236.00Serine/threonine-protein kinase 17B OS=Homo sapien... [more]
sp|Q9UEE5|ST17A_HUMAN2.990e-4935.82Serine/threonine-protein kinase 17A OS=Homo sapien... [more]
sp|Q9GM70|ST17A_RABIT7.216e-4935.82Serine/threonine-protein kinase 17A OS=Oryctolagus... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z2A41.515e-5740.81Serine/threonine kinase OS=Fasciola gigantica OX=4... [more]
A0A4E0RZ562.215e-5741.54Serine/threonine kinase OS=Fasciola hepatica OX=61... [more]
G7YNG08.574e-5742.15Serine/threonine-protein kinase 17A OS=Clonorchis ... [more]
A0A4S2LQB32.246e-5642.15Protein kinase domain-containing protein OS=Opisth... [more]
A0A067RRE92.823e-5239.76Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17a1.628e-4933.22serine/threonine kinase 17a [Source:NCBI gene;Acc:... [more]
ENSAMXT00000046763.13.877e-4735.64death-associated protein kinase 3 [Source:NCBI gen... [more]
ENSAMXT00000037487.13.877e-4735.64death-associated protein kinase 3 [Source:NCBI gen... [more]
stk17al1.424e-4534.87serine/threonine-protein kinase 17A-like [Source:N... [more]
stk17b5.809e-4535.36serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b7.862e-4734.38serine/threonine kinase 17b (apoptosis-inducing) [... [more]
ENSPMAT00000000175.15.414e-4333.55pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
ENSPMAT00000001278.13.440e-4134.75pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
mylk38.531e-4035.80myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
dapk14.472e-3834.36death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD537.781e-3331.53DNA damage response protein kinase; required for c... [more]
TPK33.286e-2828.90cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK19.704e-2827.82cAMP-dependent protein kinase catalytic subunit; p... [more]
KIC13.789e-2729.88Protein kinase of the PAK/Ste20 family, required f... [more]
TPK24.591e-2727.44cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO370246.653e-4737.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422875.297e-4334.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OBSCURIN2.459e-4237.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490901.006e-3936.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428371.725e-3736.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17al1.097e-4934.56serine/threonine-protein kinase 17A [Source:NCBI g... [more]
si:dkey-240h12.44.905e-4837.88death-associated protein kinase 2 [Source:NCBI gen... [more]
si:dkey-240h12.44.905e-4837.88death-associated protein kinase 2 [Source:NCBI gen... [more]
ENSORLT00000027698.14.956e-4734.30death associated protein kinase 3 [Source:NCBI gen... [more]
dapk2b5.724e-4536.09death associated protein kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035615.10.000e+096.50SMESG000035615.1[more]
SMESG000061289.17.626e-8438.65SMESG000061289.1[more]
SMESG000064400.18.529e-8452.22SMESG000064400.1[more]
SMESG000061289.13.644e-8339.01SMESG000061289.1[more]
SMESG000011366.11.780e-3733.58SMESG000011366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010487 ID=SMED30010487|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2206bp
TTTGATTGTAATTGATTAATAAAATTATATATTTAAGTTATTGTGTAATT
AAAATTTATTAATCTCAAGACGGCCAATTTATGATTCCATCGAAAAATAG
ATATTTCAATGGAGCAAGATTTAAATCTTCTAGTCTAATAGCATTGAACG
AAATTGATGAATTCGAAAAGAGGCATGATTGGCGTAAAAATTACATTGTT
AAACCAAAAGAAATAGGAAGAGGATTTTTCTCTAAAGTTTTCCAAGTTAC
TTGTAAAACTCGAGAAAAATCATTTGCTGCCAAAGTAATTAGACGAAAAA
AAGGCGGCATTGACAGATTAGATAAAATTCGAAGAGAAGCGGAAATAATT
AAAAAATTAAATGACAAAACCATCTCAGCAGTTATTCAGTTATATGAAAC
ATATGAAACTTTCAGTGAAGTCATTTTGATTTGTGAATTTGCGATAGGCG
GAAGCTTATATAATCTTATTGAAGAATTCACCCATGGTTTGAATCAGAAC
TATATTAAATGTGTTATTTACAAGATTCTCAAAGCATTGGAATGCATGCA
TTTTGAGAATATTGTTCACTTAGATATAAAGGCAGATAATATCTTGTTAC
GTGAACCTTATCCATCTAGCAATATTGCTATTTGTGATTTTGGATTAGCC
ACAGAATTGAAGAAAGGAATGAATTACAAAGACTTAGTTGGAACGCCGGA
TTATATGGCTCCAGAAATTATAAACTACGAAAAAATCACTTTCAACGCAG
ATATGTGGAGTGTTGGAGTTCTGATTTATTATTTGTCTACTGGGCTTTCA
CCATTTATGGGTTCAACAAAAGATGAGACGCTTATAAATGTGTCGAAAGT
TAAAATGTCATTTCATCCCCTATTTGATAACCCCGATTATTCCAATACAA
AAGATTTGATTTCTTCTCTTTGTGTAAAACTTCCTGGTTTACGCTTGTCA
TCTTCAACGGCTCAAAATCATAAATGGTTTGATGATATTCATTATATAAA
TATGGAATATCCACTGGGAAATATATCTGAATCGGTTGCATTGAATTTTC
TCGACTGTGAAATAGATACTCAATCAAACGACAATCTTAATAATTATGTC
AATGATTCCATGAATATTAAACGCAGTCAATCGGTAGATTTATGGTCCGT
CGATATGAATTCCAAGTTTCCTTTGGAAAATCCTCACAGCACATTTTTGG
CAACTTCTGATGAAGTTTTTATCGATAATAATGACACCATATCAAATAGT
TGTGAAAATATTGACACTGCAATTAACAACAATAATACTCCTGCGCCAAA
GCGGACATTAATGAATGTTGATGAAGTAGCTGATGAAACCTGGTATGAAA
ATAAAGGCAAATCACCTATCTGTGAAATGGAAGCCACCAATGGTAAATCC
AACATAAATTATCACTGTGAATATAACTCCAATCCAGAAATCATTACTCA
AAATATTGAATTGCAGCCAAATAATGTAAATAATCAGTTGACCAATCCGA
TTTCAGAATCTCATGAATCCTCCAATGAAACTATCCAGACAAATTCCGAT
GATATTGTCAGTGGAATTTCAAAAGAAATAATTATTCGGAATCTGGAAAA
TATTGGATTTAATAATATAGGAAATGGCGATTATAAACATGATCAGAATA
GCCAATTGAAATGTTCTGAAATAGAAATCAATCCTAATCATGATTCTCAG
CAATTAATCAAATCGGATTTATTGACTAATTGCGATCAGAATGATAATAA
AAACGTCGATAATAATATTGTCAGTGAAATATCAATAGATATAATTCCAT
GTCAAGTTGAAAATAGATTAGAAAACGGTGATGATAAATACGATCAGAAT
ATCCAACTGAAATTGTCTCAAATCAACTTAGATCTTCCTTTTGATTCCCA
GCAATCAAGTAAATCAGATTCATTGACTGGTTGTAATTTGAAACATAAAT
ATTTATTATCTGATCCAATAGATGAATATGAGAACATATCTGACAGCTGT
GATAGCAAAATCATTTTACACCCTCCAGAAATTCAAAGGAATATTTCCAC
GAATTCAGATTATGATGAAGATGATGATTTTAGATATCCTTCGTTGTTGG
CGCATTTCAGAATATATGAACTGTGCATTTTGATGTAATCTTTTATGAAA
TTTAATGGAACTAATAAATATTATTATCAATCATATCATAAAATTGTATT
AATTAT
back to top

protein sequence of SMED30010487-orf-1

>SMED30010487-orf-1 ID=SMED30010487-orf-1|Name=SMED30010487-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=686bp
MIPSKNRYFNGARFKSSSLIALNEIDEFEKRHDWRKNYIVKPKEIGRGFF
SKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISA
VIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKIL
KALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYK
DLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDET
LINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWF
DDIHYINMEYPLGNISESVALNFLDCEIDTQSNDNLNNYVNDSMNIKRSQ
SVDLWSVDMNSKFPLENPHSTFLATSDEVFIDNNDTISNSCENIDTAINN
NNTPAPKRTLMNVDEVADETWYENKGKSPICEMEATNGKSNINYHCEYNS
NPEIITQNIELQPNNVNNQLTNPISESHESSNETIQTNSDDIVSGISKEI
IIRNLENIGFNNIGNGDYKHDQNSQLKCSEIEINPNHDSQQLIKSDLLTN
CDQNDNKNVDNNIVSEISIDIIPCQVENRLENGDDKYDQNIQLKLSQINL
DLPFDSQQSSKSDSLTGCNLKHKYLLSDPIDEYENISDSCDSKIILHPPE
IQRNISTNSDYDEDDDFRYPSLLAHFRIYELCILM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0012501programmed cell death
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
GO:0046777protein autophosphorylation
GO:2000271positive regulation of fibroblast apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005793endoplasmic reticulum-Golgi intermediate compartment
GO:0005886plasma membrane
GO:0015629actin cytoskeleton
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 39..300
e-value: 2.1E-63
score: 226.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 42..300
e-value: 1.0E-57
score: 195.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 39..300
score: 39.453
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 127..358
e-value: 5.3E-48
score: 165.4
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 41..126
e-value: 2.4E-16
score: 61.8
NoneNo IPR availablePANTHERPTHR24342:SF12DEATH-ASSOCIATED PROTEIN KINASE RELATEDcoord: 22..621
NoneNo IPR availablePANTHERPTHR24342SERINE/THREONINE-PROTEIN KINASE 17coord: 22..621
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 161..173
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 45..68
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 34..313