Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30010476
Length (bp)1727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 2K1-like protein (SMED30010476) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30010476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2K1-like protein (SMED30010476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30010476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30010476SMESG000003402.1 dd_Smed_v4_2394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010476SMESG000003402.1 dd_Smed_v4_2394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30010476SMESG000003402.1 dd_Smed_v6_2394_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 143.28 bits (360), Expect = 3.220e-36
Identity = 117/432 (27.08%), Postives = 193/432 (44.68%), Query Frame = 2
Query:  356 LSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-------QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKF----RTLQDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            + +F  KYGN FSL+LG      I    LIK+ +   +  F  +        T  R    K+   I++       QR F    L++F   K  L   I  E QH  + ++  N +  +    ++    NI  S+   +RFE +D  F    + L +   +E  K   LY +F  +  F+     T      + S  K  K F     D+ R    P E     D +  Y++ M  ++ + +SS     ++ LI ++ +   +  E  S+ L W++ +M+ +PE+Q+KV  EI  VIG+ + P    +E++ YT AV+ E+ R+G+ + L        D ++    +P+ +++  NL   H DP  W  P  F P+HFL         +  RE  + F I K+  +GE L R + F+ F S+ QKF      N
Sbjct:   68 VQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNR------PVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQT------LFSNWKKLKLFVSHMIDKHRKDWNPAETR---DFIDAYLKEMSKHTGNPTSSFH---EENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENGQ-----FKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNN 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 134.42 bits (337), Expect = 3.343e-33
Identity = 109/420 (25.95%), Postives = 194/420 (46.19%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM-QSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDT--MTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
            FR KYG+ F++ LG R +  +   + I++ +  K + FSG+ K  M   F            R    R F+   ++DF   K  +   I  E Q  ++EL +S    ++ + +    + NI  S++  KRF  +D +F  + +    T  +    F  +F L   F++          +  +  ++YK   EI       +  H + ++ +   D + TY+  M+   ++  S       + L +N+     +  E  S+ L +    M  +P V ++V+ EI  VIG  R PE+ D+  + YT+AV+ EI R    + +G  +   +  S    IIP+++ +F+ L     DP  +EKP  F P+HFL+ + + + T    E  + F + K+  +GE + RA+ FL F +I Q F + S
Sbjct:   58 FREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLK---------YFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFS---HQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKT----EAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMAS 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 129.413 bits (324), Expect = 1.566e-32
Identity = 64/162 (39.51%), Postives = 94/162 (58.02%), Query Frame = 2
Query: 1130 LLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            LLW + +MS  P+VQ+KVHEEI  VIG  R P + DK  + YT+A + E+ RL   V L   +   ++  ++   IP+ +L+  NL+  H DP +WEKP DFYPN FL+    +Q     +E  + FGI K+  +GE L + + FL+F S+ Q F     E+
Sbjct:  152 LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLD----DQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPED 309          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 128.257 bits (321), Expect = 7.323e-31
Identity = 64/162 (39.51%), Postives = 94/162 (58.02%), Query Frame = 2
Query: 1130 LLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            LLW + +MS  P+VQ+KVHEEI  VIG  R P + DK  + YT+A + E+ RL   V L   +   ++  ++   IP+ +L+  NL+  H DP +WEKP DFYPN FL+    +Q     +E  + FGI K+  +GE L + + FL+F S+ Q F     E+
Sbjct:  361 LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLD----DQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPED 518          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2D6 (cytochrome P450 family 2 subfamily D member 6 [Source:HGNC Symbol;Acc:HGNC:2625])

HSP 1 Score: 125.946 bits (315), Expect = 1.399e-30
Identity = 63/177 (35.59%), Postives = 95/177 (53.67%), Query Frame = 2
Query: 1064 DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            D+ L +   +  S+     S+ L W +  M   P+VQ++V +EI DVIG+ R PEM D+ ++ YT AV+ E+ R G  V LG  +   +DI ++   IP+ + +  NL     D  +WEKPF F+P HFL+     Q  +   E  L F   ++  +GE L R + FL F S+ Q F
Sbjct:  241 DENLCIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDA----QGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHF 413          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27506])

HSP 1 Score: 113.235 bits (282), Expect = 2.063e-26
Identity = 61/173 (35.26%), Postives = 102/173 (58.96%), Query Frame = 2
Query: 1103 SDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPV-FLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            +  E  S+ L W + FM  +PEVQ KV +EI+D +G  R+P M DK N+ YTQAV+ E+ R  + + FLG+ ++  ++  I  N +P  SL+F  L+    +  ++E P  F P+ +L +SD      +  E+ + F I K+  +GE L R + FL+F+++ QK++  ++ NI
Sbjct:  298 AGMETTSNSLRWHLAFMMKYPEVQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHEVQRCSNMIPFLGS-HQCKEETEIHGNRVPAGSLVFAQLWSVMRNDTVFEDPETFNPSRYL-QSDGKTFDKAVLEKTIPFSIGKRNCVGEGLARMELFLIFSALIQKYEFVATSNI 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27505])

HSP 1 Score: 105.531 bits (262), Expect = 6.019e-24
Identity = 91/367 (24.80%), Postives = 165/367 (44.96%), Query Frame = 2
Query:  560 QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEK---------SLNISNMVXXXXXXXXXXXXXDKRFE----VKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            QR    K+L+DF   ++ +   +       L +LER  +K          L + N+++   F+  +     K+FE    V D   +T+Q      +    F ++ H  FP I    +            K  + + E  +DE+ + +K  +   E ++ +  Y+Q MK                 L  +  +   +  E  S+ L W + FM  +PE+Q KV +EI+D +G  R+P M DK N+ YTQAV+ E+ R  + + +   +    DI ++   IP  +L+F  ++    +  ++E+   F P+ +L  +D      S  E  + F + K+  +GE L R + FL+F+++ QK++     NI
Sbjct:  121 QRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLERIADKKNVDMFWPIQLCVGNVINESLFSYHYKYEDSKKFETFVKVLDKHLKTVQGKTIFLMSA--FPWLKH--FPVIGELGYH--------RIKKNIQSYQEFINDEVTSQIKHYDGESEPENFVHAYMQQMKQSGNPNLDM------NNLCASVIDFWLAGMETTSNSLRWHLAFMMKYPEIQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHEVQRCSNMIPILGTHTNRDDILLKGKKIPTGTLVFAQIWSVLKNDPVFEESSKFNPDRYL-MADGKTINKSVLERTIPFSVGKRNCVGEGLARMELFLIFSALIQKYEFIPKTNI 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27531])

HSP 1 Score: 104.76 bits (260), Expect = 1.236e-23
Identity = 91/367 (24.80%), Postives = 169/367 (46.05%), Query Frame = 2
Query:  560 QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEK---------SLNISNMVXXXXXXXXXXXXXDKRFE----VKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            QR    K+L+DF   ++ +   +       L +LE  ++K          L + N+++   F   +      RFE    V D   +  Q   ++ +    F ++ HL  P I N  + +     + +  K Y++F    ++E+ + LK  +   E ++ +  Y+Q MK                 L  +  +   +  E  S+ L W + FM  +PEVQ KV  EI + IG  R+P M DK+N+ YTQAV+ E+ R  + V + A +   +D+ ++ + IP  +L+F  ++    +  ++E+   F P+ +L   D      +  E  + F + K+  +GE L R + FL+F+++ QK++     N+
Sbjct:  121 QRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLEHISDKKNVDMYWPIQLCVGNVINESLFGYHYKYEDAGRFEKFVKVVDRHLKIAQGNASLLVSA--FPWLRHL--PVIGNLGYHS-----IKNNIKSYQQF---IEEEVTSQLKNYDGESEPENFVHAYMQQMKQTGNPNLDMT------NLCASVLDFWLAGMETASNSLRWHLAFMMKYPEVQDKVRNEIFENIGTARLPSMSDKQNMPYTQAVIHEVQRCSNMVPILATHMNTEDVLVKEHNIPTGTLLFAQIWSVLKNDPVFEENSKFNPDRYL-MPDGKTLNKTVLERTIPFSVGKRNCVGEGLARMELFLIFSALIQKYEFIPKTNV 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C9 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16482])

HSP 1 Score: 102.064 bits (253), Expect = 1.016e-22
Identity = 103/441 (23.36%), Postives = 192/441 (43.54%), Query Frame = 2
Query:  341 PIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM--QSFTNDRSDYLKEQERIVTQ-RNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRF-EVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWM---------LSRTKIY-KEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXX-XXFDKKLIVN-SYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            P Y+  + +  KYG+ ++  LG R    +++++ +K+      +T++ K KP    +SF       ++       + R F     +DF   K ++   I +E +      +++  + ++++++      N+   +L   RF E +  +FRT++        +            F   S     FL WM         L R K Y K F E F  ++  H K I+  LE +    Y+++         +S   +SF  K + N   +   +     S+ + W   +   + + Q+K+HEE+  VIG ER     DK NL YT A ++EI R  + V L   +   +D  ++   IP+ + +   +     D  ++ +P+ F P  FL+     +      E+L+ F + K+Q +GE L R + FL  A+ F +++V    N
Sbjct:   46 PGYKAFARWTAKYGDIYTFWLGTRPYILVSSYEALKETFIKDGETYADK-KPMAFQESFRGGSYGVVETNGPFWREHRRFAIHQFRDFGLGKDRMEQRIMLEVEDIFNNCDKTIGEGVDLTDIFDRAVGNVINQMLFGYRFDETRADEFRTIRAFFNFNSGE------------FASFSMRVQFFLPWMGYIMPGPTILDRFKKYQKGFTEFFGTQIENHKKEIDFELEENS--DYVEAFLKEQRKREASGDFESFSTKQLSNMCLDLWFAALMTTSNTMTWCFAYTLNYLDAQQKLHEELDRVIGSERHINTADKPNLPYTNAYINEIQRTANLVPLNLLHMTTRDTVLKGYNIPKGTGVVAQISTVMYDENVFPEPYIFKPERFLDDDGKLKKV----EQLVPFSVGKRQCLGEGLARMELFLFIANFFNRYRVVPDAN 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-34A9 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:H2KY69])

HSP 1 Score: 100.138 bits (248), Expect = 4.397e-22
Identity = 112/502 (22.31%), Postives = 226/502 (45.02%), Query Frame = 2
Query:  194 IIFAVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT--------QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKS----LNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKI-YKEFNEIF---DDELRAHLKPIENNL-----EHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF---KVNSSENIST 1624
            I+  +   I+ +  V++   +++ P+      P + ++  +    + +  I +  + F+ +YGN F++ +G      I +FD+  +    + +TF          F+N   DY++E   I+          R F    L++F   ++ +   I  E ++  K+ + ++ K+    +N S+   L   +I   LL+ +RFE  + +F  L+ ++   ++K   + IF    P        +K + W   RTK  ++ F+ IF   +  ++  +  I+N       E +D +     +       +  ++ +FD + L V+ Y+   +  E  S+ L W+   +  +PEV K++ +E+ +V G  R   + D+    Y  A ++EI R+ S + +  F    +D  IE   I   +++   L   HTD K ++   +F P  FL  ++  +        L+ FGI K+  +GESL RA+ +L+  ++   F    V ++  I T
Sbjct:    2 ILILILSAIVAIFTVNLWRARQKLPK-GPTPLPLIGNLHQLIYNAWKNGGIVQGFNEFKKQYGNVFTIWMGPIPSVHIADFDVAHETHVKRANTFG-------HRFSNGGMDYIREGRGIIASNGEFWQEHRRFALTTLRNFGLGRNIMEDKIMEEYRYRFKDFKNTHFKNGGIQVNASSCFDLLVGSIINQLLVSERFEQDNKEFERLKTSLAKGLEK---VSIFEAFMPVW---VLKSKLMRW---RTKTTFEPFDFIFGLVERGIQKRVSAIKNGTHIPSEEGEDFVDAF--LIKMEKDKNEGIQSTFDLETLAVDLYDLWLAGQETTSTTLTWACACLLNYPEVVKEIRKELTEVTGGTRSLSLTDRPKTPYLGATINEIQRIASILNVNIFRLMEEDSIIEGQPISAGAVLTTQLAMLHTDEKTFKNHTEFRPERFLENNNLEK-------RLIPFGIGKRSCLGESLARAELYLITGNMILDFDFESVGAAPRIQT 477          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 125.561 bits (314), Expect = 2.885e-30
Identity = 113/432 (26.16%), Postives = 208/432 (48.15%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKW-KPKMQSFT-----NDRSDYLKEQERIVTQ--RNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRT----LQDTMTI--EIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITY----IQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            +YG+ FS +LG +    ++++ +I++    + + F+G+   P MQ+       N      K+Q R +    R F    + +    K ++   I  E   F+  L  S+ + +++S ++S+   N+  SL++  RF + DPKFR     +++ M +  EI   +++      FP I     TAK  I   +R ++ + + ++ DD  R+   P  NN+   DL+ +    I+  K   T       K+ +++L+    +  S+  E I + LLW   FM   P+  ++V +E+  V+G+ R+P ++D + L  T++ + E +R  S V L   +   +D+ +    IP  S +   +   H DP LWEKP +F P+ F+   D+      P E  + FG+ ++  +G+ L R + FL FAS    F +   E 
Sbjct:   83 QYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGN---GKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQC-FPSIS----TAKNKIAQ-NRAEMQRFYQDVIDDHKRS-FDP--NNIR--DLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFI---DTEGKVRKP-EYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEG 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 125.561 bits (314), Expect = 2.885e-30
Identity = 113/432 (26.16%), Postives = 208/432 (48.15%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKW-KPKMQSFT-----NDRSDYLKEQERIVTQ--RNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRT----LQDTMTI--EIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITY----IQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            +YG+ FS +LG +    ++++ +I++    + + F+G+   P MQ+       N      K+Q R +    R F    + +    K ++   I  E   F+  L  S+ + +++S ++S+   N+  SL++  RF + DPKFR     +++ M +  EI   +++      FP I     TAK  I   +R ++ + + ++ DD  R+   P  NN+   DL+ +    I+  K   T       K+ +++L+    +  S+  E I + LLW   FM   P+  ++V +E+  V+G+ R+P ++D + L  T++ + E +R  S V L   +   +D+ +    IP  S +   +   H DP LWEKP +F P+ F+   D+      P E  + FG+ ++  +G+ L R + FL FAS    F +   E 
Sbjct:   83 QYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGN---GKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQC-FPSIS----TAKNKIAQ-NRAEMQRFYQDVIDDHKRS-FDP--NNIR--DLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFI---DTEGKVRKP-EYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEG 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 89.7373 bits (221), Expect = 1.386e-18
Identity = 49/176 (27.84%), Postives = 96/176 (54.55%), Query Frame = 2
Query: 1148 FMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTP 1675
            ++  +P V ++V  EI +V+G  R+P ++D++NL +T+A + E LR+ + V     ++A +D  +    IP+++++  +LY  H+D ++W  P  F P  FL   D++       +  L FG  K+   GE+  R   FL+ A++ Q F      N   ++  ++ +N +G++ +P
Sbjct:  330 YLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFL---DADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLGPN---DRLPDLSQNLNGLIISP 499          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 80.8777 bits (198), Expect = 7.768e-16
Identity = 106/485 (21.86%), Postives = 207/485 (42.68%), Query Frame = 2
Query:  197 IFAVAYLILGLVLVSVLHGKKRKP-RFSDQEK--PKLNDVSTIKSYLFYSLPIY-RNLSVFRLKYGN---FFSLKLGMRKITFINNFDLIKQIMYGKE-DTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKS------LNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEM-KDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFL-NKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKV 1600
            +F     I    L+++L G  RKP RF       P +     + S L   L ++ + + VF  +Y N   F+ LK+G  K+      D I ++M  ++ D        ++++F +     L + E  V QR F  + LK+F   +S +   +  E    L++L+    KS      + + ++ S++  N  + +L  +R+E   P+   L +T     K  + +      FP +   +F A          + ++        E+  H    +N  E  DL+ +Y+++    +           D+ L+    +   +  E  +  L +    +   PE+Q++  +EI +V+G ER+PE  +D+  L Y +A+  E +R+      G  +RA  D  +    IP+++++     G   +P  +  P  F P+ +L +        ++P      FG  + + +G+ L R   F+   ++ Q FK+
Sbjct:    1 MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQV-SQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLL---RFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFS----DQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPEAFNP------FGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 80.8777 bits (198), Expect = 7.768e-16
Identity = 106/485 (21.86%), Postives = 207/485 (42.68%), Query Frame = 2
Query:  197 IFAVAYLILGLVLVSVLHGKKRKP-RFSDQEK--PKLNDVSTIKSYLFYSLPIY-RNLSVFRLKYGN---FFSLKLGMRKITFINNFDLIKQIMYGKE-DTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKS------LNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEM-KDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFL-NKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKV 1600
            +F     I    L+++L G  RKP RF       P +     + S L   L ++ + + VF  +Y N   F+ LK+G  K+      D I ++M  ++ D        ++++F +     L + E  V QR F  + LK+F   +S +   +  E    L++L+    KS      + + ++ S++  N  + +L  +R+E   P+   L +T     K  + +      FP +   +F A          + ++        E+  H    +N  E  DL+ +Y+++    +           D+ L+    +   +  E  +  L +    +   PE+Q++  +EI +V+G ER+PE  +D+  L Y +A+  E +R+      G  +RA  D  +    IP+++++     G   +P  +  P  F P+ +L +        ++P      FG  + + +G+ L R   F+   ++ Q FK+
Sbjct:    1 MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQV-SQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLL---RFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFS----DQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPEAFNP------FGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p9 (cytochrome P450, family 2, subfamily P, polypeptide 9 [Source:ZFIN;Acc:ZDB-GENE-040120-2])

HSP 1 Score: 140.969 bits (354), Expect = 1.177e-35
Identity = 109/435 (25.06%), Postives = 194/435 (44.60%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGK-WKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIK-KRNFLYIFHLLFPFIENSKFTAKFLIWMLSRT-----KIYKEFNEIFDDELRAHLKPIENNLEHDDLIT--YIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            I+   + F  +YGN FSL+L   +I  +N ++L+K++   + D  + +   P       D+   L    +   QR F    L++F   K  L  +I++EC    + +     +  +   +++    N+   L+   RF+  D  F+TL   +   I  +       + +FP             W++ R      K+   + ++ D  +R  +   E+ ++HD L    YI         L       FD + L + + +   +  E  S+ L W + +M  +P +Q KV EEI  V+G  R P + D++N+ YT AV+ EI R+G+ + +       +DI I    +P+ +++  NL     D   WE P  F P HFLN     +  +  R+  L F + K+  +GE L R + FL F+S+ Q+F  +    +
Sbjct:   58 IHLQFTKFAERYGNIFSLRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIIGDKGIVLSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINLECGFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKHINEAIYLEGGICAQLYNMFP-------------WLMQRLPGSHKKVITLWKKVID-FIRQKVN--EHKVDHDPLNPRDYIDCFLAEMEKLKDDTAAGFDVENLCICTLDLFVAGTETTSTTLYWGLLYMMKYPVIQAKVQEEIDRVVGGSRHPSVSDRDNMPYTNAVIHEIQRMGNIIPINVTRTTSEDIRIGKYSVPKGTMVTSNLTSVLFDESEWETPHSFNPGHFLNA----EGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGV 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p8 (cytochrome P450, family 2, subfamily P, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-061030-1])

HSP 1 Score: 140.584 bits (353), Expect = 1.484e-35
Identity = 109/432 (25.23%), Postives = 194/432 (44.91%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGK-WKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTL----QDTMTIEIKKRNFLYIFHLLFPFI-ENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            I+   + F  +YGN FS +L   +I  +N ++L+K++   + D  + +   P       D+   L    +   QR F    L++F   K  L  +I++EC    + +     +  +   +++    N+   L+   RF+  D  F+TL     + + +E    N LY    +FP++ E      K +I       ++++  +   +++  H    + +   D    YI         L       FD + L + S +   +  E  S+ L W + +M  +PE+Q KV EEI  V+G  R P + D++N+ YT AV+ EI R+G+   +       +D  I N  IP+ +++  NL     D   WE P  F P HFL+     +  +  R+  L F + K+  +GE L R + FL F+S+ Q+F  +    +
Sbjct:   58 IHLQFTKFAERYGNIFSFRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIVGDKGLILSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINVECGFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYN---MFPWLMERLPGPHKTII------TLWRKVTDFVREKVNEHRVDYDPSNPRD----YIDCFLTEMEKLKDDTAAGFDVENLCICSLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVSDRDNMPYTNAVIHEIQRMGNIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHFLDA----EGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGV 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p10 (cytochrome P450, family 2, subfamily P, polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-040120-1])

HSP 1 Score: 138.272 bits (347), Expect = 9.208e-35
Identity = 104/430 (24.19%), Postives = 189/430 (43.95%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQS--FTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTM--TIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            I+   + F  KYG  FS +L   +I  +N ++L+K++   + D  + +    + S    ++R        +   QR F    L++F   K  L  +I+ EC    + +     +  N   +++    N+   L+   RFE  D  F+ L + +  ++ ++   F++++++    ++      K LI +  R            D +R  +     + +   L  YI                 FD + L + + +   +  E  S+ L W + +M  +PE+Q KV +EI  V+G  R P   D++N+ YT AV+ EI R+G+ + L       +D  IE   IP+ +L+  +L     D   WE P  F P HFL+     +  +  R+  L F + K+  +GE L R + FL F S+ Q+F  +    +
Sbjct:   58 IHLQFTEFAEKYGKIFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLADRPTLPITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFECGFLNEAISNEQGRPFNPRLLLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPGPHKKLITLWQRVT----------DFVREKVNEHRADYDQSSLRDYIDCFLAEMEKHKDDTAAGFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVVGSSRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIEKYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFLDA----EGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSVLQRFTFSPPAGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p10 (cytochrome P450, family 2, subfamily P, polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-040120-1])

HSP 1 Score: 138.272 bits (347), Expect = 9.208e-35
Identity = 104/430 (24.19%), Postives = 189/430 (43.95%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQS--FTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTM--TIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            I+   + F  KYG  FS +L   +I  +N ++L+K++   + D  + +    + S    ++R        +   QR F    L++F   K  L  +I+ EC    + +     +  N   +++    N+   L+   RFE  D  F+ L + +  ++ ++   F++++++    ++      K LI +  R            D +R  +     + +   L  YI                 FD + L + + +   +  E  S+ L W + +M  +PE+Q KV +EI  V+G  R P   D++N+ YT AV+ EI R+G+ + L       +D  IE   IP+ +L+  +L     D   WE P  F P HFL+     +  +  R+  L F + K+  +GE L R + FL F S+ Q+F  +    +
Sbjct:   58 IHLQFTEFAEKYGKIFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLADRPTLPITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFECGFLNEAISNEQGRPFNPRLLLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPGPHKKLITLWQRVT----------DFVREKVNEHRADYDQSSLRDYIDCFLAEMEKHKDDTAAGFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVVGSSRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIEKYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFLDA----EGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSVLQRFTFSPPAGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2r1 (cytochrome P450, family 2, subfamily R, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-110114-1])

HSP 1 Score: 137.887 bits (346), Expect = 1.730e-34
Identity = 110/422 (26.07%), Postives = 193/422 (45.73%), Query Frame = 2
Query:  377 YGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-PKMQSFTNDRSDY-LKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMT--IEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDEL----RAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDK-KLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            +G  FSL LG      +N +D IK+ +Y + + F+ +   P  Q  T        K     +          + F T + ++   IS EC +FL  +++   K  N  ++V+    NI   ++  +RF   D  F+ + +  +  +E+   ++ ++++  FP++E   F            ++++  NE++   L    R     +  + +H     YI +        +     SF +  LI +  E I +  E  ++ L W+M +M+ +P +Q+KV  EI D +   R P  +D++ + Y +AV+ E+LRL + V LG F    +D  +    IP+ +++  NLY  H D K W  P  F P  FL   D N   +   E  L F I K+  +GE L R + FL F ++ Q+F +  SE 
Sbjct:   78 HGQIFSLDLGGIPTVILNGYDAIKECLYHQSEVFADRPSLPLFQKMTKMGGLLNCKYGRGWIEHHKLAVNCFRYFGTGQ-RMFERISEECLYFLDAIDQHQGKPFNPKHLVTNAVSNITNLIIFGQRFTYDDGDFQHMIEIFSENVELAASSWAFLYNA-FPWMEYLPFG--------KHQRLFRNANEVYKFLLQIIRRFSQGRVPQSPQH-----YIDAYLDEMEQSTPDKATSFSQDNLIFSVGELIIAGTETTTNCLRWAMLYMALYPRIQEKVQMEI-DSVLNGRQPAFEDRQRMPYVEAVLHEVLRLCNIVPLGIFRATSQDAVVRGYTIPKGTMVITNLYSVHFDEKYWSDPSIFCPERFL---DCN-GKFIRHEAFLPFSIGKRHCLGEQLARLEMFLFFTTLLQRFHLQFSEG 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 136.732 bits (343), Expect = 6.172e-34
Identity = 110/416 (26.44%), Postives = 191/416 (45.91%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGK-EDTFSGKWKP-----KMQSFTNDRSDYLKEQ--ERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXF-DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            +YG+  SL++  + +  +N F++IK+ +  K EDT     +P     ++  F  +    L     +     R F    LKDF   K  L   +  E  +     +       +   +++    N+  S++  +RFE  D KF+ L   +   IK  +   +  ++     +SKF     ++   R ++ +   EI ++    H +  ++    D    +I +              +F D+ L++   E   +  E  ++ L W + FM  +P+VQ+KV EEI  VIG+ R P M D   + YT AV+ EI R G  + L   + A++D  I+   IP+ +++  NL     D K+WEKPF FYP HFL++       +  RE  + F   ++  +GE L R + FL F+S+ Q+F
Sbjct:   73 QYGDVMSLQVFWKSMVVLNGFEVIKEALIQKSEDTAD---RPPFNLYEILGFVGNNKGVLLANYGQSWKDLRRFTLSTLKDFGMGKKSLEERVGEEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFQKLLCLIEESIKAES-RPVPQIVSSLPWSSKFPGLAKLFFQPRLRMLQYLQEIINE----HKQTWDSGHTRD----FIDAFMLEMEKAKGVKDSNFNDQNLLLTIAELFVAGTETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGK----FVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRF 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 135.191 bits (339), Expect = 2.002e-33
Identity = 65/177 (36.72%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 1064 DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            D+ L++ + +  S+  E  ++ L W + FM  +P+VQ+KV EEI  VIG+ R P M D   + YT AV+ EI R G  + L   + A++D  I+   IP+ +++  NL     D K+WEKPF FYP HFL++       +  RE  + F   ++  +GE L R + FL F+S+ Q+F
Sbjct:  300 DQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGK----FVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRF 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 135.191 bits (339), Expect = 2.080e-33
Identity = 65/177 (36.72%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 1064 DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            D+ L++ + +  S+  E  ++ L W + FM  +P+VQ+KV EEI  VIG+ R P M D   + YT AV+ EI R G  + L   + A++D  I+   IP+ +++  NL     D K+WEKPF FYP HFL++       +  RE  + F   ++  +GE L R + FL F+S+ Q+F
Sbjct:  300 DQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGK----FVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRF 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 134.806 bits (338), Expect = 2.245e-33
Identity = 109/416 (26.20%), Postives = 191/416 (45.91%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGK-EDTFSGKWKP-----KMQSFTNDRSDYLKEQ--ERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXF-DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            +YG+  SL++  + +  +N F++IK+ +  K EDT     +P     ++  F  +    L     +     R F    LKDF   K  L   +  E  +     +       +   +++    N+  S++  +RFE  D KF+ L   +   IK  +   +  ++     +SKF     ++   R ++ +   EI ++    H +  ++    D    +I +              +F D+ L++   E   +  E  ++ L W + FM  +P+VQ+KV EEI  VIG+ R P M D   + YT AV+ EI R G  + L   + A++D  I++  IP+ +++  NL     D K+WEKPF FYP HF+++       +  RE  + F   ++  +GE L R + FL F S+ Q+F
Sbjct:   73 QYGDVMSLQVFWKSMVVLNGFEVIKEALIQKSEDTAD---RPPFNLYEILGFVGNNKGVLLANYGQSWKDLRRFTLSTLKDFGMGKKSLEERVGEEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFQKLLCLIEESIKAES-RPVPQIVSSLPWSSKFPGLAKLFFQPRLRMLQYLQEIINE----HKQTWDSGHTRD----FIDAFMLEMEKAKGVKDSNFNDQNLLLTIAELFVAGTETTTTTLRWGLLFMLLYPDVQRKVREEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSMPHMAYRDTHIKSFFIPKGTVIMTNLSSVLKDEKIWEKPFQFYPEHFIDRDGK----FVKREAFMAFSAGRRVCLGEQLARMELFLFFTSLLQRF 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 134.806 bits (338), Expect = 2.310e-33
Identity = 109/416 (26.20%), Postives = 192/416 (46.15%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGK-EDTFSGKWKP-----KMQSFTNDRSDYLKEQ--ERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXF-DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            +YG+  SL++  + +  +N F++IK+ +  K EDT     +P     ++  F  +    L     +     R F    LKDF   K  L   +  E  +     +       +   +++    N+  S++  +RFE  D KF+ L   +   IK  +   +  ++     +SKF     ++   R ++ +   EI ++    H +  ++    D    +I +              +F D+ L++   E   +  E  ++ L W + FM  +P+VQ+KV EEI  VIG+ R P M D   + YT AV+ EI R G  + L   + A++D  I++  IP+ +++  NL     D K+WEKPF FYP HF+++       +  RE  + F   ++  +GE L R + FL F+S+ Q+F
Sbjct:   73 QYGDVMSLQVFWKSMVVLNGFEVIKEALIQKSEDTAD---RPPFNLYEILGFVGNNKGVLLANYGQSWKDLRRFTLSTLKDFGMGKKSLEERVGEEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFQKLLCLIEESIKAES-RPVPQIVSSLPWSSKFPGLAKLFFQPRLRMLQYLQEIINE----HKQTWDSGHTRD----FIDAFMLEMEKAKGVKDSNFNDQNLLLTIAELFVAGTETTTTTLRWGLLFMLLYPDVQRKVREEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSMPHMAYRDTHIKSFFIPKGTVIMTNLSSVLKDEKIWEKPFQFYPEHFIDRDGK----FVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRF 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2j8 (cytochrome P450, family 2, subfamily j, polypeptide 8 [Source:MGI Symbol;Acc:MGI:2449817])

HSP 1 Score: 137.117 bits (344), Expect = 3.140e-34
Identity = 115/425 (27.06%), Postives = 194/425 (45.65%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGK--WKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTL----QDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKK-LIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            ++  +  F  KYGN  SL  G      I+   LIK+ +      F  +     +   F N+        +    QR F   +LK+F   K  L   I  E  H ++ +     +  +   M++    NI  S+ + +RFE +D +F+ L     +T+ +E  K   LY +F  +F ++        F  W   + K++  F+ + D    +H K    +   D    +I +        S     SF+++ LI  + +   +  E  S+ L W++ +++  PEVQ+KVH EI  VIG+ R P + D++++ YT AV+ E+LR+G+ + L        DI++    +P+ +++  NL   H DPK W  P  F P HFL         +  RE  L F + K+   GE L R++ F  F ++ QKF
Sbjct:   66 LHLGIQPFVKKYGNLISLDFGTIPSVIISGEPLIKEALTCMGQNFLKRPILAARQHIFKNN-GIISSSGQTWKEQRRFTLMILKNFGLGKKSLEQRIQDEAHHLVEAIAEEKGRPFDPHFMINNAVSNIICSITIGERFEYEDNQFQELLKLADETLCLEASKVLMLYNVFPSIFKYLPGPH-QKLFSNW--EKLKLF--FSHVMD----SHRKDWNPSAPRD----FIDAFLTEMAKYSDKTTTSFNEENLICTTLDLFFAGTETTSTALRWALLYITVNPEVQEKVHSEIDRVIGQGRHPTIDDRDSMPYTNAVIHEVLRMGNIIPLNVPREVEADITLAGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLENGQ-----FKKRESFLPFSVGKRGCPGEQLARSELFTFFTALMQKF 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 135.576 bits (340), Expect = 9.088e-34
Identity = 119/457 (26.04%), Postives = 203/457 (44.42%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-----PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTM--TIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFD---DELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS---SENISTNKFKEIIRNSDGMVRTPSIKNYVFHIL 1705
            KYG+ F++ LG R +  +   D I++ +  + + FSG+       P +Q +           ER  T R F+   ++DF   K  +   I  E Q  ++EL++     LN +        NI  S++  +RF+ KD +F  L + +  T  +       +F L         F+A    +  +  +I K   EI D     +  H   ++ +   D + TY+          S+   +   + L+++      +  E  S+ L +S   M  +P V +KV +EI  VIG  R+P + D+  + YT AV+ EI R      +G  ++  KD      +IP+N+ ++  L     DP+ +E+P  F P HFL+ + + +T     E  + F   K+  +GE + R + FL F +I Q F + S    ENI      ++I N+ G  +TP    Y  H L
Sbjct:   62 KYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGY----GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFEL---------FSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLDPSAPRDFIDTYL---LRMEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGALKTN----EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSLASPVAPENI------DLIPNNSGATKTP--PQYQIHFL 490          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2g1 (cytochrome P450, family 2, subfamily g, polypeptide 1 [Source:MGI Symbol;Acc:MGI:109612])

HSP 1 Score: 134.806 bits (338), Expect = 1.671e-33
Identity = 104/416 (25.00%), Postives = 188/416 (45.19%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMT---IEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
            KYG+ F++  G R +  +   + +K+ +  + D FSG+ + P ++         L   ER    R F+  +L++F   K  +   I  E  + L+EL +     ++ +  +S    N+  S++  KRF+ +D +F++L   +    +E+ K           P+ +      K + +   R        E   D + + +K  E + +  +   +I           S     F+ K L++ +     +  E +SS L +    +  +PEV+ K+HEEI  VIG  R P + D+  + YT AV+ EI RL   V LG  +   +D      ++P+ + ++        DPK +  P  FYP HFL++    Q  +   +  ++F   K+  +GE+L R + FL F SI Q+F + S
Sbjct:   64 KYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEMPTLEKNFQGYGLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVKGAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFVEMSK-----------PWAQLYDMYWKVMQYFPGRHNYLYNLIEDLKDFIASRVKINEASFDPSNPRDFIDCFLIKMHQDKSDPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVEAKIHEEINQVIGTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVTRDTHFRGYLLPKGTDVYPLFGSVLKDPKYFRYPDAFYPQHFLDE----QGRFKKNDAFVVFSSGKRICVGEALARMELFLYFTSILQRFSLRS 464          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 133.65 bits (335), Expect = 4.193e-33
Identity = 109/420 (25.95%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFT-NDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIEN--SKFTAKFLIWMLSRTKIYKEFNEIFD---DELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
             R KYG+ F++ LG R +  +   D I++ + G+ + FSG+    +   T  +        ER  T R F+   ++DF   K  +   I  E Q  ++EL +S    L+ + +    + NI  S++  +RFE  D +F  L +          F   F L+  F       F+     +  +  +I K   E+ D     +  H   ++ ++  D +  Y+          S+   +   + L+++      +  E  S+ L +    M  +P V +KV +EI  VIG  R+P + D+  + YT AV+ EI R    + +G  +R  KD      ++P+N+ ++  L     DP+ +E+P  F P+HFL+ + + + +    E  L F   K+  +GES+ R + FL F SI Q F V S
Sbjct:   58 LREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLEL---------FYQTFSLISSFSSQMFELFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYL---LRMEKEKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKS----EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSVAS 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 129.028 bits (323), Expect = 1.728e-31
Identity = 109/425 (25.65%), Postives = 190/425 (44.71%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFT-NDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIEN--SKFTAKFLIWMLSRTKIYKEFNEIFD---DELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDS--NQTTYSPREELLIF---GIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
             R KYG+ F++ LG R +  +   D I++ + G+ + FSG+    +   T  +        ER  T R F+   ++DF   K  +   I  E Q  ++EL +S    L+ + +    + NI  S++  +RFE  D +F  L +          F   F L+  F       F+     +  +  +I K   E+ D     +  H   ++ ++  D +  Y+          S+   +   + L+++      +  E  S+ L +    M  +P V +KV +EI  VIG  R+P + D+  + YT AV+ EI R    + +G  +R  KD      ++P+N+ ++  L     DP+ +E+P  F P+HFL+ + +      + P     IF    + K+  +GES+ R + FL F SI Q F V S
Sbjct:   58 LREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLEL---------FYQTFSLISSFSSQMFELFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYL---LRMEKEKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGQIFDQKSVGKRICLGESIARNELFLFFTSILQNFSVAS 470          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P51589|CP2J2_HUMAN (Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP2J2 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.547e-35
Identity = 117/432 (27.08%), Postives = 193/432 (44.68%), Query Frame = 2
Query:  356 LSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-------QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKF----RTLQDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            + +F  KYGN FSL+LG      I    LIK+ +   +  F  +        T  R    K+   I++       QR F    L++F   K  L   I  E QH  + ++  N +  +    ++    NI  S+   +RFE +D  F    + L +   +E  K   LY +F  +  F+     T      + S  K  K F     D+ R    P E     D +  Y++ M  ++ + +SS     ++ LI ++ +   +  E  S+ L W++ +M+ +PE+Q+KV  EI  VIG+ + P    +E++ YT AV+ E+ R+G+ + L        D ++    +P+ +++  NL   H DP  W  P  F P+HFL         +  RE  + F I K+  +GE L R + F+ F S+ QKF      N
Sbjct:   68 VQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNR------PVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQT------LFSNWKKLKLFVSHMIDKHRKDWNPAETR---DFIDAYLKEMSKHTGNPTSSFH---EENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENGQ-----FKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNN 476          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P52786|CP2J1_RABIT (Cytochrome P450 2J1 OS=Oryctolagus cuniculus OX=9986 GN=CYP2J1 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.567e-34
Identity = 133/493 (26.98%), Postives = 224/493 (45.44%), Query Frame = 2
Query:  194 IIFAVAYLILGLVLVSVLHGKKRKPR---FSDQEKPKLNDVSTI---KSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTL----QDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQK--FKVNSSENISTN 1627
            ++ AVA+L     L      K R+P+         P L ++ T+   KS+L         L  F  KYGN F L L  + I  +    LIK+++   +  F  +  P ++  +  ++  +    ++   QR F    L++F   K  L   I  E +H  + +E+   +  +    ++    NI  S+   +RFE  D +F+ L     + M +E      LY IF  +  F+  +  T      + S  K      E+F   +  + K   N  E  D I  Y++ M  Y  S +SS     ++ LI ++ +   +  E  S  + W + FM+ +PE+Q+KVH EI  VIG+ + P M  +E+L YT AV+ E+ R+G+ + L        D ++    +P+ +++  NL   H DP+ W  P  F P HFL         +  +E  + F I K+  +GE L +++ F+ F S+ QK  FK  S E ++ N
Sbjct:   22 LLGAVAFLFFAYFL------KTRRPKNYPPGPWRLPFLGNLFTLDMEKSHL--------QLQQFVKKYGNLFCLDLAGKSIVIVTGLPLIKEVLVHMDQNFINRPVPPIRERSFKKNGLIMSSGQLWKEQRRFALMTLRNFGLGKKSLEERIQEEARHLTEAMEKEGGQPFDAHFKINNAVSNIICSITFGERFEYHDGQFQELLKLFDEVMYLEASMLCQLYNIFPWIMKFLPGAHQT------LFSNWKKL----ELFVSRMLENHKKDWNPAETRDFIDAYLKEMSKYPGSATSSFN---EENLICSTLDLFLAGTETTSD-MRWGLLFMALYPEIQEKVHAEIDSVIGQWQQPSMASRESLPYTNAVIHEVQRMGNILPLNVPREVTVDTTLAGYHLPKGTVVLTNLTALHKDPEEWATPDTFNPEHFLENGQ-----FKKKEAFIPFSIGKRACLGEQLAKSELFIFFTSLMQKFTFKPPSDEKLTLN 481          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O55071|CP2BJ_MOUSE (Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=Cyp2b19 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 6.357e-33
Identity = 119/457 (26.04%), Postives = 203/457 (44.42%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-----PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTM--TIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFD---DELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS---SENISTNKFKEIIRNSDGMVRTPSIKNYVFHIL 1705
            KYG+ F++ LG R +  +   D I++ +  + + FSG+       P +Q +           ER  T R F+   ++DF   K  +   I  E Q  ++EL++     LN +        NI  S++  +RF+ KD +F  L + +  T  +       +F L         F+A    +  +  +I K   EI D     +  H   ++ +   D + TY+          S+   +   + L+++      +  E  S+ L +S   M  +P V +KV +EI  VIG  R+P + D+  + YT AV+ EI R      +G  ++  KD      +IP+N+ ++  L     DP+ +E+P  F P HFL+ + + +T     E  + F   K+  +GE + R + FL F +I Q F + S    ENI      ++I N+ G  +TP    Y  H L
Sbjct:   62 KYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGY----GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFEL---------FSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLDPSAPRDFIDTYL---LRMEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGALKTN----EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSLASPVAPENI------DLIPNNSGATKTP--PQYQIHFL 490          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P12789|CP2B5_RABIT (Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B5 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 8.211e-33
Identity = 111/431 (25.75%), Postives = 188/431 (43.62%), Query Frame = 2
Query:  344 IYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-----PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQD--TMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
            + R+    R KYG+ F++ LG R +  +   D I++ +  + + FSG+ K     P  Q +      +    E     R F+   ++DF   K  +   I  E +  ++EL +S    L+ + +    + NI  S++  KRF+ KDP F  L D    +  +       +F L   F+++   T +         +IY+   EI       +  H   ++ +   D +  Y+          S    +   + LI+       +  E  S+ L +    M  +P V ++V +EI  VIG  R P + D+  + YT AV+ EI RLG  V  GA +   KD      +IP+N+ +F  L     DP+ +E P  F P HFL+   + +      E  + F + K+  +GE + R + FL F +I Q F + S
Sbjct:   51 LLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGY----GVFFANGEHWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSVTSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFPGTHR---------QIYRNLQEINTFIGQTVEKHRATLDPSNPRDFIDVYL---LRMEKDKSDPSSEFHHRNLILTVLTLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLVPFGAPHMVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDADGALKRN----EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIAS 461          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P20813|CP2B6_HUMAN (Cytochrome P450 2B6 OS=Homo sapiens OX=9606 GN=CYP2B6 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.605e-32
Identity = 109/420 (25.95%), Postives = 194/420 (46.19%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM-QSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDT--MTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
            FR KYG+ F++ LG R +  +   + I++ +  K + FSG+ K  M   F            R    R F+   ++DF   K  +   I  E Q  ++EL +S    ++ + +    + NI  S++  KRF  +D +F  + +    T  +    F  +F L   F++          +  +  ++YK   EI       +  H + ++ +   D + TY+  M+   ++  S       + L +N+     +  E  S+ L +    M  +P V ++V+ EI  VIG  R PE+ D+  + YT+AV+ EI R    + +G  +   +  S    IIP+++ +F+ L     DP  +EKP  F P+HFL+ + + + T    E  + F + K+  +GE + RA+ FL F +I Q F + S
Sbjct:   58 FREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLK---------YFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFS---HQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKT----EAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMAS 461          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 1.501e-109
Identity = 189/487 (38.81%), Postives = 292/487 (59.96%), Query Frame = 2
Query:  239 SVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF-TNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVF 1696
            S+ +G K  P   +   P L  +  IK       P+   L     K+G  F ++LGMR +  + N+  I++ +      FSG+WK K+ S  T+D     K+     TQR+F  K+L+DF   KS     +  EC   L EL+    + ++ S ++ +++ NI    +++KRF+  DP+ + ++  +    K+ + +   HL+FP  + S   +KF +W+ S+ +++ +   +F DE+  H   ++ N E DDLI      +   +  +  V    DK+LI  ++E   + YE  S+ L WSM FMS + ++QKKV+EEI++VIG+ERMP M DK++L+YTQAVMDEILRL S   LG F+R F D S++N  IP+NSL+F N Y CHTDP +W KP +FYP HFL K ++++  YSPREEL+ FGI K+Q IGESL R +YF+ F SI Q+++V+ SENIS + F+E +R ++G++R   IKN++F
Sbjct:   25 SIPNGLKETP--IEYGWPILGIIPKIKG------PMQNYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQDIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCENDELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYSKIKNFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.763e-93
Identity = 165/453 (36.42%), Postives = 270/453 (59.60%), Query Frame = 2
Query:  341 PIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF-TNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVF 1696
            P++  L     K+G  F +KLGMR +  ++N+D+IK+ +      FSG+W+ K+ S  T+D     K+ +   TQR+F  K+L+DF   KSK    +  EC   L+ELE    K ++ S ++ +++ NI    +++KRFE ++PK   ++  ++ EIKK++ + + H++FP  + S    + +I   S+ K + E    F +E+  HLK I+ N E +DL+      +      +  V    D +LI +S E   + YE  S+ L WS  FMS   ++Q+KVH EI+++IGKER+P M DK++++YTQAVMDEI R+ S   L   +R   D +I+   IP+N+L+F NLY CH D  +WEKP  FYP HFL + D+    Y+PR+EL++F I K+Q +GESL R ++F+ F SI Q+F+V   + ++  +++E +   DG++R   + +++F
Sbjct:   51 PMHNYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSIVNDFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A1I8IZM6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 9.563e-44
Identity = 122/452 (26.99%), Postives = 220/452 (48.67%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF---TNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNM--VXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKE---FNEIFDDE--LRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVF 1696
            KYG+  S  LG R    +N++ L+K+++   +  F+G+  P+++ F   T +   +L E +    QR  + + L++     SK    I  + +  L++L+ + E +  +  +    L   ++   + L +RF   DP F+ +   +   ++          LFP  E      K L  +   T+++++    NE F  +  LR    P  ++++   L   YIQ  +    +      K F  +LI   +E   +  +  +  + W + +M+++PEVQ +V  E+  V+G+ R P M+D+  LHYT AV+DE  R  S   +G F+R+ +D +     IP ++++   +YG H   + WE+P +FYP HFL+    N+  Y     L+ F I ++  +GESL R + FL F +I Q+++V   E  S  K  +I+R   G +R P     +F
Sbjct:    7 KYGDLCSFYLGGRLFVVVNSYPLMKEML--DDPVFAGR--PRLRLFEKMTRNCGIFLVEGKVWCHQRRLSLRTLREIGFSGSKAVGMIEDQLEPLLQQLDEAAEAAQPVKTLDTFLLAVNSVITEMTLGRRFHRDDPDFKKVTSLIAATLES-GISETACFLFPAAE------KLLDIIPMSTRVFRDVEYLNEFFRQQIRLREAAMPAGSDVQPTCLCDAYIQEKRKAEKAGDFETFKEF--QLIRVCFEFYLAGTDTTARSMEWLLLYMAFYPEVQDRVQNELDSVVGQSRRPRMQDRTELHYTSAVIDETYRKASLAAIGVFHRSVEDATFHGYRIPSDAIIIPLVYGVHHRAEYWERPNEFYPEHFLD----NKGRYRSSPYLIPFLIGRRSCVGESLARMEIFLFFTAIMQRYRVR-PEPESAAKKDDILRGHMGSLRVPGDYRLIF 440          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267E0A3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001422g2 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 4.173e-43
Identity = 122/452 (26.99%), Postives = 220/452 (48.67%), Query Frame = 2
Query:  374 KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF---TNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNM--VXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKE---FNEIFDDE--LRAHLKPIENNLEHDDLI-TYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVF 1696
            KYG+  S  LG R    +N++ L+K+++   +  F+G+  P+++ F   T +   +L E +    QR  + + L++     SK    I  + +  L++L+ + E +  +  +    L   ++   + L +RF   DP F+ +   +   ++          LFP  E      K L  +   T+++++    NE F  +  LR    P  ++++   L   YIQ  +    +      K F  +LI   +E   +  +  +  + W + +M+++PEVQ +V  E+  V+G+ R P M+D+  LHYT AV+DE  R  S   +G F+R+ +D +     IP ++++   +YG H   + WE+P +FYP HFL+    N+  Y     L+ F I ++  +GESL R + FL F +I Q+++V   E  S  K  +I+R   G +R P     +F
Sbjct:   92 KYGDLCSFYLGGRLFVVVNSYPLMKEML--DDPVFAGR--PRLRLFEKMTRNCGIFLVEGKVWCHQRRLSLRTLREIGFSGSKAVGMIEDQLEPLLQQLDEAAEAAQPVKTLDTFLLAVNSVITEMTLGRRFHRDDPDFKKVTSLIAATLES-GISETACFLFPAAE------KLLDIIPMSTRVFRDVEYLNEFFRQQIRLREAAMPAGSDVQPTCLCDAYIQEKRKAEKAGDFETFKEF--QLIRVCFEFYLAGTDTTARSMEWLLLYMAFYPEVQDRVQNELDSVVGQSRRPRMQDRTELHYTSAVIDETYRKASLAAIGVFHRSVEDATFHGYRIPSDAIIIPLVYGVHHRAEYWERPNEFYPEHFLD----NKGRYRSSPYLIPFLIGRRSCVGESLARMEIFLFFTAIMQRYRVR-PEPESAAKKDDILRGHMGSLRVPGDYRLIF 525          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267GXQ8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009966g1 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.220e-41
Identity = 125/447 (27.96%), Postives = 215/447 (48.10%), Query Frame = 2
Query:  368 RLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELER--SNEKSLN----ISNMVXXXXXXXXXXXXXDKRFE--VKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDK-KLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVR 1669
            R +YG  +S ++G R +  +++++L+K+++   ED FSG+  P     T      L  + R+ + QR  + ++L+DF   +++    I+ E +  +++LE+  +  K ++    ++N V             DKR+E  +++ KF  L D           L     LFP++      +K L  +    KI K   +I    ++E+      I  + + +        +     + +    ++F K +L+  S E   +  +  +  L W M  M+ FPE Q  V EEI  V G ER P++ DK  LHYTQAV+DE +R  S       +RA KD      +IP ++ +   LYG H + K W++P  FYP HFL    +  + Y+P + L  F + K+   GESL + + FL F +I Q+++V  S +  T K  +I+R   G+ R
Sbjct:   84 RHQYGGIYSYRMGSRLMIVVSSYELLKEML--SEDVFSGRQLPPAAQRTAQGCGILFVEGRVWSEQRRVSLRVLRDFGFARTESVEFINEEIRILMEKLEQQPTEVKVIDHFNALTNSVIAMLVFGRRYANEDKRYEKFLENSKF--LFDV--------GLLSALPFLFPYL------SKLLSLLPMTRKIVKTVQDIQTFIEEEITKREALISTDADAEGTCLCDAYIIERRNAEAKGDFETFKKFQLVRVSMELFVAGTDTTAKTLEWLMIHMAAFPEAQDNVQEEIHRVAGTERQPQLSDKAQLHYTQAVIDESMRFASLAPNAISHRAIKDTYFRGYLIPADAAIVPFLYGLHRNSKYWKRPHTFYPGHFL----TEDSRYAPSKMLEPFCVGKRACPGESLAKLEIFLTFTAIMQRYRVRFSRDYET-KVDDILRGVCGLAR 507          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2r1 (vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103038630])

HSP 1 Score: 151.369 bits (381), Expect = 2.692e-39
Identity = 118/469 (25.16%), Postives = 212/469 (45.20%), Query Frame = 2
Query:  227 LVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-------PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMT--IEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKK-LIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVN 1603
            LVLV+    K+R+PR        L  +  I S         +N S     YG  FSL LG      +N +D IK+ +Y + + F+ +          KM    N +      + R +   +F       +      +   IS EC  F+  ++    K  N  ++V+    N+   ++  +RF   D  F+ +    +  +E+    + ++++  FP+IE   F            K+++  N+++D  L+   +  +  ++H     YI +        +     SF ++ LI +  E I +  E  ++ L W+M +++ +P VQ+KVH EI D +   R P M+DK+ + Y +AV+ E+LR  + V LG F    +D  +    IP+ +++  NLY  H D K W +P  F P  FL+    N   +  R+  + F + ++  +GE L R + FL F ++ Q+F++ 
Sbjct:   35 LVLVARRLVKQRRPRGFPPGPAPLPLIGNILSLAVEPHVYMKNQSE---TYGQIFSLDLGGISTVILNGYDAIKECLYHQSEVFADRPSLPLFQKMTKMGGLLNCKYGRGWIEHRKLAVNSFR------YFGSGEAMFQRISEECMFFVDAIDTHKGKPFNPQHLVTNAVSNVTNLVIFGQRFTYDDRDFQHMIQIFSENVELAASAWAFLYNA-FPWIEYLPFG--------KHQKLFRNANKVYDFLLQIIERFSQGRVQHSPR-HYIDAYLDEMEQSAGDEATSFSRENLIFSVGELIIAGTETTTNTLRWAMLYLALYPSVQEKVHREI-DSVLNGRAPTMEDKQRMPYVEAVLHEVLRFCNIVPLGIFRATSQDTVVRGYTIPRGTMVITNLYSVHFDEKYWREPGVFCPERFLD----NNGNFMRRDAFVPFSVGRRHCLGEQLARMEMFLFFTTLLQRFRLQ 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000005452.2 (cytochrome P450 2J2-like [Source:NCBI gene;Acc:103036008])

HSP 1 Score: 149.828 bits (377), Expect = 8.266e-39
Identity = 120/431 (27.84%), Postives = 199/431 (46.17%), Query Frame = 2
Query:  332 YSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGK-WKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTL----QDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            ++ P +R++     +YG  FSL+ G  K+ FI+ + ++K+ +  + D+F  +   P            L        QR F N  L+ F   K  L  +I  E   FL +  R  +   +    ++    NI  +L+   RFE  D +F T+     + + +    ++ LY  F  LF ++                 KI+  + +I     DE+R H    + +L+  D   YI +        +S     F+ + L+V + +   +  E  ++ L W + +M  +PE+QKKV EEI  VIG+ R P M DK N+ YT+AV+ E+ R+G+ V LG   +A KD ++    IP+ + +  NL     D   W+ P  F P HFL+    +Q  +  R+  L F   ++  +GESL R + FL F S+ Q F
Sbjct:   50 FTGPDFRSIDKLSEEYGEVFSLRWGSEKVVFISGYKMVKEALVTQLDSFIDRPVVPLFHKVFKGIGVALSNGYMWKMQRKFANTHLRHFGEAKKNLELSIQQETT-FLCDAFRDEKGPFDPQYYLNNAVSNIISALVFGHRFEYHDERFLTILRLDAEAILLAGSAQSQLYNAFPGLFEYLPGP------------HQKIFANYAKIVAFLKDEVRKH----QEDLDPTDPRDYIDAYLLEMEKKNSDPEAGFNIESLVVATLDMFEAGTETAATTLRWGLLYMMKYPEIQKKVQEEIDRVIGQSRQPCMADKPNMPYTEAVVHEMQRVGNVVPLGFPKKAIKDTTLGGYFIPKGTTVNTNLSSVLNDKTEWKTPDTFNPEHFLD----DQGQFRKRDAFLPFSAGRRVCVGESLARMELFLFFTSLLQNF 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000005525.2 (cytochrome P450 2J2-like [Source:NCBI gene;Acc:103037239])

HSP 1 Score: 145.206 bits (365), Expect = 3.859e-37
Identity = 120/488 (24.59%), Postives = 205/488 (42.01%), Query Frame = 2
Query:  203 AVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIW-----MLSRT---------KIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            AV +  + L+LV  L  + + PR      P L  +  + +    +  I+     F  KYGN FS+++   +   +N + L+K++   + D F+ +   P       D+            QR F    L++F   K  L  +I +EC++ ++ +        N   +++    N+   L+   RFE  + +F+ L   M                     N  F  +  IW     M+ R          ++ + +  +F+  +RA +   + + +  +   YI                 F  + L   + +   +  E  S+ L W + +M+ +PE+Q KVH EI  V+G  R P M D++NL YT AV+ EI R+G+ +         KD+ I    IP+ + +F NL     D   WE P  F P HFLN    N  ++  RE  + F   K+  +GE L R + FL F+S+ Q+F     E +
Sbjct:   16 AVLFFCVFLLLVEYL--RNKAPRNFPPGPPTLPFIGNLHT--IDTTRIHLQFIEFAEKYGNLFSIQIFGPRAVVVNGYKLVKELYVNQGDHFADRPVFPLFHDIFKDKGLVASSGYAWKQQRRFALTTLRNFGLGKKSLEPSILLECRYLIEAMSNEQGNRFNPQFLINNAVSNVICVLVFGSRFEYSNSEFQDLLKMM---------------------NQAFYLEGTIWAQMYNMVPRIMRRLPGPHQRVIQLWGNVFN-YVRAKVDEHKMDRDFSNPRDYIDCFLEEMEKRKDDKAADFSIENLCFCAMDLFIAGTETTSTTLYWGLLYMTKYPEIQAKVHAEIDQVVGSSRQPSMMDRDNLPYTNAVIHEIQRMGNIIPFNLARATSKDVQIGEYTIPKGASVFGNLTSVLFDETEWETPKSFNPGHFLN----NDGSFRRREAFMPFSAGKRVCLGEQLARMELFLFFSSLLQRFTFKPPEGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000057879.1 (cytochrome P450 2J2-like [Source:NCBI gene;Acc:103035690])

HSP 1 Score: 142.895 bits (359), Expect = 1.770e-36
Identity = 118/436 (27.06%), Postives = 203/436 (46.56%), Query Frame = 2
Query:  347 YRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-------QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTL----QDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            +R ++    +YG  FSL+ G  KI F++ + ++K+ +  + D+F+ +  P +  F       L     IV+       QR F N  L+ F   K  L  +I  EC  FL E  ++ +   +   +++    NI  SL+   RF+  D +F+ L     + + +    +  LY  +  LF ++            M +  K+  +F     DE++ H    + NL+  D   YI +        +S     F+   L+  + +   +  E  ++ + W + +M  +PE+Q+KV  EI  VIG+ R   M D+ ++ YT AV+ EI R+G+ V LGA   A KD ++    IP+ + +  NL     D   WE P  F P HFL+K    Q  +  R+  L F   ++  +GE L R + FL FA++ Q+F+++    
Sbjct:   56 FRTINKLAEEYGEVFSLRWGSEKIVFVSGYKMVKEALVTQLDSFADR--PAVPLF----DKILSGLGLIVSNGYLWKMQRRFANTHLRGFTEGKRSLELSIQQECV-FLCEAFQAEKGPFDPHFILNNAVSNIISSLVFGHRFDYHDERFQNLLRLDSEAIALSGLTQTQLYNAYPRLFEYLPGPHQK------MFANYKMILQF---IRDEIKKH----KENLDPTDPKDYIDAFLLEIEKKTSDPAAGFNIDTLVSATLDMFEAGSETSATTIWWGLLYMMKYPEIQEKVQAEIDRVIGQSRQLNMDDRPSMPYTDAVIHEIQRMGNVVPLGATKTACKDTTLGGYFIPKGTAVNTNLSSVLYDKNEWETPNTFNPEHFLDK----QGQFRKRDAFLPFSAGRRSCLGEQLARMELFLFFATLLQRFRLSPGPG 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000005484.2 (cytochrome P450 2J2-like [Source:NCBI gene;Acc:103041822])

HSP 1 Score: 142.124 bits (357), Expect = 4.035e-36
Identity = 120/441 (27.21%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  347 YRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISME----CQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKF----RTLQDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFD---DELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTN 1627
            Y+ +     +YG+ FS++ G  K  +I  + ++K+ +  + D+F  +   P        R   L        QR F    L+ F   K  L  +I  E    C+ F KE +R  +    ++  VS     + F      RF+  D  +    RTL + +++       LY IF  LF +I                 K++  +  I D   +E+R H    + N +  D   YI +         S     FD   L   + +   +  E +++ + W++ F+  FPE+QKKV  EI  VIG+ R P + D+ N+ YT+AV+ E  R+G+ + LG   RA KDI++    IP+ + M  NL    TD   WE P  F P HFL++    Q  +  R+  + F   K+  +GE L R + FL   S+ Q+F  +       N
Sbjct:   56 YKTIDKLYKQYGDVFSVRWGSSKTVYICGYKMLKEALVTQLDSFIERPVIPLFDKIYKGRGVSLSNGYMWKMQRKFIITHLRYFGEAKKTLELSIQQESVCLCEAF-KEEKRPFDPQFYLNTAVSNIISVLIF----GHRFDYHDESYLKIQRTLVEAVSLAGSSHANLYNIFPFLFNYIRGP------------HQKVFANYFAILDFVKEEVRKH----KENWDPSDPRDYIDAYLAEMEKRKSDPEAGFDLDTLACATMDMFEAGTETLATTMRWALLFLMKFPEIQKKVQAEIDSVIGQSRQPTLADRPNMPYTEAVIHETQRMGNILPLGFPKRACKDITLGGYFIPKGTAMTTNLSSVLTDKNEWETPDIFNPGHFLDE----QGQFRKRDAFMPFSAGKRVCLGEPLARMELFLFITSLLQRFTFSPGSGEELN 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp2u1 (cytochrome P450, family 2, subfamily U, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-070730-1])

HSP 1 Score: 118.242 bits (295), Expect = 9.256e-30
Identity = 58/195 (29.74%), Postives = 101/195 (51.79%), Query Frame = 2
Query: 1103 SDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIE--NNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKE--IIRNSDGMVRTP 1675
            +  +  ++ LLW +  M  +P VQ +V  E+  V+G+ R   + D+  L  T A + E+ RL S V L   + A + +  E     IP+ S++ +NL+ CH DP++W +P  F P  FL+     +     R+  + FGI ++  +GESL R + FL F+++ Q+F   SS   S +      +++ + G+   P
Sbjct:  110 AGTDTTANTLLWCLLLMCTYPAVQARVQAELDAVVGRGRRVSLSDRPRLPLTVATIMEVQRLSSVVPLAIPHSATRSVRTELRGFTIPRGSVVLLNLWACHVDPRVWARPLLFDPERFLDPHGRLRR----RDAFMPFGIGRRSCLGESLARVELFLFFSALMQEFTFTSSAPHSPDSAPRSPVLQGTFGLTYAP 300          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 2.209e-28
Identity = 112/489 (22.90%), Postives = 218/489 (44.58%), Query Frame = 2
Query:  197 IFAVAYLILGLVLVSVLHGKKRKPRFSDQEK--PKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSD--YLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIK-KRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIR 1648
            IF + +L+L  +L  V    KR   F    K  P L +VS  K       P      V + +YG   S+ +G   + F++ +  +K+++  +   F+ +         N      +    +  +  R F    L++F   KS +  TI  E   FL E  +    + +    ++    NI  S++  KR+E  D +F+     +   ++ +   L     +FPF+ +     + +   ++++K   +F      E  A   PI+     D  ++ ++     ++S S       ++ LI+ + +   +  E  S+ L W + +M   PE+Q + HEEI  ++G +R+P M+D+ +L Y  AV+ EI R  + V  GA +    D+     +IP+ +++ +N+    +D   W+ P++F P +FL++       +   +  L F    +  +GE+L + + FL FAS+ Q F+    + +S      I++
Sbjct:   29 IFCIIFLVLRAILQEV-KATKRPLDFPPGPKVIPFLGNVSLFKK------PDVALDEVTK-QYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVG-FLIEAFKQKGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSK---QFIRDIISERHATRDPIKPMCLIDAYLSQLEKEDNPNSSFS-------EQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDGK----FVKPDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFEFYWPDLVSAPTLGYILQ 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002462.1 (pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 gene:ENSPMAG00000002249.1 transcript:ENSPMAT00000002462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 2.083e-26
Identity = 83/317 (26.18%), Postives = 143/317 (45.11%), Query Frame = 2
Query:  749 RFEVKDPKFRTL----QDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEI---FDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQ-KKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTP 1675
            RF+  D +FR L     +   IE   R  + IF    P++E+         W      I++  +++   F + +R H +  E     D +  Y+  M+  S    S+     D  L+    +   +  E  S+ L W++ +M  +P++Q ++   EI +VIG +R P   D+ NL YT AV+ E  R+ +   LG  +    D+      IP+ + + +NL     D   W+ P +F P+HFL+    N   +   +  L F    +  +GE+L R + FL F S+ Q+FK +  +  S   F      ++G+ R P
Sbjct:   26 RFDYDDKRFRNLLHLFAENFRIEGGWRGKICIF---MPWLED---------WPGPHQLIFRNADKVNLFFQERIREHRQTREAGQPRDLIDAYLDEMEKESQDPESTFT---DGNLLNVVGDLFIAGTETSSTTLRWALLYMMAYPQIQAERCQREIDEVIGGDRSPNTTDRANLPYTDAVIHEAQRMANVAPLGVLHSTTTDVKFRGYNIPKGTKVLLNLTSVLHDETQWKTPNEFNPDHFLD----NTGQFVKPDAFLAFSAGPRVCLGENLARMELFLFFTSLLQRFKFHWPDATSRPNFVA----AEGLSRAP 319          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 2.719e-24
Identity = 57/169 (33.73%), Postives = 86/169 (50.89%), Query Frame = 2
Query: 1091 ETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFK 1597
            E      E  S+ L W + FM   P++Q + H EI  V+G ER P M D+ +L Y  AV+ EI R G+ + LG  +   KD+   + + P+ + + +NL     D   W+ P  F P+HFL+K    Q   S  +  L F    +  +GESL + + FL F S+ Q F+
Sbjct:  301 ELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDK--DGQCIQS--DAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFE 465          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 102.449 bits (254), Expect = 2.632e-23
Identity = 46/187 (24.60%), Postives = 98/187 (52.41%), Query Frame = 2
Query: 1064 DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENIST 1624
            D++++  + +   + ++ I + L W + ++   P+VQ K+  EI + IG++R P  +D+ NL   +A + E+ R  + V     +   +D+ +    IP+++ +F+NL+  + DP +W  P  F P+ FL+  D  +      E++ IFG+ K++ +G+ + R + F++  ++ Q           T
Sbjct:  321 DERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDETIGRDRTPRFEDRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSH-DGKEVNKEMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLLQGLSFRVPPGTPT 506          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 55.8398 bits (133), Expect = 1.061e-8
Identity = 42/179 (23.46%), Postives = 82/179 (45.81%), Query Frame = 2
Query: 1121 SSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDK--ENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENN-IIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIR 1648
            SS+  W    ++  P+V  K+ EE + V   +   E+     E + YT  V+ E LR   PV +   Y   K+  +  N   P+ +++   LY    DP+++E P +F P  ++  S +++     ++  L+FG      +G++       + FA++  KF + +  + +     E I+
Sbjct:  342 SSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVP-YVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEA----KKNWLVFGCGPHVCLGQTYV----MITFAALLGKFALYTDFHHTVTPLSEKIK 511          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN35])

HSP 1 Score: 137.117 bits (344), Expect = 5.460e-35
Identity = 120/451 (26.61%), Postives = 208/451 (46.12%), Query Frame = 2
Query:  305 VSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQER----------IVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLL--FPFIENSKFTAKFLIWMLSRTKIYKEF--NEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            VS + ++ FY L I    +    +YG+ F L L   +   I++  + +  +  K+D FSG+       FT    DYL    R          ++ QR   +  ++ ++   S+L ST+  E     K L   + K ++  +   L + N+  +++  +R+E+ DP+F  + D      K    L   +LL   PF+      AK  I   SR   Y     +E+ D +L  H +  E     D     I++++      S          +++   +  S   E  +S L W   +M   PEVQ +VH E+ DVIG++ MP  +DK+ L Y +AV+ E LRL S V L   ++  +D ++E   IP+ + + +N++  H +   W  P  F P+ FL+ SD N +  S     L FG  ++  IGE+L + + F++ + +  KF   ++E+
Sbjct:    2 VSFVGAHYFY-LQIQIEFTKAAKQYGDVFMLCLPGERTVVISSASIARDAVLTKKDDFSGR----PYKFT---WDYLTRGSRDIAIGDFSPSLILQRKIVHSAMRSYM---SRLESTVIREVDELTKRLRSHHSKPMDPGHDFFLTTLNVICAIVYGQRYEIDDPEFLRIVD---YNEKMFRLLAAVNLLNTLPFL------AKLPI-KDSRDLEYVRITRDELLDRKLNEHRETYEEGNIRDLTDALIKALEEAKKEDSKVKDLITQDHVVLTMADAFSGGLETTTSTLRWFFVYMMSNPEVQARVHAELDDVIGRDVMPRWEDKDRLPYLEAVIAETLRLSSVVALAVPHKTIQDTTLEGYDIPKGTTVLLNIWAMHHNETEWTCPLKFDPSRFLD-SDGNFSAGSGSRSYLPFGAGRRVCIGEALAKQELFVVISRLMHKFVNETAES 430          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO42736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I4])

HSP 1 Score: 129.798 bits (325), Expect = 2.243e-32
Identity = 114/442 (25.79%), Postives = 202/442 (45.70%), Query Frame = 2
Query:  353 NLSVFRL--KYGNFFSLKLGMRKITFINNFDLIKQIMYGKE-DTFSGKWKPKMQSFT----NDRSDYLKEQERIVTQRN-------------FNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQ--DTMTIEIK-KRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEF----NEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPRE-ELLIFGIDKKQAIGESLTRAQYFLLFASIFQKF 1594
            +L+V +L   YG+ F+L++    I FIN+    K+ M GK  D F+G+  PK  +F     N +   L +  R +  R              F+N + +  +  +S++ ++  +        ++  +E +L I N++  F           K + + DP+F+ ++  +  + E+      L IF  L  F              L  ++++K F    +E+ D    AH +  +     D     +Q+          +V    D  +I+   +      E   S L W + F+ Y PEVQ +   E+ DVIG E+ P + D+E L Y +AV+ E LR+GS V L   ++A +D +     IP+ + + +NL+  H DPK W  P +FYP  F+N   SN     P +   L F + ++  +G+S+ +A+ FL+ A + Q++
Sbjct:   29 HLAVTKLVKDYGDVFTLRILGESIVFINSGAAAKEAMLGKHMDDFAGR--PKKFTFDYITRNCQDIILGDYSRALNWRRKVFHSALRMYAPRFDNIIREQIVAFESRMDASEGLP-------VDSRDEFALLILNIICSFVC--------GKTYSLDDPEFKKIKQFNIYSAEVPVATCILNIFPWLIHF-------------PLKSSRLFKGFRNTRDEVLDKIFLAHKETFQEGNIRDLADALLQAKIEIEREDKKAVGMVTDDHVIMMLSDIFGGGLESTISSLRWCVAFLIYHPEVQARAQAELDDVIG-EKFPTLADREKLPYIEAVIAETLRMGSNVPLAIPHKAIRDTAFRERAIPKGTTVLLNLWAIHRDPKEWSNPEEFYPGRFIN---SNGEFEVPSKLSFLPFSLGRRVCVGQSVAKAELFLIVARMIQRY 436          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO37670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF10])

HSP 1 Score: 118.627 bits (296), Expect = 4.281e-29
Identity = 63/237 (26.58%), Postives = 122/237 (51.48%), Query Frame = 2
Query:  905 TKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSEN 1615
            T+ Y E  E F+      ++   NN E +DL   +                  +  +++   +  ++ +E  ++ +LW + ++S  P+VQ K+H E+ +VIG  RMP++KD+ N+ Y +A + EILR+ S V L   ++A  D ++    +P+ + + +NL+  H DP+ W  P +F P+ FL+   S +   +  +  L F   ++  +GE+L + + FL+ + I  +F+ +  E 
Sbjct:  131 TRKYLEHKEKFE------IENANNNFEVNDLTDALLQAFADEKRELRKAEALTEDNIMMTMNDVFNAGFETTTTAILWLIAYLSKHPDVQDKIHAELDEVIGGSRMPQLKDRHNMPYIEATIAEILRIRSIVPLALPHKATCDTTLSGYDVPKGTTVIVNLWAIHHDPEEWLNPEEFDPSRFLDADGSYRA--AGEKSFLPFSAGRRSCLGEALAKMELFLVCSRILHQFRFSHLEG 359          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO40136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S865])

HSP 1 Score: 120.553 bits (301), Expect = 4.621e-29
Identity = 109/458 (23.80%), Postives = 200/458 (43.67%), Query Frame = 2
Query:  353 NLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF---TNDRSD--YLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRT---LQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEH------DDLITYIQXXXXXXXXXXXXXXXXF--DKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPS 1678
            +L   + KYG  FS ++G  K+      + IK+I+  K   ++G+  P   SF   T    D  +          R   +  L+ +++    L S +  + +  LK LE   E+  + S+++     ++   +   K F      F+T   L +    + +  N L++  L + F     F+A            YKE    FD  L    + +E    H      D+L+  +   +  +   +   +K+   D  LI + Y+ +++ YE  ++ L WS+ ++  +P+VQ  +  E+  V+G  RMP + D+ +L YTQAV+ E LRLG+       +    D ++    IP+++++ ++L   H  P  W+ P  F P   L   D+N    + +   L F   ++   GE+L +A+ FL  + + QKF     E     +   II+   G  + P+
Sbjct:   65 SLKGLKQKYGEVFSFQVGSWKVVQAGTPEAIKEILISKSADYAGR--PPFYSFLVETLGGKDIAFGNYGSAWKLHRKLFSTCLRQYVSNVPLLESCVGEQAKKLLKFLEYQKEQPFDPSDILMTSIADVICGITFGKYFGSWHKDFKTFLKLTNKSFGDTELNNQLFLLDLFY-FTRYFPFSA------------YKENQADFDTVLGIIRRVLEEGKAHYDTKQVDNLMMGLLKARSEAEHENEEEKKALLSDDYLIGSLYDMMAAGYETTAATLKWSIVYLVNYPDVQTTIQAELTKVVGPNRMPSINDRPHLPYTQAVIMETLRLGNVADQSIPHYTLCDTTLTGYRIPKDTVVNVDLEALHRHPVCWDNPTLFEPRRHL---DANGELVTSQGNWLPFSAGRRVCSGEALAKAELFLFLSWMLQKFHFVPEEG--EGQTPPIIKAVKGFTQNPA 502          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ60])

HSP 1 Score: 112.464 bits (280), Expect = 2.012e-26
Identity = 94/425 (22.12%), Postives = 191/425 (44.94%), Query Frame = 2
Query:  377 YGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLK-----DFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRT-KIYKEFNEIFDDELRAHLKPIENNL-----EHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            YG  ++L +G +    +N++D+ K+ +  + + F+G+    + S  +     +  Q    T R     ++K     D L     L   I+ E  +  K L    ++S +  + V+  + N+   +   +R++  + +F  L +++TI ++       F   FPF++   F+      M+ R  K  K  +++ +D+ R HLK ++N+        D     I      +   +S         +I+   + I +  E  +  LLW ++F+  +P+VQ +  E++ DV    +    + ++ L Y +A + E+LR+   + L   + A  D ++    IP+ + + +NL+    DPK+W+ P +F P  FL+      T  +  E    +G+  +   GE L R + FL    + + F+  +SE +
Sbjct:   60 YGPIYTLNMGSQLAVVLNSYDIAKEALMKRGNAFAGRPHHFVGSKFSRDGKGVGFQNYTPTLRRQQKTIMKTVKFFDTLKTGESLQEIITKEVDYLCKRLLIFGDQSFDPRHEVTFAAGNVVGRITFGERYKGGNKEFWQLMESLTIFVEGLTATS-FIDAFPFLKYVPFS------MVKRVEKAVKLRDDVLNDKFRDHLKNLQNSTISTTTNRDLTYALIDEANKTNCFANSQSDALTIDHVIMTMNDMIMAGSETPTMTLLWILYFLVKYPDVQVRAQEQVDDVSRNVQPLAWEGRKRLPYLEAFIAEVLRITGVMPLAIQHLAMADTALAGYHIPKGTTVIVNLWAMGHDPKVWDAPMEFRPERFLDSRGGFSTAST--EGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRASEAL 475          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 159.073 bits (401), Expect = 3.599e-42
Identity = 122/450 (27.11%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVT-------QRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRT-LQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSR-----TKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTP 1675
            F  KYGN FSL +   K   +N   L+K+ +  K D F  +  P++  F    SD ++ +  ++T       QR F    L++F   K  +   I  EC +  +       K  +   +++    NI   L+  +RFE  D +++  LQD   +   + +F  + + +FP             W++ R      K++   ++I D  ++  ++  + NL+      YI S                 K L   + +   +  E  ++ L W + FM ++P++Q++VH EI  VIG  R P M DKEN+ YT AV+ EI R+G  V +G    A +D  ++N  IP+ +++   L+    D  +WE P  F P HFLN+      T+  RE    FG  K+  +GE L R + FL F S  Q+F  +++        K  +    G +R+P
Sbjct:   68 FAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDR--PQIPLF----SDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVVKLQGSFSALAYNVFP-------------WLMKRFPGPLQKLFTLVDKIMD-FVKIKIEEHKENLDPACPKDYIDSFLIEMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFLNQDG----TFKKREAFFPFGAGKRVCLGEQLARMELFLFFTSFLQRFSFSTA-----GGEKPPLEGRMGTIRSP 488          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018724.2 (cytochrome P450 2J1 [Source:NCBI gene;Acc:105353996])

HSP 1 Score: 143.665 bits (361), Expect = 1.047e-36
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 2
Query:  365 FRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTN---DRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKF----RTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFD-KKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNS 1606
            F  KYGN FSL L   +   +N +  +K+ +  + D F  +  P +  F +   ++   +        QR F    L++F   K  + + I  EC +  +       K  +   +++    NI   L+  +RFE  D ++    R L D + +E      LY    +FP++          I+ L+R  I  +F +I  +E + +  P       D  +  ++  +   +         FD   + + + +   +  E  ++ L W + +M Y+P++Q+KVH EI  VIG  R P M DKE++ YT AV+ EI R+G  V  G F +A +D +++   IP+ +++   L+    D  +W+ P  F P +FL+K       +  RE    FG  K+  +GE L R + FL F S+FQ+F  ++
Sbjct:   68 FAEKYGNVFSLHLLGERTVILNGYKQVKEALVQQGDDFVDR--PTIPLFVDTIDNKGIVMSNGNSWKQQRRFALHTLRNFGLGKKTMETYIQNECHYITQTFADKQGKPFDAQFLINNAVSNIICCLVFGERFEYSDQEYQKILRNLNDLLILEGSVSAMLYN---MFPWLMKRLPGPHQKIFSLTRKII--DFVKIKINEHKGNFDPSAPEDYIDSFLIEMEKSQDKDSG--------FDIDNMCICTMDLFLAGTETTTTTLYWGLLYMIYYPDIQEKVHAEIDAVIGSSRQPSMADKESMPYTDAVIHEIQRMGDIVPQGVFRQANRDTTLDKYTIPKGTIIVPALHSVLHDESMWDNPHSFDPKNFLDKDGK----FCKREAFNPFGAGKRVCLGEQLARMELFLFFTSLFQRFSFSA 470          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2n13 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101156965])

HSP 1 Score: 142.51 bits (358), Expect = 2.999e-36
Identity = 109/418 (26.08%), Postives = 192/418 (45.93%), Query Frame = 2
Query:  377 YGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSF---TNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            YGN FS++LG +   F++ + ++K+ +  + + F  +   ++       N    +    E+   QR F    L+ F   K+ +  +I  E +H  +++E       + + + +    NI   L++ KRF+  D  F+ +   ++  ++    ++ I +  FP +       K L    S  KI++ + +I  D L   +K  + +L+ ++   YI S         +S     D  L   S +   +  E  S+ L+W++ ++   P+VQ KV +EI  VIG+ R+P M D+ NL YT AV+ EI R+G+ V L     A KD ++    IP+ + +   L     D   WE P  F P HFL+        +  +E  L F   K+  +GE L R + FL    + QKF  +  E +
Sbjct:   69 YGNVFSVRLGSQATVFVSGYKMVKEALVTQAENFVDRPFSEIGGRFYEGNSNGLFFSNGEKWKKQRRFALSTLRTFGLGKNTMEQSICEEIRHLQQQIENEKGGPFSPAGLFNNAVSNIICQLVMGKRFDYDDNNFQVMMKYISEAVQLEGSIWGILYESFPGL------MKHLPG--SHNKIFRNY-KIVQDFLAQEIKIHKQDLDPNNPRDYIDSFIIEMEKHQNSDLGFNDANLAFCSLDLFVAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVVHEIQRIGNIVPLNGLRVAAKDTTLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDADGK----FVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFSFSVPEGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2n13 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101156566])

HSP 1 Score: 141.354 bits (355), Expect = 6.825e-36
Identity = 112/430 (26.05%), Postives = 187/430 (43.49%), Query Frame = 2
Query:  377 YGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGK-WKPKMQSFTNDRSD--YLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRT----LQDTMTIEIKKRNFLY------IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFN---EIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            YGN FS++ G     F++ + ++K+ +  + + F  + + P    F    ++  ++   E+   QR F    L+ F   K+ +   I  E +H   E+E    +    + + +    NI   L++ KRF+  D  F T    L + + +E      LY      + HL  P                   +++K+F+   +  D E++ H K ++ N   D    YI S         +S     +  L   S +   +  E  S+ L+W++ ++   P+VQ KV +EI  VIG+ R+P M D+ NL YT AV+ EI R G+ V L     A KD ++    IP+ + +   L     D   WE P  F P HFL+        +  +E  L F   K+  +GE L R + FL    + QKF  +  E +
Sbjct:   69 YGNVFSVRFGSETSVFVSGYKMVKEALVTQAENFVDRPYSPMATRFYQGPTNGIFMSNGEKWKKQRRFALSTLRTFGLGKNTMEQCICEEIRHLQAEIESEKGQLFTPTGLFNNAVSNIVCQLVMGKRFDYNDHDFHTMIKYLSEVLRLEGSVWGLLYEAFPGLMKHLPGP-----------------HNEMFKDFDILRDFLDQEIKMHKKDLDRNNPRD----YIDSFLIEMEKHQNSDLGFNEANLAFCSLDLFLAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVIHEIQRFGNIVPLNGLRVAAKDTTLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDADGK----FVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFSFSVPEGV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 139.043 bits (349), Expect = 7.143e-35
Identity = 117/431 (27.15%), Postives = 182/431 (42.23%), Query Frame = 2
Query:  347 YRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWK-PKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQ----DTMTIEIKKRNFLY-IFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKK-LIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENI 1618
            + + S    +YG+ +SL+ G R    +N    +K+ +  K D+   +   P                     QR F    L+ F   K  L   I  E  H  +EL+R   + L+   +++    NI   L+   RF   D KF+ L       + IE      LY  F L+   +     T +          I++E  +   +EL+ H K    + +  D   YI                +FD++ LI+   +   +  E  S+ L W+  +M+ +PE+Q+KV  EI  VIGK R P M+D+  L YT AV+ E+ R+G+ V L   +   KD+ +    IP+  L+  NL     D K WE P  F P HFLNK       +  R   + F   K+  +GE+L R + FL F S  Q F  +    +
Sbjct:   86 HESFSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKFKKLMLLFDRALQIEASIWAQLYNSFTLIMRCLPGPHKTLQ---------HIWREVQDFIGEELKEHKK----SWDPSDARDYIDFYLTEIQKTKGQEGSTFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLNKDGK----FVKRGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHFSFSMPAGV 499          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000003402.1 (SMESG000003402.1)

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 507/508 (99.80%), Postives = 507/508 (99.80%), Query Frame = 2
Query:  182 MAWHIIFAVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFHIL 1705
            MAWHIIFAVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVSLFSFNIFFSLLLDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQSMKYYSTSLSSSVRKSFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIV VIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFHIL
Sbjct:    1 MAWHIIFAVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVSLFSFNIFFSLLLDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQSMKYYSTSLSSSVRKSFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVYVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFHIL 508          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000022100.1 (SMESG000022100.1)

HSP 1 Score: 350.903 bits (899), Expect = 1.521e-114
Identity = 182/473 (38.48%), Postives = 295/473 (62.37%), Query Frame = 2
Query:  335 SLPIYRNLSVFRL-----------------KYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKMQSFTNDRSDYL-KEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFH 1699
            +LPI R + +F +                 KYG+ FS+K GMR++  +NNF +IK+ +  + D FSG+W+ K+++  +  +  L  + +   TQR F  K+L+DF   KS+    +  EC+  L+EL+   E  ++IS ++ +++ NI    +++KRFE  DPK + ++  +    KK N L I HL+FP +++S   + F +W+ SR K++    ++F++E++ HL+ ++ N E +DLI      K      + + +   DK+LI  ++E   + YE  S+ L WSM FM+ +P +Q KV +EI + IG E++P M DK++L YTQAVMDEILRL S   LG ++R F D S++N  IP+NSL+F N + CHTDP+ W KPF+F+P HF++ +++ +  Y+PRE+L+ FGI K+Q IGESL + ++F+ F SIFQ F+V  +ENIS   ++E +  +DG++R   IKN++FH
Sbjct:   45 NLPIVRGIPIFGILFQKKEPLHIFLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKTLKDEGDNFSGRWQTKLKTVISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFILEELKSLQETVVDISKLIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSGIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNHQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQNKVFDEIRENIGLEKIPIMNDKKSLTYTQAVMDEILRLSSVAPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMEFFIFFVSIFQSFEVKFAENISDKLYQENLEGNDGIIRYSKIKNFIFH 517          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072738.1 (SMESG000072738.1)

HSP 1 Score: 329.331 bits (843), Expect = 2.295e-106
Identity = 176/493 (35.70%), Postives = 298/493 (60.45%), Query Frame = 2
Query:  227 LVLVSVLHGKKRKP--RFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM-QSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVF 1696
            ++L+    GK+ +   R    + P +  +  I S L   LP++  L      YG  + +KLG R+I   N+F+++KQ      ++FSG+W   + +  T+D   +LK+ E  V QR F  K+L+DF   +SK   T+  EC+  L E++    K ++ S ++ +++ NI    +++KRF  +DPK + +++ +   +KK +F+ +F+L+FP  ENS    K L+ + +  K+  E ++ F  E+ +H K ++ N + +D+I      +      + S+    + +LI NS+E + + YE  S+ L+WS+ FMS   ++Q+KV++EIV VIGKE++P + DK+++ YTQA+MDEILR+ S   L +F+RA  D S +   +P+++L+F NLY CH DP +W  P +FYPNHFL+  D+    Y PREEL+ FGI K+Q +GESL R +YF+ F SI Q+FKV  +E ++  +++E++R +DG++R     N++F
Sbjct:   10 IILILYYFGKRWRSGQRILRNQAPLVKGLPLIGSLLDIKLPLHIYLKELSEIYGPVYRIKLGFREILVFNSFEILKQTFKLDGNSFSGRWSTCLFKVLTHDSGIFLKDGEVWVKQRAFVQKVLRDFGVGRSKSSETVQFECESCLDEIKLLVGKKVDFSQLIPIYTLNIISKFIMNKRFCREDPKIKMIENVLLEFLKKADFVTMFYLVFPCFENSSLVFKILMKLQAHLKMVIEIHDSFKKEIESHQKVLDLNSDGEDMIDRFLLEQKRVREKTGSIDTFTEWQLIRNSFEMLVAGYETTSTTLVWSLMFMSRHQDIQEKVYKEIVSVIGKEKLPSISDKKDMDYTQAIMDEILRMSSVTPLASFHRAMIDCSAKGFFVPKDTLIFPNLYACHFDPDVWINPSEFYPNHFLSTDDNIPMKYCPREELIPFGIGKRQCLGESLARMEYFIFFCSILQRFKVRFAEEMTEMRYQEVLRGNDGVIRICLETNFIF 502          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072726.1 (SMESG000072726.1)

HSP 1 Score: 326.635 bits (836), Expect = 3.208e-105
Identity = 174/494 (35.22%), Postives = 293/494 (59.31%), Query Frame = 2
Query:  227 LVLVSVLHGKK--RKPRFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM-QSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFH 1699
            ++L+    GK+   + R    + P +  +  I S L   LP++  L      YG  + +KLG R+I   N+F+++KQ      ++FSG+W   + +  T+D      + E    QR F  K+L+DF   +SK    +  EC+  L E+++   K ++ S ++ +++ NI    +++KRF  +DPK + +Q  M   +KK +F+ IF+L+FP+ ENS    KF + + +  K+  +  +  ++E+  H K ++ N + +D+I      +      + SV    + +LI NS+E + + YE  S+ L+WS+ FMS   ++Q+KV++EIV VIGKE++P + DK+++ YTQA+MDEILR+ S   L +F+RA  D S +   +P+++L+F NLY CH DP +W  P +FYPNHFL+  D+    Y PREEL+ FGI K+Q +GESL R +YF+ F SI Q+FKV  +E ++  +++E++R +DG++R     N++F 
Sbjct:   10 IILILYYFGKRWRSRQRILRNQAPLVKGLPLIGSLLDIKLPLHIYLKDLSQIYGPVYRIKLGFREILVFNSFEILKQTFKLDGNSFSGRWSTCLFKVLTHDSGIIFTDGEVWAKQRAFMQKVLRDFGVGRSKSSEIVQFECESCLDEIKQLAGKKVDFSQLIPIYTLNIISKFIMNKRFCREDPKLKFMQKMMLDSLKKIDFVLIFYLVFPYFENSSLVFKFFMKLTTHLKMVLKIYDSLNEEIETHQKLLDLNSDGEDMIDRFLLEQKKVMEKTGSVDTFTEWQLIRNSFEMLVAGYETTSTTLVWSLMFMSRHQDIQEKVYKEIVSVIGKEKLPSINDKKDMDYTQAIMDEILRMSSVTPLASFHRAMIDCSAKGFFVPKDTLIFPNLYACHFDPDVWSNPSEFYPNHFLSTDDNIPMKYCPREELIPFGIGKRQCLGESLARMEYFIFFCSILQRFKVRFAEEMTEMRYQEVLRGNDGVIRICLETNFIFE 503          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072730.1 (SMESG000072730.1)

HSP 1 Score: 326.25 bits (835), Expect = 3.421e-105
Identity = 174/494 (35.22%), Postives = 293/494 (59.31%), Query Frame = 2
Query:  227 LVLVSVLHGKKRKP--RFSDQEKPKLNDVSTIKSYLFYSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFSGKWKPKM-QSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTISMECQHFLKELERSNEKSLNISNMVXXXXXXXXXXXXXDKRFEVKDPKFRTLQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNEIFDDELRAHLKPIENNLEHDDLITYIQXXXXXXXXXXXXXXXXFDKKLIVNSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEMKDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFINLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQAIGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSIKNYVFH 1699
            ++L+    GK+ +   R    + P +  +  I S L   LP++  L      YG  + +KLG R+I   N+F+++KQ      ++FSG+W   + +  T+D      + E    QR F  K+L+DF   +SK    +  EC+  L E+++   K ++ S ++ +++ NI    +++KRF  +DPK + +Q  M   +KK +F+ IF+L+FP+ ENS    KF + + +  K+  +  +  ++E+  H K ++ N + +D+I      +      + SV    + +LI NS+E + + YE  S+ L+WS+ FMS   ++Q+KV++EIV VIGKE++P + DK+++ YTQA+MDEILR+ S   L +F+RA  D S +   +P+++L+F NLY CH DP +W  P +FYPNHFL+  D+    Y PREEL+ FGI K+Q +GESL R +YF+ F SI Q+FKV  +E ++  +++E++R +DG++R     N++F 
Sbjct:   10 IILILYYFGKRWRSCQRILRNQAPLVKGLPLIGSLLDIKLPLHIYLKDLSQIYGPVYRIKLGFREILVFNSFEILKQTFKLDGNSFSGRWSTCLFKVLTHDSGIIFTDGEVWAKQRAFMQKVLRDFGVGRSKSSEIVQFECESCLDEIKQLAGKKVDFSQLIPIYTLNIISKFIMNKRFCREDPKLKFMQKMMLDSLKKIDFVLIFYLVFPYFENSSLVFKFFMKLTTHLKMVLKIYDSLNEEIETHQKLLDLNSDGEDMIDRFLLEQKKVMEKTGSVDTFTEWQLIRNSFEMLVAGYETTSTTLVWSLMFMSRHQDIQEKVYKEIVSVIGKEKLPSINDKKDMDYTQAIMDEILRMSSVTPLASFHRAMIDCSAKGFFVPKDTLIFPNLYACHFDPDVWSNPSEFYPNHFLSTDDNIPMKYCPREELIPFGIGKRQCLGESLARMEYFIFFCSILQRFKVRFAEEMTEMRYQEVLRGNDGVIRICLETNFIFE 503          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2J23.220e-3627.08cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2B63.343e-3325.95cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
CYP2U11.566e-3239.51cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2U17.323e-3139.51cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2D61.399e-3035.59cytochrome P450 family 2 subfamily D member 6 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-14A12.063e-2635.26CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A26.019e-2424.80CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A51.236e-2324.80CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C91.016e-2223.36CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-34A94.397e-2222.31CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a12.885e-3026.16gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a12.885e-3026.16gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp304a11.386e-1827.84gene:FBgn0038095 transcript:FBtr0082691[more]
Cyp303a17.768e-1621.86gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a17.768e-1621.86gene:FBgn0001992 transcript:FBtr0080828[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2p91.177e-3525.06cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2p81.484e-3525.23cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2p109.208e-3524.19cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2p109.208e-3524.19cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2r11.730e-3426.07cytochrome P450, family 2, subfamily R, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp11a16.172e-3426.44cytochrome P450 family 11 subfamily A member 1 [So... [more]
cyp11a12.002e-3336.72cytochrome P450 family 11 subfamily A member 1 [So... [more]
cyp11a12.080e-3336.72cytochrome P450 family 11 subfamily A member 1 [So... [more]
cyp11a12.245e-3326.20cytochrome P450 family 11 subfamily A member 1 [So... [more]
cyp11a12.310e-3326.20cytochrome P450 family 11 subfamily A member 1 [So... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2j83.140e-3427.06cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2b199.088e-3426.04cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2g11.671e-3325.00cytochrome P450, family 2, subfamily g, polypeptid... [more]
Cyp2b104.193e-3325.95cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b101.728e-3125.65cytochrome P450, family 2, subfamily b, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51589|CP2J2_HUMAN1.547e-3527.08Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP... [more]
sp|P52786|CP2J1_RABIT1.567e-3426.98Cytochrome P450 2J1 OS=Oryctolagus cuniculus OX=99... [more]
sp|O55071|CP2BJ_MOUSE6.357e-3326.04Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=C... [more]
sp|P12789|CP2B5_RABIT8.211e-3325.75Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=99... [more]
sp|P20813|CP2B6_HUMAN1.605e-3225.95Cytochrome P450 2B6 OS=Homo sapiens OX=9606 GN=CYP... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U8U4731.501e-10938.81Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A4P8NYX53.763e-9336.42P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A1I8IZM69.563e-4426.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E0A34.173e-4326.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GXQ85.220e-4127.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2r12.692e-3925.16vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000005452.28.266e-3927.84cytochrome P450 2J2-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000005525.23.859e-3724.59cytochrome P450 2J2-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000057879.11.770e-3627.06cytochrome P450 2J2-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000005484.24.035e-3627.21cytochrome P450 2J2-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2u19.256e-3029.74cytochrome P450, family 2, subfamily U, polypeptid... [more]
ENSPMAT00000011205.12.209e-2822.90pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000002462.12.083e-2626.18pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 g... [more]
ENSPMAT00000011254.12.719e-2433.73pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp1d12.632e-2324.60cytochrome P450, family 1, subfamily D, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ERG51.061e-823.46C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469995.460e-3526.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427362.243e-3225.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376704.281e-2926.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401364.621e-2923.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465062.012e-2622.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018818.23.599e-4227.11cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000018724.21.047e-3626.54cytochrome P450 2J1 [Source:NCBI gene;Acc:10535399... [more]
cyp2n132.999e-3626.08cytochrome P450 2J6 [Source:NCBI gene;Acc:10115696... [more]
cyp2n136.825e-3626.05cytochrome P450 2J6 [Source:NCBI gene;Acc:10115656... [more]
ENSORLT00000020799.27.143e-3527.15cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003402.10.000e+099.80SMESG000003402.1[more]
SMESG000022100.11.521e-11438.48SMESG000022100.1[more]
SMESG000072738.12.295e-10635.70SMESG000072738.1[more]
SMESG000072726.13.208e-10535.22SMESG000072726.1[more]
SMESG000072730.13.421e-10535.22SMESG000072730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010476 ID=SMED30010476|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1727bp
GGAGTCCATGAATGATCAGAACTAGACATTGTTGATTCACGAAAATTACT
TTGACCACATGTTATATTATTTATCAATTTTGACCAACCAAATAAACTTT
ATTCCCAGCCAATCACATTTACAATAACAGTCTGACAAGTGGATATAAAT
ACCAAACAATTCAACGTGAAATTATTCAACAATGGCATGGCATATTATTT
TCGCGGTGGCATACCTGATTCTAGGCCTAGTCCTGGTCTCGGTGCTCCAT
GGTAAAAAACGGAAACCTAGGTTCAGTGATCAGGAAAAACCAAAACTGAA
CGATGTATCGACGATAAAATCGTATTTGTTCTACAGCCTACCAATCTATA
GAAATCTCTCGGTGTTTCGGTTAAAATACGGCAACTTTTTCAGTTTGAAA
CTAGGAATGAGAAAAATAACTTTCATCAACAATTTTGATTTGATCAAACA
AATAATGTATGGCAAAGAAGACACATTTTCCGGAAAATGGAAACCCAAAA
TGCAAAGTTTTACCAATGACAGATCTGACTACTTAAAAGAACAAGAAAGA
ATTGTTACTCAAAGAAATTTTAATAACAAATTACTGAAAGATTTTCTCAC
AGAAAAATCAAAATTGTGCTCAACTATTTCAATGGAATGCCAACATTTTC
TCAAAGAATTGGAAAGAAGTAATGAAAAATCTCTGAATATATCCAATATG
GTTTCTCTATTTTCATTTAACATATTTTTCTCACTGTTATTGGATAAAAG
ATTTGAAGTTAAAGATCCAAAATTTAGAACCCTTCAAGATACCATGACAA
TAGAAATTAAAAAGCGCAACTTTTTGTACATTTTCCATTTGCTTTTTCCG
TTTATTGAAAACTCAAAATTCACTGCCAAATTCCTCATTTGGATGCTGTC
AAGGACAAAGATTTACAAAGAATTTAATGAAATTTTCGATGATGAACTTA
GAGCTCATTTGAAACCCATTGAAAACAATTTGGAACATGACGATCTGATA
ACATACATCCAGTCAATGAAATATTATTCTACAAGTCTCAGCAGTTCTGT
GAGAAAATCTTTCGACAAAAAGTTGATTGTTAATTCGTATGAGACGATCT
CATCGGACTATGAAATAATCTCATCTATACTGTTATGGAGCATGTTTTTC
ATGTCATATTTTCCGGAAGTTCAAAAGAAAGTTCACGAAGAAATAGTTGA
TGTGATTGGCAAAGAAAGGATGCCTGAAATGAAGGATAAAGAAAATTTGC
ATTACACTCAAGCCGTTATGGATGAAATTCTTAGACTTGGATCACCAGTT
TTCCTAGGAGCGTTTTACAGAGCATTCAAAGATATTTCTATAGAGAATAA
TATTATTCCCCAAAATAGCTTGATGTTTATAAATTTATATGGCTGTCACA
CCGATCCAAAGTTATGGGAGAAACCATTCGATTTTTATCCTAATCATTTC
CTTAATAAATCTGACAGTAACCAAACTACATATTCCCCAAGGGAAGAACT
TCTTATCTTTGGAATTGATAAAAAGCAAGCAATTGGTGAATCCTTGACTA
GAGCTCAGTACTTCCTTTTATTCGCAAGTATTTTCCAGAAATTCAAGGTG
AATTCTAGTGAAAATATTTCAACAAACAAGTTCAAAGAAATAATTCGCAA
CAGTGACGGAATGGTAAGGACACCGAGCATTAAGAATTATGTTTTTCACA
TATTATAATTGCAAAAGCGTTTTTTGT
back to top

protein sequence of SMED30010476-orf-1

>SMED30010476-orf-1 ID=SMED30010476-orf-1|Name=SMED30010476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MAWHIIFAVAYLILGLVLVSVLHGKKRKPRFSDQEKPKLNDVSTIKSYLF
YSLPIYRNLSVFRLKYGNFFSLKLGMRKITFINNFDLIKQIMYGKEDTFS
GKWKPKMQSFTNDRSDYLKEQERIVTQRNFNNKLLKDFLTEKSKLCSTIS
MECQHFLKELERSNEKSLNISNMVSLFSFNIFFSLLLDKRFEVKDPKFRT
LQDTMTIEIKKRNFLYIFHLLFPFIENSKFTAKFLIWMLSRTKIYKEFNE
IFDDELRAHLKPIENNLEHDDLITYIQSMKYYSTSLSSSVRKSFDKKLIV
NSYETISSDYEIISSILLWSMFFMSYFPEVQKKVHEEIVDVIGKERMPEM
KDKENLHYTQAVMDEILRLGSPVFLGAFYRAFKDISIENNIIPQNSLMFI
NLYGCHTDPKLWEKPFDFYPNHFLNKSDSNQTTYSPREELLIFGIDKKQA
IGESLTRAQYFLLFASIFQKFKVNSSENISTNKFKEIIRNSDGMVRTPSI
KNYVFHIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 360..378
score: 30.12
coord: 401..425
score: 38.89
coord: 450..473
score: 32.97
coord: 63..82
score: 29.3
coord: 177..195
score: 25.62
coord: 87..108
score: 15.72
coord: 317..343
score: 38.05
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 49..500
e-value: 3.2E-73
score: 249.2
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 51..478
IPR001128Cytochrome P450PFAMPF00067p450coord: 54..477
e-value: 1.6E-56
score: 192.0
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 57..494
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
NoneNo IPR availableTMHMMTMhelixcoord: 168..187