EF Hand type protein

Overview
NameEF Hand type protein
Smed IDSMED30010475
Length (bp)2943
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF Hand type protein (SMED30010475) t-SNE clustered cells

Violin plots show distribution of expression levels for EF Hand type protein (SMED30010475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF Hand type protein (SMED30010475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF Hand type protein (SMED30010475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010475SMESG000065951.1 SmedASXL_010261SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010475SMESG000065951.1 dd_Smed_v6_8441_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010475SMESG000065951.1 dd_Smed_v4_8441_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF Hand type protein vs. Ensembl Fly
Match: CG10841 (gene:FBgn0038163 transcript:FBtr0309093)

HSP 1 Score: 219.55 bits (558), Expect = 5.263e-60
Identity = 181/674 (26.85%), Postives = 324/674 (48.07%), Query Frame = 2
Query:  923 KESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQIL-TIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQ--SYVG--HVVDEEAPP----PSMPLDRDWKTL--------VTPVV-----KTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFV--LPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRD-------TEAVMDKI----KAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPN---SFDYMSFCEEIESIFA---TKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIG---DVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAF 2812
            K + LS  E++ + ++++  DG ++YR FC+ + +      L K    D            V ++   E+  ++  IL  + +      I + PYF+D+++   +  ++T   F+R LHF+ + ++  D  LL R++       VNY AF + ID   +Y+G  H++D         P   +D +   L        V P+        K +    D+L   I++ +  N++R   F E +D+L  G +  NQF R L+++G+ K     +T  +   L++ Y D    +  RW +F  ++D+VFT  NLE  P+  V      +  LP+PG V W + +  ++ L E AM++++ ++  RR+++ P F+++DKLN GHV     +Q+     + L++ E D + +R+ N+ GF Y +FLD++D   PAEY        +  + +K+  +E  P  RD       +E V+ +I    K Q   + V +I+F KD+D    G +  + F+RAL+ +++ + E E ++L + FR   PN      Y  FC+ ++ IF    T   ++     P  + P+ +     L  +E    S A+ ++    D +      L  LF DFD     +++QNQF R +   D+   LS  ++  + K F    G+  + NY  F
Sbjct:   66 KVAGLSESELRDVTDYFQIRDGRVAYRQFCKVVCSE----TLHKTAKSDLATGLEWNDPWHVNVVPQPEDRRRLCLILLKIAQLCN---IPLMPYFQDYELIAQNVGVVTVAHFSRVLHFMKIPLSESDFLLLLRRYMKD-GYLVNYVAFLKHIDNIIAYLGEHHLLDNSHDIIKDFPGRLVDLELSQLPAIDGCKAVHPIFPDACSTPKKNRNQCDILFC-IQNYIYKNQVRTSEFLECYDSLNVGSITKNQFERGLSNMGVGKY----LTQREMSILLERYTDPVDINRVRWRNFADEIDTVFTIKNLEKMPQCVVESPLRHIQELPRPGAVPWESVSANVRDLCEDAMAKIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRTNGILLSDPEQDSVLSRYGNELGFCYTKFLDDVD---PAEYA-------MPALVTKQQLVECPPFARDNLDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVIIKEEEANILCNIFRS--PNRVSCIRYRDFCKALDEIFIQLDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDERTICSQALMKLARKPDEIS----NLSQLFKDFDREQCGSITQNQFLRGITVRDMHVMLSSREFQAICKCFGVKKGMCMEFNYREF 710          

HSP 2 Score: 95.5153 bits (236), Expect = 8.831e-20
Identity = 162/717 (22.59%), Postives = 296/717 (41.28%), Query Frame = 2
Query:  164 DKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSD--GGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMS--YKDFDV--HNIGLITESQFYRGFPGPK-DITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEID----------ERVRLPQ------------ERCDSPSVQLIEDRIRFTV----HKRGIRIMDFLTDYDKLRHDAVTENQFVCGLS-MAIGKESNLSRGEIQKIANFYRRPDGF--ISYRDFCRNMDNPFHVLDLEKDP----------LKDAPYP---PTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFD-ISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDV-------LMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFV-LPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMH--LTEEEMDIIQARFANDDG----FNYFEFLDNLD 2122
            D   SG+V+   F   L +   V    E E + V  Y     GR+ ++ FC VV  +     LH   K  +    E+           PE   +L  IL ++ Q       NI +   ++D+++   N+G++T + F R     K  +++++  LL+R+Y   ++  ++NY+     +  I     +   +    +I           E  +LP             + C +P     +  I F +    +K  +R  +FL  YD L   ++T+NQF  GLS M +GK   L++ E+  +   Y  P     + +R+F   +D  F + +LEK P          +++ P P   P  ++S  V+ L           +A +K +++ RR+ + P+F+ +D +++ H +     Q  RT   L  D   E   +L+R        E+ +  +T+ +D        D +    +MP     + LV      + +  P DV       +++  +   +   + +  F +D+D  R G +  + F R L +  +       I   +   L   +    +    R+ DF + +D +F +  L++    +V+     + LP    VD   +  E + +   A+ +L RK  E   ++   F+ FD+   G +T   F + +T+ +MH  L+  E   I   F    G    FNY EFL  LD
Sbjct:   45 DPCCSGFVSEPIFTAVLGKYRKVAGLSESELRDVTDYFQIRDGRVAYRQFCKVVCSE----TLHKTAKSDLATGLEWNDPWHVNVVPQPEDRRRLCLILLKIAQLC-----NIPLMPYFQDYELIAQNVGVVTVAHFSRVLHFMKIPLSESDFLLLLRRYM--KDGYLVNYVAFLKHIDNIIAYLGEHHLLDNSHDIIKDFPGRLVDLELSQLPAIDGCKAVHPIFPDACSTPKKNRNQCDILFCIQNYIYKNQVRTSEFLECYDSLNVGSITKNQFERGLSNMGVGKY--LTQREMSILLERYTDPVDINRVRWRNFADEIDTVFTIKNLEKMPQCVVESPLRHIQELPRPGAVPWESVSANVRDLC-------EDAMAKIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRTNGILLSD--PEQDSVLSR-----YGNELGF-CYTKFLD--------DVDPAEYAMPALVTKQQLVECPPFARDNLDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVI------IKEEEANILCNIFRSPNRVSCIRYRDFCKALDEIFIQ--LDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDE-RTICSQALMKLARKPDEIS-NLSQLFKDFDREQCGSITQNQFLRGITVRDMHVMLSSREFQAICKCFGVKKGMCMEFNYREFLKILD 715          

HSP 3 Score: 55.4546 bits (132), Expect = 2.446e-7
Identity = 79/334 (23.65%), Postives = 139/334 (41.62%), Query Frame = 2
Query:  104 KLKETCDTKRIRINEFFLDFDKLRSGYV---TNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVD-KKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPE--SEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDIT-DTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRF---TVHKRGI-----------RIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFI---SYRDFCRNMDNPF 1033
            K+K     +R+ ++ FF  +DKL SG+V      Q FRT     G+  S  E+  ++++Y +     +  F D VD  ++   AL    K Q+   P +         L PE  SE  ++ IL    +    +   +    KD+D H  G I ES F R       I  + E  +L   +R+P   + I Y +      A++EI      IQ    + ++V         P++  ++  + F   T+  + +            +     D+D+ +  ++T+NQF+ G+++       LS  E Q I   +    G     +YR+F + +D  F
Sbjct:  405 KIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRT----NGILLSDPEQDSVLSRYGNELGFCYTKFLDDVDPAEYAMPALVT--KQQLVECPPFARDN-----LDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVIIKEEEANILCNIFRSPNRVSCIRYRDF---CKALDEIF-----IQLDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDERTICSQALMKLARKPDEISNLSQLFKDFDREQCGSITQNQFLRGITVR-DMHVMLSSREFQAICKCFGVKKGMCMEFNYREFLKILDVLF 718          
BLAST of EF Hand type protein vs. Ensembl Fly
Match: CG10841 (gene:FBgn0038163 transcript:FBtr0082795)

HSP 1 Score: 219.55 bits (558), Expect = 5.821e-60
Identity = 181/674 (26.85%), Postives = 324/674 (48.07%), Query Frame = 2
Query:  923 KESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQIL-TIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQ--SYVG--HVVDEEAPP----PSMPLDRDWKTL--------VTPVV-----KTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFV--LPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRD-------TEAVMDKI----KAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPN---SFDYMSFCEEIESIFA---TKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIG---DVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAF 2812
            K + LS  E++ + ++++  DG ++YR FC+ + +      L K    D            V ++   E+  ++  IL  + +      I + PYF+D+++   +  ++T   F+R LHF+ + ++  D  LL R++       VNY AF + ID   +Y+G  H++D         P   +D +   L        V P+        K +    D+L   I++ +  N++R   F E +D+L  G +  NQF R L+++G+ K     +T  +   L++ Y D    +  RW +F  ++D+VFT  NLE  P+  V      +  LP+PG V W + +  ++ L E AM++++ ++  RR+++ P F+++DKLN GHV     +Q+     + L++ E D + +R+ N+ GF Y +FLD++D   PAEY        +  + +K+  +E  P  RD       +E V+ +I    K Q   + V +I+F KD+D    G +  + F+RAL+ +++ + E E ++L + FR   PN      Y  FC+ ++ IF    T   ++     P  + P+ +     L  +E    S A+ ++    D +      L  LF DFD     +++QNQF R +   D+   LS  ++  + K F    G+  + NY  F
Sbjct:   67 KVAGLSESELRDVTDYFQIRDGRVAYRQFCKVVCSE----TLHKTAKSDLATGLEWNDPWHVNVVPQPEDRRRLCLILLKIAQLCN---IPLMPYFQDYELIAQNVGVVTVAHFSRVLHFMKIPLSESDFLLLLRRYMKD-GYLVNYVAFLKHIDNIIAYLGEHHLLDNSHDIIKDFPGRLVDLELSQLPAIDGCKAVHPIFPDACSTPKKNRNQCDILFC-IQNYIYKNQVRTSEFLECYDSLNVGSITKNQFERGLSNMGVGKY----LTQREMSILLERYTDPVDINRVRWRNFADEIDTVFTIKNLEKMPQCVVESPLRHIQELPRPGAVPWESVSANVRDLCEDAMAKIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRTNGILLSDPEQDSVLSRYGNELGFCYTKFLDDVD---PAEYA-------MPALVTKQQLVECPPFARDNLDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVIIKEEEANILCNIFRS--PNRVSCIRYRDFCKALDEIFIQLDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDERTICSQALMKLARKPDEIS----NLSQLFKDFDREQCGSITQNQFLRGITVRDMHVMLSSREFQAICKCFGVKKGMCMEFNYREF 711          

HSP 2 Score: 95.5153 bits (236), Expect = 9.478e-20
Identity = 162/717 (22.59%), Postives = 296/717 (41.28%), Query Frame = 2
Query:  164 DKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSD--GGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMS--YKDFDV--HNIGLITESQFYRGFPGPK-DITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEID----------ERVRLPQ------------ERCDSPSVQLIEDRIRFTV----HKRGIRIMDFLTDYDKLRHDAVTENQFVCGLS-MAIGKESNLSRGEIQKIANFYRRPDGF--ISYRDFCRNMDNPFHVLDLEKDP----------LKDAPYP---PTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFD-ISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDV-------LMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFV-LPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMH--LTEEEMDIIQARFANDDG----FNYFEFLDNLD 2122
            D   SG+V+   F   L +   V    E E + V  Y     GR+ ++ FC VV  +     LH   K  +    E+           PE   +L  IL ++ Q       NI +   ++D+++   N+G++T + F R     K  +++++  LL+R+Y   ++  ++NY+     +  I     +   +    +I           E  +LP             + C +P     +  I F +    +K  +R  +FL  YD L   ++T+NQF  GLS M +GK   L++ E+  +   Y  P     + +R+F   +D  F + +LEK P          +++ P P   P  ++S  V+ L           +A +K +++ RR+ + P+F+ +D +++ H +     Q  RT   L  D   E   +L+R        E+ +  +T+ +D        D +    +MP     + LV      + +  P DV       +++  +   +   + +  F +D+D  R G +  + F R L +  +       I   +   L   +    +    R+ DF + +D +F +  L++    +V+     + LP    VD   +  E + +   A+ +L RK  E   ++   F+ FD+   G +T   F + +T+ +MH  L+  E   I   F    G    FNY EFL  LD
Sbjct:   46 DPCCSGFVSEPIFTAVLGKYRKVAGLSESELRDVTDYFQIRDGRVAYRQFCKVVCSE----TLHKTAKSDLATGLEWNDPWHVNVVPQPEDRRRLCLILLKIAQLC-----NIPLMPYFQDYELIAQNVGVVTVAHFSRVLHFMKIPLSESDFLLLLRRYM--KDGYLVNYVAFLKHIDNIIAYLGEHHLLDNSHDIIKDFPGRLVDLELSQLPAIDGCKAVHPIFPDACSTPKKNRNQCDILFCIQNYIYKNQVRTSEFLECYDSLNVGSITKNQFERGLSNMGVGKY--LTQREMSILLERYTDPVDINRVRWRNFADEIDTVFTIKNLEKMPQCVVESPLRHIQELPRPGAVPWESVSANVRDLC-------EDAMAKIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRTNGILLSD--PEQDSVLSR-----YGNELGF-CYTKFLD--------DVDPAEYAMPALVTKQQLVECPPFARDNLDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVI------IKEEEANILCNIFRSPNRVSCIRYRDFCKALDEIFIQ--LDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDE-RTICSQALMKLARKPDEIS-NLSQLFKDFDREQCGSITQNQFLRGITVRDMHVMLSSREFQAICKCFGVKKGMCMEFNYREFLKILD 716          

HSP 3 Score: 55.4546 bits (132), Expect = 2.469e-7
Identity = 79/334 (23.65%), Postives = 139/334 (41.62%), Query Frame = 2
Query:  104 KLKETCDTKRIRINEFFLDFDKLRSGYV---TNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVD-KKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPE--SEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDIT-DTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRF---TVHKRGI-----------RIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFI---SYRDFCRNMDNPF 1033
            K+K     +R+ ++ FF  +DKL SG+V      Q FRT     G+  S  E+  ++++Y +     +  F D VD  ++   AL    K Q+   P +         L PE  SE  ++ IL    +    +   +    KD+D H  G I ES F R       I  + E  +L   +R+P   + I Y +      A++EI      IQ    + ++V         P++  ++  + F   T+  + +            +     D+D+ +  ++T+NQF+ G+++       LS  E Q I   +    G     +YR+F + +D  F
Sbjct:  406 KIKIRIRNRRLYLHPFFRSYDKLNSGHVRCNITKQIFRT----NGILLSDPEQDSVLSRYGNELGFCYTKFLDDVDPAEYAMPALVT--KQQLVECPPFARDN-----LDPEDVSEEVIVRILTNAKRQAVVKSVAVIEFMKDYDRHREGEILESDFKRALDNSSVIIKEEEANILCNIFRSPNRVSCIRYRDF---CKALDEIF-----IQLDTNMGDQVVTAVPLLHLPNLDCVDCFLSFDERTICSQALMKLARKPDEISNLSQLFKDFDREQCGSITQNQFLRGITVR-DMHVMLSSREFQAICKCFGVKKGMCMEFNYREFLKILDVLF 719          
BLAST of EF Hand type protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20389660 (tr|A0A3R7DBX7|A0A3R7DBX7_CLOSI Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_6219s PE=4 SV=1)

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 459/963 (47.66%), Postives = 631/963 (65.52%), Query Frame = 2
Query:   65 SCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYS--DGGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPE--YLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCD--SPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDG--FISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYV-----------GHVVDEEAPPPSMPLD----------RDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPA--EYQYRKRLLNLREVN-SKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            S +A  +I N+E  +++    +R R +E FLD+D LRSGYVT  QFFR L   +G+    + E+ ++ KY   +   +NW+ F   ++ +FD      HP+ ++  T    Y+G +   +    E    L PIL R+NQF G+QG+ IR  YK FDVHNIGL+TESQFYR FPGP DI++ ELT+LV +Y++  +P  ++YL    +L  + ++     ++ Q  ++ E + +P+ + D   PSV+LI DRIRF +H+RG+R+MDF  DYDKLRHDAVTENQFVC L +AI KE+ LSR E+Q +AN YR+      I+YR+FCR +D PFH L LEKDPLK    P TG L+R V  LT EEE +VS IL  ++ +V++RRI   PYF+D+D+ T  T +++  QF R LHFL L V+ ED RLL RKFA+P TG+V+Y+ F Q ID   +              V++E     + +           RDW + V P + + GD+ P++VL+ RIRHLVL NRI +KP+F DFD LRSG M  +QF RCLT+ G+ +L LHD+TPTQ  TL   Y      +   W  F+ DV++VFT   LE +P  RVLP E FV PKPGT DWS ATTEM++ +E +MS+LRRK+ ERRM + PDF AFDK + G+VT  NFRQL+TM +  ++   +D I AR ANDDGF+Y  FL  LDP  P   EY+Y +R+  L+  N   +   E+EP+LRDTE V+D+IKA+++RRR+RL D+F+DHD LNHG +  +TFRR L    + + ET M+++EDR++G +P + D+ +FC EIE +F T +LE++PLKEP  Y PD   SQ  L +E A+ A  A+ ++ D VRQRR+QL PLF+DFD  HRMTVSQ QFRRVL+ +DLA  LSE +W+ L+ ++RHP+G+ D++NYLAF D VY AAG   RMP
Sbjct:    9 SGMALDTIQNVENYIRDLAKDRRSRFSENFLDYDNLRSGYVTTGQFFRVLRNIIGIPLRNDAEELILQKYGVNENKDVNWRQFVREIEGEFDVNDFSEHPECKVLKTIGSFYVGSKAPHKRAGDEKYDSLRPILSRINQFVGFQGYIIRDCYKQFDVHNIGLVTESQFYRSFPGPTDISEAELTMLVERYKSNTHPGFVDYLAFERELKEL-QVAEGVAKMGQPADVKEGIFIPEPKEDFLRPSVELIIDRIRFAIHRRGVRVMDFFVDYDKLRHDAVTENQFVCALMLAIAKEAQLSREEVQMLANCYRKHSNPRMIAYREFCRQVDAPFHTLHLEKDPLKQPNMPKTGELTRGVATLTTEEEQRVSRILDDLRAKVEKRRIMTCPYFRDYDLGTGITGIVSDTQFGRVLHFLGLTVSPEDCRLLCRKFAEPTTGKVSYTLFCQAIDGWSIPEGILKPDDTSACCVEQENINFGVAIGDSKSGKKVSRRDWLSTVEPHISSVGDHWPVEVLLDRIRHLVLINRIGLKPWFHDFDQLRSGYMTRSQFARCLTAAGIMRLDLHDLTPTQLNTLADRYVSPNDSNMVNWTKFVEDVETVFTIPELEKQPLTRVLPQETFVQPKPGTADWSTATTEMRENYEDSMSKLRRKIHERRMLLLPDFLAFDKNHRGYVTTNNFRQLVTMFDFSISPAGIDAIIARHANDDGFDYRGFLGVLDPPSPGEVEYKYPERVKTLQMANIIGKKRREMEPVLRDTEGVLDQIKAEVYRRRIRLSDWFRDHDKLNHGYMPRSTFRRCLGVLPLSIGETAMNMVEDRYKGPQPETIDWRAFCAEIEHVFQTPDLERNPLKEPEVYVPDAPVSQNHLSLEVAKLADGAVVKVADKVRQRRLQLMPLFSDFDETHRMTVSQMQFRRVLMTMDLADMLSEREWSSLYCKYRHPLGVVDNINYLAFIDDVYTAAGMDPRMP 970          
BLAST of EF Hand type protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22918455 (tr|A0A4S2M7B4|A0A4S2M7B4_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003435 PE=4 SV=1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 461/965 (47.77%), Postives = 632/965 (65.49%), Query Frame = 2
Query:   71 VAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYS--DGGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPE--YLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNL---FYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCD--SPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDG--FISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYV-----------GHVVDEEAPPPSMPLD----------RDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPP--AEYQYRKRLLNLREVN--SKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            +A  +I N+E  +++    +R R +E FLD+D LRSGYVT  QFFR L   +GV    + E+ ++ KY   +   +NW+ F   ++ KFD      HP+ ++  T +   +G +   +    E    L PIL R+NQF G+QG+ +R  YK FDVHN+GL+TESQFYR FPGP DI+D ELT+LV +Y++  +P  ++YL       +L A   + R    + Q  ++ E + +P+ + D   PSV+LI DRIRF +H+R +R+MDF  DYDKLRHD VTENQFVC L +AI KE+ LSR E+Q +AN YR+      I+YR+FCR +D PFH L LEKDPLK    P TG L+  V  LT EEE +VS IL  ++ ++++RRI   PYF+D+D+ T  T+LI+  QF R LHFL L V+ ED RLL RKFA+P TG+V+Y+ F Q ID+  +            + V++E     + +           RDW + V P + + GD+ P++VL+ RIRHLVL NRI +KP+F DFD LRSG M  +QF RCLT+ G+ +L LHD+TPTQ  TL   Y      +   W  F+ DV++VFT   LE +P  RVLP E FV PKPGT DWS ATTEM++ +E +MS+LRRK+ ERRM + PDF AFDK + G+VT  NFRQL+TM +  ++   +D I AR ANDDGF+Y EFL  LDP  P   EY+Y +RL  L+  N   K+G  E+EP++RDTE V+D+IKA+++RRR+RL D+F+DHD LNHG +  +TFRR L    + + ET M+++EDR++G +P + D+ +FCEEIE +F T  LE++PLKEP  Y PD   +Q  L +E A+ A  A+ ++ D VRQRR+QL PLF+DFD  HRMTVSQ QFRRVL+ +DLA  LSE +W+ L+ ++RHP+G+ D++NYLAF D VY AAG   RMP
Sbjct:   26 MALDTIQNVENYVRDLAKDRRSRFSENFLDYDNLRSGYVTTGQFFRVLRNIIGVPLRNDAEELILRKYGVNENKDVNWRQFVQEIEGKFDVNDFSEHPECKVLKTIDSFCVGSKAPHKRPGDEKYDSLRPILSRINQFIGFQGYIVRDCYKQFDVHNMGLVTESQFYRSFPGPTDISDAELTMLVERYKSNTHPGFVDYLAFEKELKELQAAEGVAR----MGQLTDMKEGIYIPEPKEDFLRPSVELIIDRIRFAIHRRDVRVMDFFVDYDKLRHDEVTENQFVCALMLAIAKEAQLSREEVQMLANCYRKHSNPRMIAYREFCRQVDAPFHTLHLEKDPLKQPNMPKTGELTHGVATLTTEEEQRVSRILDDLRTKIEKRRIMTYPYFRDYDLGTGITRLISDTQFGRVLHFLGLTVSPEDCRLLCRKFAEPTTGKVSYTLFCQAIDKWSIPEEIPKPDDTSAYCVEQENINVGVAIGDSKSGKKVSRRDWLSTVEPHISSVGDHWPVEVLLDRIRHLVLINRIGLKPWFHDFDQLRSGYMTRSQFARCLTAAGIMRLDLHDLTPTQLNTLADRYVSPNDSNMVNWTKFVEDVETVFTIPELEKQPLTRVLPQETFVQPKPGTADWSTATTEMRENYEESMSKLRRKIHERRMLLLPDFLAFDKNHRGYVTTNNFRQLVTMFDFSISPAGIDAIIARHANDDGFDYREFLGVLDPPSPEEIEYKYPERLKTLQMTNILGKKGQ-EMEPVVRDTEGVLDQIKAEVYRRRIRLSDWFRDHDKLNHGYMPRSTFRRCLGVLPVSIGETAMNMVEDRYKGPQPETIDWRAFCEEIEHVFQTPGLERNPLKEPEVYVPDAPVAQNHLSLEVAKLADGAVVKVADKVRQRRLQLLPLFSDFDETHRMTVSQMQFRRVLMTMDLADMLSEREWSSLYCKYRHPLGVVDNINYLAFIDDVYTAAGMDPRMP 985          
BLAST of EF Hand type protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21449869 (tr|A0A074ZUX6|A0A074ZUX6_9TREM Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_13008 PE=4 SV=1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 460/969 (47.47%), Postives = 635/969 (65.53%), Query Frame = 2
Query:   71 VAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYS--DGGRMNWQVFCDVVDKKFDPK---ALHVHPKDQIKNTPE-------YLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCD--SPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDG--FISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYV-----------GHVVDEEAPPPSMPLD----------RDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPP--AEYQYRKRLLNLREVNS-KRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            +A  +I N+E  +++    +R R +E FLD+D LRSGYVT  QFFR L   +GV    + E+ ++ KY   +   +NW+ F   ++ KFD      +     +++++  +       Y+G +   +    E    L PIL R+NQF G+QG+ IR  YK FDVHN+GL+TESQFYR FPGP DI++ ELT+LV +Y++  +P  ++YL    +L  + +      ++ Q  ++ E + +P+ + D   PSV+LI DRIRF +H+RG+R+MDF  DYDKLRHDAVTENQFVC L MAI KE+ LSR E+Q +AN YR+      I+YR+FCR +D PFH L LEKDPLK    P TG L+R V  LT EEE +VS IL  ++ +V++RRI   PYF+D+D+ T  T++++  QF R LHFL L V+ ED RLL RKFA+P TG+VNY+ F Q ID+  V            + V++E     + +           RDW + V P + + GD+ P++VL+ RIRHLVL NRI +KP+F DFD LRSG M  +QF RCLT+ G+ +L LHD+TPTQ  TL   Y      +   W  F+ DV++VFT   LE +P  RVLP E FV PKPGT DWS ATTEM++ +E +MS+LRRK+ ERRM + PDF AFDK + G+VT  NFRQL+TM +  ++   +D I AR ANDDGF+Y  FL+ LDP  P   EY+Y +RL  L+  N   +  +E+EP+LRDTE V+D+IKA+++RRR+RL D+F+DHD LNHG +  +TFRR L    + + ET M+++EDR++G +P + D+ +FC EIE +F T +LE++PLKEP  Y PD   +Q  L ++ A+ A  AI ++ D VRQRR+QL PLF+DFD  HRMTVSQ QFRRVL+ LDLA  LSE +W+ L+ ++RHP+G+ D++NYLAF D VY AAG   RMP
Sbjct:    1 MALDTIQNVENYIRDLAKDRRSRFSENFLDYDNLRSGYVTTGQFFRVLRNIIGVPLRNDAEELILQKYGVNENKDVNWRQFAQEIEGKFDVNDFTRMQSSEDNRVRSLSKADRSRSYYVGSKAPHKRPGDEKYDSLRPILSRINQFIGFQGYIIRDCYKQFDVHNVGLVTESQFYRSFPGPTDISEAELTMLVERYKSNTHPGFVDYLAFERELREL-QAAEGVAKMGQPTDMKEGICIPEPKEDFLRPSVELIIDRIRFAIHRRGVRVMDFFVDYDKLRHDAVTENQFVCALMMAIAKEAQLSREEVQMLANCYRKHSNPRMIAYREFCRQVDAPFHTLHLEKDPLKQPNMPKTGELTRGVATLTTEEEQRVSRILDDLRAKVEKRRIMTYPYFRDYDLGTGVTRIVSDTQFGRVLHFLGLTVSPEDCRLLCRKFAEPTTGKVNYTLFCQAIDRWSVPGEILKPDDTSAYCVEQENINFGVVIGDSKSGKKVSRRDWLSTVEPRISSVGDHWPVEVLLDRIRHLVLINRIGLKPWFHDFDQLRSGYMTRSQFARCLTAAGIMRLDLHDLTPTQLNTLADRYVSPNDSNMVNWTKFVEDVETVFTIPELEKQPLTRVLPQETFVQPKPGTADWSTATTEMRENYEDSMSKLRRKIHERRMLLLPDFLAFDKNHRGYVTTNNFRQLVTMFDFSISPAGIDAIIARHANDDGFDYRGFLEVLDPPSPEEIEYKYPERLKTLQMTNILGKKRLEMEPVLRDTEGVLDQIKAEVYRRRIRLSDWFRDHDKLNHGYMPRSTFRRCLGVLPLSIGETAMNMVEDRYKGSQPETIDWRAFCAEIEQVFQTPDLERNPLKEPEVYVPDAPVAQNHLSLDVAKLADGAIVKVADKVRQRRLQLLPLFSDFDETHRMTVSQMQFRRVLMTLDLADMLSEREWSSLYCKYRHPLGVVDNINYLAFIDDVYTAAGMDPRMP 968          
BLAST of EF Hand type protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16242432 (tr|A0A0V0J8M7|A0A0V0J8M7_SCHSO Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR137270 PE=4 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 448/945 (47.41%), Postives = 618/945 (65.40%), Query Frame = 2
Query:   92 NIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLS-PESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRL-PQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRR---PDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVG---------HVVDEEAPPPSM-----PLDR-DWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDP--QPPAEYQYRKRLLNLR-EVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            N EE L+ T + K +R++E+FLDFDKLRSG VT+  FFR L +N G+  + E+   L  KY  G ++NW+ F   +DK  DP  L V PK Q+K       QE    P +    +    PIL R+NQ   YQG++IR  YK FD  NIG ++ESQFYR FPGPKDIT+ EL  + + Y  P +P M++YL L  DL  + + +++ +E    K     + +  +     PSV ++ +RI F VH RGIR++D   DYD LRHD V+E+QF C L++A+ + ++LSR +IQ++ANF+R    PD  I+YR+FCR  D PFH +DLEK PL     PP G LSR +Q LT +EE +VS IL+ ++E+V+ +RI   P F+D+D STA T+ +TP Q  R LHFL LDV SED RLLA+KFADP+T  VNY+A  + ID  +            + ++  PPP +     P  R DW  + TP+  + GD+V ++ LM+R+RHLVL NRIR+K FFEDFD LRSGR+  +QF R L++  +S++GLHD+TP Q   L + Y  S  P   RW+DF+ DVD++FT   LE +P  RV P E F++PKPG  DWS+AT EM++ +E  M  LRR VMER + +KP+F AFDKLN GHVTL NFRQ+M+MLN+HL  E++D+I +R+A+DDGFNY  F+ +L P  +    Y+Y  R+ N R +   ++  IE EP++RD E V+D IK ++   R+RL ++ +D D LNHG V+   FRRAL    I L ETE+++LE  ++ +E N  ++ +FC+E+ES+FAT NLEKDPLKE    K +   S+  L I  A  A  AI++IG +VRQRRIQL PLF+DFD  HRMT+SQ+QFRR L+ L LA +++E +W  L+ ++RHPVG  D++NYLAF+D VYE AG  YR P
Sbjct:    9 NFEECLRNTANEKGVRVSEYFLDFDKLRSGKVTDNIFFRILTRNFGITLNEEQRDLLRGKYGVGDKINWRKFVGEIDKTLDPNDLSVTPKQQLKRI---RFQETECLPNNFAGVDETFRPILSRINQHITYQGYSIRQCYKQFDNQNIGKVSESQFYRAFPGPKDITEAELCAIAKHYSVPNDPGMVDYLRLEQDLWDLAQAEQRAKEGYPPKPDAPDIHINTKAELLVPSVHMVLERIGFAVHTRGIRVLDHFLDYDPLRHDEVSEHQFACVLNLALSEAAHLSRFDIQQLANFFRSSKNPDK-IAYREFCRAADFPFHTMDLEKKPLCKPEMPPCGALSRPLQNLTEDEEIRVSNILSTLREKVRTQRIQTYPMFRDYDTSTALTRTMTPLQLGRALHFLQLDVGSEDCRLLAKKFADPVTKYVNYAALCEAIDPMFQASALVRDVTQEIAEDAGPPPKIGDFVKPAQRCDWDAISTPIAMSSGDSVDLETLMARLRHLVLVNRIRLKGFFEDFDPLRSGRITKSQFMRGLSNASISRIGLHDLTPAQCNKLFEKYKSSEDPKTVRWLDFVNDVDTIFTLPELEKQPLARVPPQEIFLVPKPGCGDWSSATEEMRENYEHGMRALRRCVMERSLQLKPEFLAFDKLNRGHVTLSNFRQIMSMLNIHLPVEDLDVIASRYADDDGFNYATFILDLIPLTEEQLHYKYPDRIQNQRLKYLYEKKQIEREPVMRDAEGVLDMIKKKVHECRIRLSEWIRDSDRLNHGTVSRQAFRRALGLLPIPLKETELNVLEHYYKAKEENFINWRAFCDEVESVFATPNLEKDPLKEAQVLKTEVGISENYLPIGLAAEADAAIKKIGGLVRQRRIQLTPLFSDFDQTHRMTLSQSQFRRCLMTLGLADTITEHEWIALYAKYRHPVGEIDNINYLAFSDDVYEVAGMVYRTP 949          

HSP 2 Score: 126.331 bits (316), Expect = 1.202e-25
Identity = 168/744 (22.58%), Postives = 311/744 (41.80%), Query Frame = 2
Query:   83 SIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQF--FRTLWQNMGVQFSPEEEQQLVNKYSDG---GRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHN--IGLITESQFYRGFPGPK-DITDTELTLLVRKYRNPENPTMINYLNL-------FYDLMAINEIKRQ-QEEIQQHKEIDERVRLPQERC--------------DSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMA----IGKESNLSRGEIQKIANFYRRPD--GFISYRDFCRNMDNPFHVLDLEKDPLKD--------APYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFD-ISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFAD--------------PITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMH--LTEEEMDIIQARF----ANDDGFNYFEFLDNL 2119
            S++ + E++     T+ IR+ + FLD+D LR   V+  QF     L  +     S  + QQL N +       ++ ++ FC   D  F    L   P  +    P      R ++ L+ + E ++  IL  + +    Q       ++D+D        +T  Q  R     + D+   +  LL +K+ +P     +NY  L       F     + ++ ++  E+     +I + V+ P +RC              DS  ++ +  R+R  V    IR+  F  D+D LR   +T++QF+ GLS A    IG   +L+  +  K+   Y+  +    + + DF  ++D  F + +LEK PL           P P  G  S A +    E        + A++  V +R + + P F  FD ++  H   +T + F + +  L++ +  ED  ++A ++AD              P+T E  +  +   I    + ++ +++       ++R+      PV++        + ++  I+  V   RIR+  +  D D L  G +    F R L   GL  + L +   T+   L +HY  + + ++  W  F  +V+SVF   NLE  P       EA VL     +  +     +    + A+ ++   V +RR+ + P F  FD+ +   ++   FR+ +  L +   +TE E   + A++       D  NY  F D++
Sbjct:  236 SVHMVLERIGFAVHTRGIRVLDHFLDYDPLRHDEVSEHQFACVLNLALSEAAHLSRFDIQQLANFFRSSKNPDKIAYREFCRAADFPFHTMDLEKKPLCK-PEMPPCGALSRPLQNLTEDEEIRVSNILSTLREKVRTQRIQTYPMFRDYDTSTALTRTMTPLQLGRALHFLQLDVGSEDCRLLAKKFADPVT-KYVNYAALCEAIDPMFQASALVRDVTQEIAEDAGPPPKIGDFVK-PAQRCDWDAISTPIAMSSGDSVDLETLMARLRHLVLVNRIRLKGFFEDFDPLRSGRITKSQFMRGLSNASISRIGLH-DLTPAQCNKLFEKYKSSEDPKTVRWLDFVNDVDTIFTLPELEKQPLARVPPQEIFLVPKPGCGDWSSATE----EMRENYEHGMRALRRCVMERSLQLKPEFLAFDKLNRGH---VTLSNFRQIMSMLNIHLPVEDLDVIASRYADDDGFNYATFILDLIPLTEEQLHYKYPDRIQNQRLKYLYEKKQ------IERE------PVMRDA------EGVLDMIKKKVHECRIRLSEWIRDSDRLNHGTVSRQAFRRAL---GLLPIPLKE---TELNVL-EHYYKAKEENFINWRAFCDEVESVFATPNLEKDPL-----KEAQVLKTEVGISENYLPIGLAAEADAAIKKIGGLVRQRRIQLTPLFSDFDQTHRMTLSQSQFRRCLMTLGLADTITEHEWIALYAKYRHPVGEIDNINYLAFSDDV 938          
BLAST of EF Hand type protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20709663 (tr|A0A504YXW8|A0A504YXW8_FASGI Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_07294 PE=4 SV=1)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 440/957 (45.98%), Postives = 616/957 (64.37%), Query Frame = 2
Query:   83 SIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYS-DGGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEY--LGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNL---FYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDG--FISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQ-----SYV---------GHVVDEEAPPP------SMPLDR-DWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAE--YQYRKRLLNLREVNS-KRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            ++ N+E  +++    ++ R  E FLD+DKLR GYVT  QFFR + + +GV    + ++ +  +Y  +   ++W+ F   ++ KFD     + P+ ++  T E   +G +   +    +    L P+L R+++F  YQG+ IR  YK FD+HN+G+ITESQFYR FPGP+DIT  E+T L ++Y++   P  ++YL       DL A  E+ +   + +           P+E    PS  +I DRI+F VH+RGIR+MDF  DYDKLRHD +TE+QF C L +A+GKE+ LSR E+Q + N+YRR D    I+YRDFCR +D PFH+LDLEKDPLK    P  G LSR +  L  +EE +VS +L  +K QV +RRI   PYF+D+D  +A TQ++TP QF+R LHFL L+++SED R L RKF DP +G V+Y  F Q ID      S+V         G  +++   P          + R DW  +  P +K+ GDN P+DVL+ RIRHLVL NRI +KP+F DFD LR+G+M   QF RCLT+ GLS+L  HD+TP Q +TLV+ Y     P    W  F+ D+DSVFT   LE +P  RVLP E ++ PKPGTVDW+  + E+++ +E +M+ LRRK++ERRM + PDF+AFDK + G+V+ +NFRQL+ M N  L   E+D I AR +ND+GF+Y  FL  LDPQ  +E  YQY KRL  LR+ N   R   E+EPI+ DTE V+ ++KAQ+FRRR+RL ++F+D D LNHG +   TFRR L    + + ET +S +EDR++G +P++ D+ +FC E+E +F T +LEKDPLKEP  Y PD    Q  L +E A+ A  A+ ++ D VRQRR+QL PLF DFD+ HR TVSQNQFRRVL+ LDLA  ++E +W+CL+ ++RHP+G+ D++NY AF D VY  AG   R+P
Sbjct:    5 TLQNVESYIRDLAKDRKCRFTENFLDYDKLRLGYVTAGQFFRVIRELIGVALDEKAQEFIRKEYGINKNDIDWRRFVSSIEGKFDENDFRIPPESKLLRTIEAPTVGTKAFHKKPGDDGYDNLRPLLSRISRFIKYQGYVIRECYKQFDIHNVGIITESQFYRSFPGPQDITPAEITALAQRYQSLTTPGCVDYLAFEKDLNDLAAAEELAKTGIKAKDEGSQGTVALEPREDFLRPSFHMIIDRIKFVVHRRGIRVMDFFIDYDKLRHDTITEHQFACALLLAVGKEAQLSRPEVQMVINYYRRKDNPDLIAYRDFCRQIDAPFHILDLEKDPLKQPVTPSRGMLSRGLAKLDEDEEQRVSNLLDKVKSQVAKRRILTYPYFQDYDSGSAMTQVVTPAQFSRVLHFLGLEISSEDCRRLCRKFTDPTSGNVSYRIFCQAIDSWFNNDSFVVNQENDVESGRDLEDTVRPAIGETQSGKQVSRCDWSAITEPNLKSAGDNWPVDVLLDRIRHLVLINRIALKPWFADFDQLRTGQMTRTQFERCLTAAGLSRLHFHDLTPAQIKTLVEAYVSPNDPKMVNWTKFVEDIDSVFTLPALEMKPMVRVLPQETYLQPKPGTVDWNTVSDEIRENYEYSMATLRRKILERRMLLLPDFEAFDKSHRGYVSPKNFRQLVLMFNFCLKPAEIDAILARHSNDEGFDYRGFLQTLDPQVESEKVYQYPKRLEELRKTNIFGRERKEMEPIIYDTEGVLQQLKAQVFRRRIRLAEWFRDQDQLNHGYMPRITFRRCLGALPLEMNETGLSAIEDRYKGSKPDTVDWKAFCAEVEHVFQTPDLEKDPLKEPETYVPDSMVKQNFLSLEMAKVADRALVKVADKVRQRRLQLLPLFRDFDVTHRYTVSQNQFRRVLMALDLADLITEKEWSCLYCKYRHPLGVVDNINYQAFIDDVYTEAGIDPRVP 961          
BLAST of EF Hand type protein vs. Ensembl Nematostella
Match: EDO33216 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV0])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 365/941 (38.79%), Postives = 538/941 (57.17%), Query Frame = 2
Query:   83 SIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKY-SDG---GRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPS-VQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVD----------EEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRG-QEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            ++ ++E+K++   + + +R+ E+F DFD+LR+G++T  QF R L Q  G+  +PE++  L+ KY SD    G +N+++FC V+   FDP  +   P  Q       + +    RPLSP S AK   +L RM   Y Y G NI+  Y DFD+H+IG++TE QF+R FPGP DITD ++ LL RKYR+   P + NY +  +D+   ++ K  QEE    K       LP  R    S +Q I +RIR  V K GIR  +F  D+DKLR   +TENQF+CGLS+    ++NLSR EIQK+ ++YR  DG + Y++FC  M+N F V +LEK    DA  PP G L++A  +LT +EE +V  IL  M+++V++RR+   PYFKDFD S  +T+ IT  QFAR LHFL+LD+   +  L+ +KF   + G++NY AF Q ID  Y G              +  P PS PLD                +V +D L+ RIRH VL  R+R++ FF+DFD LR G +  +QF +CL S+G +     D+T  QF+ L + Y D  +P    W  F+ DV+                              +   ++ E++   ET M R+ +K+++RR+  KP FQ FDK N+GHVT    RQ +  L +   E EM II+AR+++D GFNY +FL+ L P    ++ Y KRL  L+ VNSK+ A   E   +D E +M KIKA++ + R+R+++F +D+D L  GR+  A F RA++   + L + E+ ++ DR+     P+  DY  F ++IE IF  K+LEK PL EP  + P  +    KL  E  +A    + R+ D VR RRIQ+ PLF D+D  H  +VS++QF RVL ELDL   +S  ++  L+++F   +G++ D NY+ F D + + A FA+ MP
Sbjct:   17 AVESLEDKIRLDVNARNVRLTEYFKDFDRLRTGFITKPQFERCLDQLFGIVLTPEQDALLMAKYGSDAKQKGMVNYRMFCHVIGSVFDPNLIVEDPATQRPTMSNPVDR----RPLSPASLAKCDELLMRMATHYKYHGINIKSCYADFDIHHIGVVTEPQFFRSFPGPPDITDYQVKLLARKYRDSVRPGLCNYYDFHFDIE--DKQKYLQEEADFTKYAPTEDFLPAPRSPKASTLQEIFERIRVAVFKNGIRTPEFFRDHDKLRSGIITENQFICGLSLCCATQANLSRDEIQKVTDYYRTEDGRVRYQEFCDLMENAFTVPELEKKTTADAYRPPVGALAQAPNLLTEQEERRVYEILEDMRDKVRKRRLMAYPYFKDFDRSKGYTRGITKTQFARMLHFLTLDLQPLELALICKKFEYQVGGDINYPAFIQAIDTEYTGTATSLSDKMNKDRAQTPPKPSPPLDL--------------SSVDLDELIQRIRHHVLVKRLRVEEFFQDFDPLRHGSISVSQFRQCLNSMGQT-----DLTHAQFQVLAQQYADPKRPGNVMWTQFLTDVEI---------------------------GANQGLSSGELQMHLETIMQRMHQKILQRRILCKPLFQDFDKHNNGHVTRSQARQCLHNLGLTHDENEMKIIEARYSDDIGFNYIDFLELLQPPDKPDHMYVKRLEGLKLVNSKQMADLGE---QDMETIMHKIKAKVMKERIRVLEFMRDYDKLRTGRMLRANFIRAMDMCCLDLTKREIEIIMDRYSSPGYPDYVDYARFSDDIEQIFTVKHLEKMPLVEPTRFNPHVQSENLKLRPEAEEAFERVMHRLADRVRIRRIQIFPLFEDYDKVHNGSVSRSQFNRVLSELDLGGLVSAREFEVLYQKFDVVIGLKHDFNYIGFCDTINDYANFAFGMP 902          

HSP 2 Score: 163.31 bits (412), Expect = 3.944e-41
Identity = 186/711 (26.16%), Postives = 314/711 (44.16%), Query Frame = 2
Query:   80 SSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQ--FSPEEEQQLVNKY-SDGGRMNWQVFCDVVDKKFD-PKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGL---ITESQFYRGFPG-PKDITDTELTLLVRKYR-----NPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIE--DRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQF-VCGLSMAIGKESNLSRGEIQKIANFYRRPD--GFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTL-VTPVVKTK-----GDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMH--LTEEEMDIIQARFANDDG----FNYFEFLDNLD 2122
            S++  I E+++       IR  EFF D DKLRSG +T  QF   L      Q   S +E Q++ + Y ++ GR+ +Q FCD+++  F  P+       D  +     L Q  ++  L+ + E ++  IL+ M      +       +KDFD  + G    IT++QF R       D+   EL L+ +K+      +   P  I  ++  Y   A +   +  ++  Q          P    D  SV L E   RIR  V  + +R+ +F  D+D LRH +++ +QF  C  SM    +++L+  + Q +A  Y  P   G + +  F                 L D        LS        E +  + TI+  M +++ QRRI   P F+DFD    +   +T +Q  + LH L L     + +++  +++D I    NY  F +L+              PP  P     K L    +V +K     G+   ++ +M +I+  V+  RIR+  F  D+D LR+GRM    F R +    L      D+T  + E ++  Y     PDY  +  F  D++ +FT  +LE  P   V PT     P   + +      E ++ FE  M RL  +V  RR+ + P F+ +DK+++G V+   F ++++ L++   ++  E +++  +F    G    FNY  F D ++
Sbjct:  246 STLQEIFERIRVAVFKNGIRTPEFFRDHDKLRSGIITENQFICGLSLCCATQANLSRDEIQKVTDYYRTEDGRVRYQEFCDLMENAFTVPELEKKTTADAYRPPVGALAQAPNL--LTEQEERRVYEILEDMRDKVRKRRLMAYPYFKDFD-RSKGYTRGITKTQFARMLHFLTLDLQPLELALICKKFEYQVGGDINYPAFIQAIDTEYTGTATSLSDKMNKDRAQTPP------KPSPPLDLSSVDLDELIQRIRHHVLVKRLRVEEFFQDFDPLRHGSISVSQFRQCLNSMG---QTDLTHAQFQVLAQQYADPKRPGNVMWTQF-----------------LTDVEIGANQGLSSG------ELQMHLETIMQRMHQKILQRRILCKPLFQDFD--KHNNGHVTRSQARQCLHNLGLTHDENEMKIIEARYSDDIG--FNYIDFLELLQ-------------PPDKPDHMYVKRLEGLKLVNSKQMADLGEQ-DMETIMHKIKAKVMKERIRVLEFMRDYDKLRTGRMLRANFIRAMDMCCL------DLTKREIEIIMDRYSSPGYPDYVDYARFSDDIEQIFTVKHLEKMP--LVEPTR--FNPHVQSENL-KLRPEAEEAFERVMHRLADRVRIRRIQIFPLFEDYDKVHNGSVSRSQFNRVLSELDLGGLVSAREFEVLYQKFDVVIGLKHDFNYIGFCDTIN 892          

HSP 3 Score: 152.14 bits (383), Expect = 1.282e-37
Identity = 181/722 (25.07%), Postives = 311/722 (43.07%), Query Frame = 2
Query:  770 SPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIG-----KESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAV--QILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPI-TGEVNYSAFTQLID--QSYVGHVVDEEAPPPS---MPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEM--KQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGH---VTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDG--FNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEP------ILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNT-ATIHLPETEMSLLEDRFRG-QEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVY-EAAGFAY 2848
            S +V+ +ED+IR  V+ R +R+ ++  D+D+LR   +T+ QF   L    G     ++  L   +    A    +  G ++YR FC  + + F    + +DP    P     T+S  V  + L+    +K   +L  M    K   INI   + DFDI   H  ++T  QF R+      D+T    +LLARK+ D +  G  NY  F   I+  Q Y+    D     P+   +P  R      +P   T      +  +  RIR  V  N IR   FF D D LRSG +  NQF   +  + L      +++  + + +  +Y   T+    R+ +F   +++ FT   LE +        +A+  P        N  TE   ++++E  +  +R KV +RR+   P F+ FD+ + G+   +T   F +++  L + L   E+ +I  +F    G   NY  F+  +D     EY      L+  ++N  R     +P         D + ++ +I+  +  +R+R+ +FF+D D L HG ++ + FR+ LN+     L   +  +L  ++   + P +  +  F  ++E I A + L    L+   E                       ++R+   + QRRI   PLF DFD ++   V+++Q R+                 CL     H +G+  D N +   +A Y +  GF Y
Sbjct:   15 SHAVESLEDKIRLDVNARNVRLTEYFKDFDRLRTGFITKPQFERCLDQLFGIVLTPEQDALLMAKYGSDA----KQKGMVNYRMFCHVIGSVFDPNLIVEDPATQRP-----TMSNPVDRRPLSPASLAKCDELLMRMATHYKYHGINIKSCYADFDIH--HIGVVTEPQFFRSFPG-PPDITDYQVKLLARKYRDSVRPGLCNYYDFHFDIEDKQKYLQEEADFTKYAPTEDFLPAPR------SPKAST------LQEIFERIRVAVFKNGIRTPEFFRDHDKLRSGIITENQF---ICGLSLCCATQANLSRDEIQKVTDYY--RTEDGRVRYQEFCDLMENAFTVPELEKKTTA-----DAYRPPVGALAQAPNLLTEQEERRVYEI-LEDMRDKVRKRRLMAYPYFKDFDR-SKGYTRGITKTQFARMLHFLTLDLQPLELALICKKFEYQVGGDINYPAFIQAID----TEYTGTATSLS-DKMNKDRAQTPPKPSPPLDLSSVDLDELIQRIRHHVLVKRLRVEEFFQDFDPLRHGSISVSQFRQCLNSMGQTDLTHAQFQVLAQQYADPKRPGNVMWTQFLTDVE-IGANQGLSSGELQMHLE---------------------TIMQRMHQKILQRRILCKPLFQDFDKHNNGHVTRSQARQ-----------------CL-----HNLGLTHDENEMKIIEARYSDDIGFNY 651          

HSP 4 Score: 55.8398 bits (133), Expect = 8.151e-8
Identity = 65/292 (22.26%), Postives = 129/292 (44.18%), Query Frame = 2
Query:   59 MSSCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALHVHPKDQIK--NTPEY--LGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFP-GPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQE-------EIQQHKEIDE-RVRLPQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQF 895
            +SS      +  I +++ +    +RI     F DFDK  +G+VT +Q  R    N+G+     E + +  +YSD    N+  F +++     P  ++V   + +K  N+ +   LG E+ +  +  + +AK++    R+ +F            +D+D    G +  + F R       D+T  E+ +++ +Y +P  P  ++Y     D+  I  +K  ++           H + +  ++R   E      +  + DR+R     R I+I     DYDK+ + +V+ +QF
Sbjct:  573 LSSGELQMHLETIMQRMHQKILQRRILCKPLFQDFDKHNNGHVTRSQ-ARQCLHNLGLTHDENEMKIIEARYSDDIGFNYIDFLELLQPPDKPDHMYVKRLEGLKLVNSKQMADLG-EQDMETIMHKIKAKVMKERIRVLEF-----------MRDYDKLRTGRMLRANFIRAMDMCCLDLTKREIEIIMDRYSSPGYPDYVDYARFSDDIEQIFTVKHLEKMPLVEPTRFNPHVQSENLKLRPEAEEAFERVMHRLADRVRI----RRIQIFPLFEDYDKVHNGSVSRSQF 847          
BLAST of EF Hand type protein vs. Ensembl Nematostella
Match: EDO28235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T718])

HSP 1 Score: 69.3218 bits (168), Expect = 5.580e-13
Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 1916 RKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNL 2119
            +K+++RR+  KP FQ FDK N+GHVT    RQ +  L +   E EM II+AR+++D GFNY +FL+ L
Sbjct:  118 QKILQRRILCKPLFQDFDKHNNGHVTRSQARQCLHNLGLTHDENEMKIIEARYSDDIGFNYIDFLELL 185          
BLAST of EF Hand type protein vs. Planmine SMEST
Match: SMESG000065951.1 (SMESG000065951.1)

HSP 1 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 930/933 (99.68%), Postives = 932/933 (99.89%), Query Frame = 2
Query:   59 MSSCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALHVHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRXXXXXXXXXXXXXXXWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 2857
            MSSCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALH+HPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGD TQPDYTRWMDFIRDVDSVFTESNLE+RPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRVLVELDLASSLSESDWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP
Sbjct:    1 MSSCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFRTLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALHIHPKDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSYKDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYLNLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRFTVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQKIANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAVQILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQFARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVVDEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRIKPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYGDPTQPDYTRWMDFIRDVDSVFTESNLENRPKGRVLPTEAFVLPKPGTVDWSNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFRQLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKRLLNLREVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDNLNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEEIESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDVVRQRRIQLHPLFNDFDINHRMTVSQNQFRRVLVELDLASSLSESDWACLFKQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP 933          
The following BLAST results are available for this feature:
BLAST of EF Hand type protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG108415.263e-6026.85gene:FBgn0038163 transcript:FBtr0309093[more]
CG108415.821e-6026.85gene:FBgn0038163 transcript:FBtr0082795[more]
back to top
BLAST of EF Hand type protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203896600.000e+047.66tr|A0A3R7DBX7|A0A3R7DBX7_CLOSI Uncharacterized pro... [more]
gnl|BL_ORD_ID|229184550.000e+047.77tr|A0A4S2M7B4|A0A4S2M7B4_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|214498690.000e+047.47tr|A0A074ZUX6|A0A074ZUX6_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|162424321.202e-2547.41tr|A0A0V0J8M7|A0A0V0J8M7_SCHSO Uncharacterized pro... [more]
gnl|BL_ORD_ID|207096630.000e+045.98tr|A0A504YXW8|A0A504YXW8_FASGI Uncharacterized pro... [more]
back to top
BLAST of EF Hand type protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO332163.944e-4138.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282355.580e-1348.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF Hand type protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF Hand type protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065951.10.000e+099.68SMESG000065951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010475 ID=SMED30010475|Name=EF Hand type protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2943bp
CAACATTTTACCAACGATTTCAATTTCAATCTTAGAAAATAATTTGAAAA
AATTATAAATGTCTTCGTGTGTTGCTCCCAGTTCCATTTACAATATCGAG
GAAAAGCTAAAAGAAACTTGTGATACAAAGCGTATTCGTATAAATGAGTT
CTTTCTTGATTTCGACAAACTACGTTCAGGATATGTAACAAATACACAGT
TCTTTCGAACATTGTGGCAAAATATGGGGGTTCAGTTTTCTCCAGAAGAA
GAGCAGCAATTAGTTAATAAATATAGCGATGGTGGAAGAATGAATTGGCA
AGTTTTCTGTGATGTTGTTGATAAAAAATTCGATCCAAAAGCTCTTCATG
TTCATCCTAAAGACCAAATTAAAAATACACCTGAATATCTTGGTCAAGAA
CGATCTGTGAGACCTTTAAGTCCGGAATCCGAGGCAAAACTGTTACCAAT
TCTACAACGAATGAATCAATTTTATGGTTATCAAGGCTTTAATATCAGAA
TGAGTTACAAAGATTTTGATGTTCATAATATTGGACTCATTACTGAATCT
CAGTTCTATCGAGGGTTTCCTGGGCCAAAGGATATAACTGACACAGAGCT
GACGTTGCTTGTTCGTAAATATAGAAATCCCGAAAATCCAACTATGATTA
ATTATCTCAACTTGTTTTACGATCTTATGGCCATTAATGAAATTAAACGA
CAACAGGAAGAAATCCAACAACATAAGGAAATAGATGAAAGAGTTCGTTT
GCCACAAGAACGATGCGACAGTCCTTCAGTCCAGCTGATTGAAGACAGGA
TTCGATTTACTGTCCACAAGCGCGGAATTCGAATCATGGACTTTCTGACA
GATTATGATAAACTGCGACATGACGCTGTGACTGAAAACCAGTTTGTTTG
CGGATTAAGCATGGCTATAGGAAAAGAGTCGAATTTGTCTCGTGGTGAAA
TACAAAAAATAGCTAATTTCTATAGAAGGCCTGATGGATTTATATCATAT
CGAGATTTTTGTCGAAATATGGATAATCCTTTCCATGTTCTTGACTTAGA
GAAAGATCCTCTCAAAGATGCTCCATACCCACCAACAGGAACACTTTCTA
GAGCGGTGCAAATTTTAACGATTGAAGAAGAAAGTAAAGTGTCGACTATA
CTCGCTGCAATGAAGGAACAAGTTAAGCAGAGACGTATCAACATAACTCC
TTACTTTAAAGATTTTGATATAAGTACAGCGCATACTCAATTGATCACTC
CAAATCAATTTGCTCGAACTCTTCACTTTTTAAGTCTGGATGTTACTAGT
GAAGATGCAAGACTTCTTGCAAGGAAATTTGCTGATCCCATTACTGGAGA
AGTTAATTACTCCGCTTTTACACAATTGATCGATCAGAGTTACGTTGGGC
ACGTTGTTGATGAAGAAGCACCTCCCCCAAGTATGCCACTAGACAGAGAT
TGGAAAACTCTGGTCACTCCAGTTGTCAAAACTAAAGGTGACAATGTGCC
AATTGATGTTCTAATGTCTCGAATTAGACATCTTGTTTTAACCAATAGGA
TTAGAATAAAACCTTTTTTCGAAGATTTCGATACTCTTCGCAGCGGTAGA
ATGAAAAATAACCAATTTTATCGATGCCTCACTTCAATTGGTCTGAGTAA
ATTGGGTCTTCATGATATTACTCCAACTCAATTTGAAACTCTTGTTAAAC
ATTACGGAGATTCTACACAACCTGATTATACTCGATGGATGGATTTTATA
CGTGATGTTGATTCTGTTTTTACCGAATCCAATTTAGAAAGCAGGCCCAA
AGGTAGAGTTTTACCAACTGAAGCGTTTGTGCTGCCAAAACCAGGAACAG
TCGATTGGAGTAATGCCACTACTGAAATGAAACAGCTTTTCGAAACGGCA
ATGTCGAGGTTAAGGAGAAAAGTTATGGAAAGGCGAATGCATGTCAAACC
AGATTTTCAGGCATTTGACAAACTCAATCATGGTCATGTTACATTGCAAA
ACTTTCGTCAGCTGATGACAATGCTTAATATGCACTTAACCGAGGAGGAA
ATGGACATTATACAAGCCAGATTTGCTAATGACGATGGCTTTAACTACTT
TGAATTTTTGGATAATTTGGATCCACAGCCTCCTGCTGAATATCAATACA
GGAAAAGATTACTTAATTTGCGCGAAGTTAATTCTAAGAGAGGTGCAATA
GAAGTGGAGCCTATTTTGAGAGATACTGAAGCGGTGATGGACAAAATAAA
AGCTCAAATATTTCGACGAAGAGTTAGACTGATTGATTTTTTCAAGGATC
ATGATAACTTGAACCACGGAAGGGTAAACAATGCCACTTTTCGACGCGCA
TTGAATACAGCAACAATTCACTTGCCAGAAACTGAAATGAGTTTGCTTGA
AGATAGGTTTCGAGGACAAGAACCAAATTCGTTTGACTATATGTCTTTTT
GTGAAGAAATCGAGTCTATTTTTGCTACTAAAAATTTAGAAAAAGATCCG
CTCAAAGAACCATTTGAATACAAACCAGATCCAGAATACAGTCAAGAGAA
ATTAATTATTGAAGAAGCTCAAGCAGCTTCAGATGCTATTAGAAGAATTG
GTGATGTAGTTAGACAACGTCGTATTCAGCTTCATCCTTTATTTAATGAC
TTTGACATCAATCATAGAATGACTGTCTCCCAGAATCAGTTCAGACGAGT
ACTCGTGGAATTGGATTTAGCCAGCAGTTTGTCAGAATCTGATTGGGCAT
GTTTATTTAAACAATTCCGCCACCCAGTTGGAATTCGCGATGATGTTAAT
TATTTGGCTTTCAATGATGCTGTCTATGAAGCCGCGGGATTTGCTTACAG
AATGCCATAGATTCGTTTTGAATGTCTTATCTAAGGCTTATTTTAAGACT
GACTATTATTATGTAGTAAAATATATTTGATTACTCAAAAAAA
back to top

protein sequence of SMED30010475-orf-1

>SMED30010475-orf-1 ID=SMED30010475-orf-1|Name=SMED30010475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=934bp
MSSCVAPSSIYNIEEKLKETCDTKRIRINEFFLDFDKLRSGYVTNTQFFR
TLWQNMGVQFSPEEEQQLVNKYSDGGRMNWQVFCDVVDKKFDPKALHVHP
KDQIKNTPEYLGQERSVRPLSPESEAKLLPILQRMNQFYGYQGFNIRMSY
KDFDVHNIGLITESQFYRGFPGPKDITDTELTLLVRKYRNPENPTMINYL
NLFYDLMAINEIKRQQEEIQQHKEIDERVRLPQERCDSPSVQLIEDRIRF
TVHKRGIRIMDFLTDYDKLRHDAVTENQFVCGLSMAIGKESNLSRGEIQK
IANFYRRPDGFISYRDFCRNMDNPFHVLDLEKDPLKDAPYPPTGTLSRAV
QILTIEEESKVSTILAAMKEQVKQRRINITPYFKDFDISTAHTQLITPNQ
FARTLHFLSLDVTSEDARLLARKFADPITGEVNYSAFTQLIDQSYVGHVV
DEEAPPPSMPLDRDWKTLVTPVVKTKGDNVPIDVLMSRIRHLVLTNRIRI
KPFFEDFDTLRSGRMKNNQFYRCLTSIGLSKLGLHDITPTQFETLVKHYG
DSTQPDYTRWMDFIRDVDSVFTESNLESRPKGRVLPTEAFVLPKPGTVDW
SNATTEMKQLFETAMSRLRRKVMERRMHVKPDFQAFDKLNHGHVTLQNFR
QLMTMLNMHLTEEEMDIIQARFANDDGFNYFEFLDNLDPQPPAEYQYRKR
LLNLREVNSKRGAIEVEPILRDTEAVMDKIKAQIFRRRVRLIDFFKDHDN
LNHGRVNNATFRRALNTATIHLPETEMSLLEDRFRGQEPNSFDYMSFCEE
IESIFATKNLEKDPLKEPFEYKPDPEYSQEKLIIEEAQAASDAIRRIGDV
VRQRRIQLHPLFNDFDINHRMTVSQNQFRRVLVELDLASSLSESDWACLF
KQFRHPVGIRDDVNYLAFNDAVYEAAGFAYRMP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 613..687
e-value: 2.9E-11
score: 45.1
coord: 11..85
e-value: 1.5E-7
score: 33.1
coord: 483..565
e-value: 4.1E-5
score: 25.4
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 13..924
NoneNo IPR availablePANTHERPTHR20875:SF0GH12158Pcoord: 13..924
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 740..903
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 27..322
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 362..441
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 499..686