DEP domain-containing protein

Overview
NameDEP domain-containing protein
Smed IDSMED30010473
Length (bp)5196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DEP domain-containing protein (SMED30010473) t-SNE clustered cells

Violin plots show distribution of expression levels for DEP domain-containing protein (SMED30010473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DEP domain-containing protein (SMED30010473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DEP domain-containing protein (SMED30010473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010473h1SMcG0009446 Contig6675uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010473h1SMcG0009446 Contig6675newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010473h1SMcG0014949 Contig6675uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010473h1SMcG0014949 Contig6675newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30010473h1SMcG0009446 SmedASXL_032786SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010473h1SMcG0009446 dd_Smed_v4_8467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010473h1SMcG0009446 dd_Smed_v4_8467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010473h1SMcG0009446 dd_Smed_v4_8467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010473h1SMcG0009446 dd_Smed_v4_8467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010473h1SMcG0009446 dd_Smed_v4_8467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DEP domain-containing protein vs. Ensembl Human
Match: DEPDC5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:HGNC Symbol;Acc:HGNC:18423])

HSP 1 Score: 335.495 bits (859), Expect = 4.121e-100
Identity = 178/438 (40.64%), Postives = 276/438 (63.01%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSS 1355
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPA 431          
BLAST of DEP domain-containing protein vs. Ensembl Human
Match: DEPDC5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:HGNC Symbol;Acc:HGNC:18423])

HSP 1 Score: 335.495 bits (859), Expect = 4.121e-100
Identity = 178/438 (40.64%), Postives = 276/438 (63.01%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSS 1355
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPA 431          
BLAST of DEP domain-containing protein vs. Ensembl Human
Match: DEPDC5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:HGNC Symbol;Acc:HGNC:18423])

HSP 1 Score: 336.265 bits (861), Expect = 2.067e-99
Identity = 178/438 (40.64%), Postives = 276/438 (63.01%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSS 1355
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPA 431          
BLAST of DEP domain-containing protein vs. Ensembl Human
Match: DEPDC5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:HGNC Symbol;Acc:HGNC:18423])

HSP 1 Score: 336.265 bits (861), Expect = 2.067e-99
Identity = 178/438 (40.64%), Postives = 276/438 (63.01%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSS 1355
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPA 431          
BLAST of DEP domain-containing protein vs. Ensembl Human
Match: DEPDC5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:HGNC Symbol;Acc:HGNC:18423])

HSP 1 Score: 336.65 bits (862), Expect = 2.423e-98
Identity = 182/460 (39.57%), Postives = 283/460 (61.52%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEK-------LAKPKDDNNFI 1400
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +  +        L  PK+  N +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPASEKAKNGRDTSLGSPKESENAL 453          
BLAST of DEP domain-containing protein vs. Ensembl Celegans
Match: T08A11.1 (pep chromosome:WBcel235:III:4248155:4263048:-1 gene:WBGene00011604.1 transcript:T08A11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08A11.1)

HSP 1 Score: 239.58 bits (610), Expect = 3.182e-63
Identity = 134/370 (36.22%), Postives = 215/370 (58.11%), Query Frame = 3
Query:  273 LTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAI-NFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIK--IDENGRFYEDFYIVVVQNERYVGNEWR-KVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKL 1370
            L  N  +K  +   + ++LD + +  R+QY+SR+DMYR+   +   +  + +   +       +S+MW  G    SGY    TRVVFRS++S V IFIQM +EM + D  G+LY +K I  F+++LFLKW+  +C H ++I+L SR +        + D  KR +K   D  GR+Y+DFY ++ QNE Y   +W  K +K +    + Y +   Q Q+   +     +  +S+A D NFL+ +N+++N +  Y+ DR FE TG+  + +T G+GV +VDR    +TKQR+ D+G+ +D+VC+GEQPLHAVPLF+F            Y+IP+W+N+S+Y+      AI + +F PRI++     S  +K+
Sbjct:  351 LKQNDIVKCTLETVDTVSLDNVQLTFREQYMSRADMYRYRSCLIGRMTYVEEPKRYMN-INTRISDMWRKGSLVRSGYVTDKTRVVFRSSSSTVLIFIQMCSEMNQLDPQGDLYLEKCIKGFLTELFLKWKEQSCTHYVSIILCSRWYAIG----GVDDAAKRFMKGACDHRGRYYQDFYRLLFQNEHY--EDWADKQLKEINVGCSKYSS---QIQEKLKEMLPQVQFEVSTAADGNFLQVVNMSMNSFSMYHSDRRFETTGQQIIFVTPGNGVLHVDRDLVSLTKQRVIDMGISLDMVCLGEQPLHAVPLFVFHPIVGQMDKKCEYFIPHWMNYSYYQMARR-SAISV-QFRPRIQLPAAVLSAPKKM 708          

HSP 2 Score: 69.707 bits (169), Expect = 2.402e-11
Identity = 72/299 (24.08%), Postives = 118/299 (39.46%), Query Frame = 3
Query: 4224 ESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXX--XXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESC-INYSSKDHLLNTQIKNTTKNVEGKQVYCD---SLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVK 5102
            +S LGE   W    Y   ++P  AF   ++W++ TG  +A+ +        K  + L PVP DPFAL    +S+PLR PI + L  E ++ ++D                       ER + L      IL RFGFI   C + +       ++   + TK +                   +++ +YIH +GGMF               I+L +     +                          F W+WN +L+ ++        E+FQD +L++FR  C++ ++ L Q Y D K
Sbjct: 1631 DSPLGE---WTRITYDHWFYPDTAFRITMKWVMGTGQTVADTVLSWFNKASKQGMSLYPVPEDPFALAQDTHSNPLRCPIRIQLK-EKVVAHSD-----------------------EREFLL-----KILFRFGFIDIGCNVKHDFSSPRTDSSSSDHTKALSSPSPTLQLEGDDGDLDDVTISMNYIHQAGGMF---------------ISLVLSENPNRPPF-----------------------FYWAWNHLLSNRYRGQ---CSEKFQDYLLSEFRAVCSDKNDTLTQLYSDFK 1856          
BLAST of DEP domain-containing protein vs. Ensembl Fly
Match: Iml1 (gene:FBgn0035227 transcript:FBtr0333402)

HSP 1 Score: 338.576 bits (867), Expect = 1.837e-94
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 164.081 bits (414), Expect = 3.991e-40
Identity = 94/269 (34.94%), Postives = 142/269 (52.79%), Query Frame = 3
Query: 2199 GVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRR 2996
            GVDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+
Sbjct:  723 GVDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQ 973          

HSP 3 Score: 135.191 bits (339), Expect = 2.976e-31
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1225 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1477          
BLAST of DEP domain-containing protein vs. Ensembl Fly
Match: Iml1 (gene:FBgn0035227 transcript:FBtr0333401)

HSP 1 Score: 338.576 bits (867), Expect = 2.099e-94
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 162.925 bits (411), Expect = 9.209e-40
Identity = 96/291 (32.99%), Postives = 149/291 (51.20%), Query Frame = 3
Query: 2202 VDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNP 3065
            VDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+        +  + +   N +N+P
Sbjct:  765 VDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQYARKARHDTPRITEKHHNQLNSP 1037          

HSP 3 Score: 134.806 bits (338), Expect = 3.567e-31
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1233 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1485          
BLAST of DEP domain-containing protein vs. Ensembl Fly
Match: Iml1 (gene:FBgn0035227 transcript:FBtr0072704)

HSP 1 Score: 338.191 bits (866), Expect = 2.262e-94
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 166.392 bits (420), Expect = 8.062e-41
Identity = 98/293 (33.45%), Postives = 151/293 (51.54%), Query Frame = 3
Query: 2199 GVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMP-VIDNSSNLMNNP 3065
            GVDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+      +   P + +   N +N+P
Sbjct:  723 GVDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQYARKARQHDTPRITEKHHNQLNSP 997          

HSP 3 Score: 135.191 bits (339), Expect = 3.059e-31
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1193 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1445          
BLAST of DEP domain-containing protein vs. Ensembl Fly
Match: Iml1 (gene:FBgn0035227 transcript:FBtr0072703)

HSP 1 Score: 338.576 bits (867), Expect = 2.336e-94
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 161.384 bits (407), Expect = 2.901e-39
Identity = 93/268 (34.70%), Postives = 141/268 (52.61%), Query Frame = 3
Query: 2202 VDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRR 2996
            VDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+
Sbjct:  765 VDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQ 1014          

HSP 3 Score: 134.806 bits (338), Expect = 3.649e-31
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1266 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1518          
BLAST of DEP domain-containing protein vs. Ensembl Fly
Match: Iml1 (gene:FBgn0035227 transcript:FBtr0072705)

HSP 1 Score: 338.191 bits (866), Expect = 2.560e-94
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 164.081 bits (414), Expect = 4.711e-40
Identity = 94/269 (34.94%), Postives = 142/269 (52.79%), Query Frame = 3
Query: 2199 GVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRR 2996
            GVDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+
Sbjct:  723 GVDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQ 973          

HSP 3 Score: 134.806 bits (338), Expect = 4.151e-31
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1194 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1446          
BLAST of DEP domain-containing protein vs. Ensembl Zebrafish
Match: depdc5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:ZFIN;Acc:ZDB-GENE-091204-356])

HSP 1 Score: 342.813 bits (878), Expect = 1.823e-95
Identity = 181/458 (39.52%), Postives = 283/458 (61.79%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFE-------KSSLIEKLAKPKDDNN 1394
            +LV HKK     +D+++   K F  +  G ++EI    ND++   L+++ ++  +  QK+TIS D  +  + KL   + +   +++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R   SE+W  G++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F+SDLF KW+  NC H++T+VLFSR FY     E   ++ + +++ D  GR+YEDFY VV QNER   +EW  ++ T+K  F  Y   +     + F C  N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    ++    S I D+ Y +P+WINHSFY S ++        F PRIK++ +       K+S    L  PKD  N
Sbjct:   12 KLVVHKKGFGGSDDELMMNPKVFPQVKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVAQAFKLRAYQDVIINIVDPKEVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYVTQKVEFAG-IRAQASELWVKGEKVTCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLSDLFAKWKEKNCSHEVTVVLFSRTFYSAKTLEEFPESQRASVRQDHEGRYYEDFYRVVAQNERR--DEWMSLLVTIKKLFIQYPVLVRLKGADGFPCGHN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTVHGDSRIGDD-YNLPHWINHSFYTSKSQNSC---SCFTPRIKLAGKKVHAEKAKNSKEHSLGAPKDAEN 455          

HSP 2 Score: 143.665 bits (361), Expect = 9.841e-34
Identity = 133/516 (25.78%), Postives = 211/516 (40.89%), Query Frame = 3
Query: 3564 VRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRE----SCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            + +LE + +   G+  L          F S E VHW +S ++ +     AV  +QK++    I HAS  +   FVYGF FY +           +D  N                  +   + S   +E   ++          +R + E +F+      + +P D      FL+  +P +       H +     G       L        K V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFAL S +  DPLR  +F+PL+I+CL++                D LF+ F  E    R+ L QEAIL RFGF+++    S  N+ S++                                   YIH +G +F  +P YSK +  +         +  + N ++S  + +   E+        +G+ W++N MLT+ W TG ++ DE+  DR+L DF +FC N DNRL  F+
Sbjct: 1139 MEILEAIKHPTTGVQLLPEQRGLPPNCFVSAEVVHWLVSTVENVATQGIAVEIMQKMLEEGLITHASGDAMRTFVYGFYFYRI-----------VDKDN--------EKAPLTQLPPAGANVWSAAALEDFALF----------QRKWFEVAFVM----EERRPCDLP---AFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQKTVTLDVDVNNRSDRTEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKAASCGFLLVPVLEVPFALSSYLYGDPLRAQLFIPLNIQCLLKEGS-------------DNLFEGFEPETYWDRMQLFQEAILTRFGFVQDKFSASAFNFPSENKP--------------------------------QYIHVTGTVFLQLP-YSKRKYSSG--------QRRRRNSTTSTNQSLFGSEE-------RVGYNWAYNTMLTKAWRTG-VLGDEKLADRLLRDFTDFCANKDNRLVTFW 1556          

HSP 3 Score: 137.502 bits (345), Expect = 7.359e-32
Identity = 92/279 (32.97%), Postives = 147/279 (52.69%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP-----PALN---YSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDS-KDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--------SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+ ++     +         +  H VF+E I QRL QG+Q+I  P     PA+     SS ++       S  K +++ ++Y   +GR FH + +K  +I VT+Y P++      I Y+Y L  P +   FM    +FS + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A         + +   D+Y + +   ++        +L++ F +FLEG+N
Sbjct:  723 VGVDWKSLTTPACLPLTTDYFPDRQTLQNDYTEGCYDLLPHTDLERRDDETPV----MTAHQVFEEFICQRLMQGYQIIVQPNRKPQPAIAPPLSSSPLY--SRGLVSRRKPEEEESLYWLSMGRTFHKVCLKDKIITVTRYLPKYPYESTQIQYSYNLCPPHADAHFMPFWVEFSHERLEEYKWNYLDQYICSAG------SED---FSLIDSLKFWRTRFLLLPAGGA-----RRVADGEGHWDVYGEGAGAGRDGLAGTGDWTLLDGFIRFLEGLN 981          

HSP 4 Score: 68.1662 bits (165), Expect = 1.178e-10
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + +PIQ+HHQ   N  +L G E+++
Sbjct:  595 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEPIQIHHQTRQNMAELQGSEQRD 651          
BLAST of DEP domain-containing protein vs. Ensembl Zebrafish
Match: depdc5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:ZFIN;Acc:ZDB-GENE-091204-356])

HSP 1 Score: 342.813 bits (878), Expect = 2.189e-95
Identity = 181/458 (39.52%), Postives = 283/458 (61.79%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFE-------KSSLIEKLAKPKDDNN 1394
            +LV HKK     +D+++   K F  +  G ++EI    ND++   L+++ ++  +  QK+TIS D  +  + KL   + +   +++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R   SE+W  G++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F+SDLF KW+  NC H++T+VLFSR FY     E   ++ + +++ D  GR+YEDFY VV QNER   +EW  ++ T+K  F  Y   +     + F C  N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    ++    S I D+ Y +P+WINHSFY S ++        F PRIK++ +       K+S    L  PKD  N
Sbjct:   12 KLVVHKKGFGGSDDELMMNPKVFPQVKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVAQAFKLRAYQDVIINIVDPKEVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYVTQKVEFAG-IRAQASELWVKGEKVTCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLSDLFAKWKEKNCSHEVTVVLFSRTFYSAKTLEEFPESQRASVRQDHEGRYYEDFYRVVAQNERR--DEWMSLLVTIKKLFIQYPVLVRLKGADGFPCGHN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTVHGDSRIGDD-YNLPHWINHSFYTSKSQNSC---SCFTPRIKLAGKKVHAEKAKNSKEHSLGAPKDAEN 455          

HSP 2 Score: 143.665 bits (361), Expect = 1.234e-33
Identity = 133/516 (25.78%), Postives = 211/516 (40.89%), Query Frame = 3
Query: 3564 VRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRE----SCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            + +LE + +   G+  L          F S E VHW +S ++ +     AV  +QK++    I HAS  +   FVYGF FY +           +D  N                  +   + S   +E   ++          +R + E +F+      + +P D      FL+  +P +       H +     G       L        K V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFAL S +  DPLR  +F+PL+I+CL++                D LF+ F  E    R+ L QEAIL RFGF+++    S  N+ S++                                   YIH +G +F  +P YSK +  +         +  + N ++S  + +   E+        +G+ W++N MLT+ W TG ++ DE+  DR+L DF +FC N DNRL  F+
Sbjct: 1174 MEILEAIKHPTTGVQLLPEQRGLPPNCFVSAEVVHWLVSTVENVATQGIAVEIMQKMLEEGLITHASGDAMRTFVYGFYFYRI-----------VDKDN--------EKAPLTQLPPAGANVWSAAALEDFALF----------QRKWFEVAFVM----EERRPCDLP---AFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQKTVTLDVDVNNRSDRTEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKAASCGFLLVPVLEVPFALSSYLYGDPLRAQLFIPLNIQCLLKEGS-------------DNLFEGFEPETYWDRMQLFQEAILTRFGFVQDKFSASAFNFPSENKP--------------------------------QYIHVTGTVFLQLP-YSKRKYSSG--------QRRRRNSTTSTNQSLFGSEE-------RVGYNWAYNTMLTKAWRTG-VLGDEKLADRLLRDFTDFCANKDNRLVTFW 1591          

HSP 3 Score: 137.502 bits (345), Expect = 8.053e-32
Identity = 92/279 (32.97%), Postives = 147/279 (52.69%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP-----PALN---YSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDS-KDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--------SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+ ++     +         +  H VF+E I QRL QG+Q+I  P     PA+     SS ++       S  K +++ ++Y   +GR FH + +K  +I VT+Y P++      I Y+Y L  P +   FM    +FS + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A         + +   D+Y + +   ++        +L++ F +FLEG+N
Sbjct:  737 VGVDWKSLTTPACLPLTTDYFPDRQTLQNDYTEGCYDLLPHTDLERRDDETPV----MTAHQVFEEFICQRLMQGYQIIVQPNRKPQPAIAPPLSSSPLY--SRGLVSRRKPEEEESLYWLSMGRTFHKVCLKDKIITVTRYLPKYPYESTQIQYSYNLCPPHADAHFMPFWVEFSHERLEEYKWNYLDQYICSAG------SED---FSLIDSLKFWRTRFLLLPAGGA-----RRVADGEGHWDVYGEGAGAGRDGLAGTGDWTLLDGFIRFLEGLN 995          

HSP 4 Score: 68.1662 bits (165), Expect = 1.135e-10
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + +PIQ+HHQ   N  +L G E+++
Sbjct:  595 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEPIQIHHQTRQNMAELQGSEQRD 651          
BLAST of DEP domain-containing protein vs. Ensembl Zebrafish
Match: depdc5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:ZFIN;Acc:ZDB-GENE-091204-356])

HSP 1 Score: 80.4925 bits (197), Expect = 8.559e-16
Identity = 57/171 (33.33%), Postives = 83/171 (48.54%), Query Frame = 3
Query: 4203 KKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRE----SCINYSSKDHLLNTQIKNTT 4694
            K V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFAL S +  DPLR  +F+PL+I+CL++                D LF+ F  E    R+ L QEAIL RFGF+++    S  N+ S++      +  T 
Sbjct:   87 KTVTLDVDVNNRSDRTEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKAASCGFLLVPVLEVPFALSSYLYGDPLRAQLFIPLNIQCLLKEGS-------------DNLFEGFEPETYWDRMQLFQEAILTRFGFVQDKFSASAFNFPSENKPQYIHVTGTV 244          
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047719.1 (DEP domain containing 5 [Source:NCBI gene;Acc:100498286])

HSP 1 Score: 347.821 bits (891), Expect = 3.053e-97
Identity = 219/630 (34.76%), Postives = 339/630 (53.81%), Query Frame = 3
Query:   96 EDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKI--DENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF------------IYEIP-----ENSLNF--VR--KLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHK-----------------RIIQSDHR---------------------------KALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYG 1766
            +D+++   K F +I+ G ++EI    ND++   L+++ ++  +  QK+T+S D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R     +  VL  +    F    R  V E+W   ++   GY   +TRVVFRS +++V+IFIQMS+E+W+FD +G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR FY   N E+  +   RN  +  D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +       F    N     S+++  N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR+   +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +SS   S + D+ Y IP+WINHSFY S  + Q +    F PRIK++  K  ++  L   + +N              ++ +P     + S+ F  VR  ++ K     D     +S     E G   +    S     +  + P    H+                 R+I+S  R                           +AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G
Sbjct:   19 DDELVINPKVFPYINLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETVSIDQTVAQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLK---KIPVLSQTCYWLFL-ICRAQVGELWVKSEKVTCGYISEDTRVVFRSTSAMVYIFIQMSSELWDFDIYGDLYFEKAVNGFLADLFNKWKDKNCSHEVTVVLFSRTFYDAKNIEDFPE-AHRNASVMQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLENAEGFPPGHN-----STSDQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFQVDRSLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSSPGDSRLGDD-YNIPHWINHSFYTS--QSQPLN-NSFTPRIKLAPRK--VLASLYPKETENALPIQVDYDAYDSQVFRLPGPSRAQRSITFRAVRETQVRKSSCSYDTSCSPVSRPFTAEEGRSQNSDESSLGKLSNILLIPRPHLHQYEASSSLGYTSTRDFLERMIESQQRDSSAPGRFHVGSAESMLHVRPGGYHPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQG 628          

HSP 2 Score: 141.354 bits (355), Expect = 8.178e-33
Identity = 93/271 (34.32%), Postives = 137/271 (50.55%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP--PALNYSSTIFXXXXXXXXXXXXXXXXA----IYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSK-DFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P  P    S               +    A     Y   +GR FH + +K  +I VT+Y P++    A I+Y Y L    S+ DF+ S  +FS + LE + WNY D YI + G      ++D   + LI SLKFWR+RF LLP+              + RCDIY ++   EQ    L++ F +F+EG+N
Sbjct:  689 VGVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGAQ----MTAQQVFEEFICQRLMQGYQIIVQPKHPKAISSVPPPLSSSPLYRRGLVSRNRAEEENQYWLSMGRTFHKVTLKDKIITVTRYLPKYPYESAQISYMYSLCPSHSECDFVSSWVEFSHERLEDYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPSCVG---PTKRITEGEQRCDIYGERPRSEQEEAQLLDGFLRFVEGLN 943          

HSP 3 Score: 135.576 bits (340), Expect = 4.560e-31
Identity = 139/522 (26.63%), Postives = 214/522 (41.00%), Query Frame = 3
Query: 3543 LSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            L  ++    +LE M +   G+  L   +      F S EAVHW ++ +  +     A+  +QK++  +YI HAS  +   F+YGF  Y +                              A  E D   ++ N ++    +  +ME     +R + E + +   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+  T AFE  + W+ AT   L E +  W +K       LVPV   PF+LPS +  DPLR  +F+PL+I CL++  +             D LF+ F  E    R+ LLQE I  RFGFI++    YS+      ++ K                           YIH +G +F  +P YSK              +  + N +SS T+++  +E         IG+ W++N MLT+ W    TG    DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1038 LPTTASLSEILEAMKHPTTGIPLLSEQKCLPPGCFISAEAVHWLVNNISWVQSQVMAMDIMQKMLEEQYITHASGETFRTFIYGFYLYKI-----------------------------PADKEPD---RASNLVQPCVWHSTAMEDFTAFQRKWFEVALVEEELLHSEIPP-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSSYYHGNFSLTAAFEIKLHWMAATAAMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNISCLVKAEN-------------DHLFEGFEPETYWERMYLLQEVIAYRFGFIQD---KYSASAFNFPSENKP-------------------------QYIHVTGTVFLQLP-YSKR----------KGQQRRRRNSTSSSTQNLFGEE--------RIGYNWAYNTMLTKTWRSIGTG----DERFADRLLKDFTDFCANRDNRLGTFW 1456          
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047756.1 (DEP domain containing 5 [Source:NCBI gene;Acc:100498286])

HSP 1 Score: 335.109 bits (858), Expect = 2.989e-93
Identity = 212/613 (34.58%), Postives = 330/613 (53.83%), Query Frame = 3
Query:   96 EDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKI--DENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF------------IYEIP-----ENSLNF--VR--KLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHK-----------------RIIQSDHR---------------------------KALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNK 1715
            +D+++   K F +I+ G ++EI    ND++   L+++ ++  +  QK+T+S D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R     +  VL  +    F    R  V E+W   ++   GY   +TRVVFRS +++V+IFIQMS+E+W+FD +G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR FY   N E+  +   RN  +  D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +       F    N     S+++  N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR+   +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +SS   S + D+ Y IP+WINHSFY S  + Q +    F PRIK++  K  ++  L   + +N              ++ +P     + S+ F  VR  ++ K     D     +S     E G   +    S     +  + P    H+                 R+I+S  R                           +AL NPFAP+R  ++ TSN RRW H FP+  N++
Sbjct:   19 DDELVINPKVFPYINLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETVSIDQTVAQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLK---KIPVLSQTCYWLFL-ICRAQVGELWVKSEKVTCGYISEDTRVVFRSTSAMVYIFIQMSSELWDFDIYGDLYFEKAVNGFLADLFNKWKDKNCSHEVTVVLFSRTFYDAKNIEDFPE-AHRNASVMQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLENAEGFPPGHN-----STSDQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFQVDRSLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSSPGDSRLGDD-YNIPHWINHSFYTS--QSQPLN-NSFTPRIKLAPRK--VLASLYPKETENALPIQVDYDAYDSQVFRLPGPSRAQRSITFRAVRETQVRKSSCSYDTSCSPVSRPFTAEEGRSQNSDESSLGKLSNILLIPRPHLHQYEASSSLGYTSTRDFLERMIESQQRDSSAPGRFHVGSAESMLHVRPGGYHPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGSNHR 611          

HSP 2 Score: 141.354 bits (355), Expect = 6.589e-33
Identity = 93/271 (34.32%), Postives = 137/271 (50.55%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP--PALNYSSTIFXXXXXXXXXXXXXXXXA----IYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSK-DFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P  P    S               +    A     Y   +GR FH + +K  +I VT+Y P++    A I+Y Y L    S+ DF+ S  +FS + LE + WNY D YI + G      ++D   + LI SLKFWR+RF LLP+              + RCDIY ++   EQ    L++ F +F+EG+N
Sbjct:  643 VGVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGAQ----MTAQQVFEEFICQRLMQGYQIIVQPKHPKAISSVPPPLSSSPLYRRGLVSRNRAEEENQYWLSMGRTFHKVTLKDKIITVTRYLPKYPYESAQISYMYSLCPSHSECDFVSSWVEFSHERLEDYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPSCVG---PTKRITEGEQRCDIYGERPRSEQEEAQLLDGFLRFVEGLN 897          

HSP 3 Score: 130.183 bits (326), Expect = 2.138e-29
Identity = 133/488 (27.25%), Postives = 202/488 (41.39%), Query Frame = 3
Query: 3645 FTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            F S EAVHW ++ +  +     A+  +QK++  +YI HAS  +   F+YGF  Y +                              A  E D   ++ N ++    +  +ME     +R + E + +   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+  T AFE  + W+ AT   L E +  W +K       LVPV   PF+LPS +  DPLR  +F+PL+I CL++  +             D LF+ F  E    R+ LLQE I  RFGFI++    YS+      ++ K                           YIH +G +F  +P YSK              +  + N +SS T+++  +E         IG+ W++N MLT+ W    TG    DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1048 FISAEAVHWLVNNISWVQSQVMAMDIMQKMLEEQYITHASGETFRTFIYGFYLYKI-----------------------------PADKEPD---RASNLVQPCVWHSTAMEDFTAFQRKWFEVALVEEELLHSEIPP-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSSYYHGNFSLTAAFEIKLHWMAATAAMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNISCLVKAEN-------------DHLFEGFEPETYWERMYLLQEVIAYRFGFIQD---KYSASAFNFPSENKP-------------------------QYIHVTGTVFLQLP-YSKR----------KGQQRRRRNSTSSSTQNLFGEE--------RIGYNWAYNTMLTKTWRSIGTG----DERFADRLLKDFTDFCANRDNRLGTFW 1432          
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047660.1 (DEP domain containing 5 [Source:NCBI gene;Acc:100498286])

HSP 1 Score: 333.183 bits (853), Expect = 2.054e-92
Identity = 222/661 (33.59%), Postives = 348/661 (52.65%), Query Frame = 3
Query:   96 EDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKI--DENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF------------IYEIP-----ENSLNF--VR--KLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHK-----------------RIIQSDHRKALFNPFAPNRFNV-------------------------------RTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFE-KKNSKNMAEAWKNYYKLYTEANNK 1844
            +D+++   K F +I+ G ++EI    ND++   L+++ ++  +  QK+T+S D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R     +  VL  +    F    R  V E+W   ++   GY   +TRVVFRS +++V+IFIQMS+E+W+FD +G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR FY   N E+  +   RN  +  D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +       F    N     S+++  N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR+   +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +SS   S + D+ Y IP+WINHSFY S  + Q +    F PRIK++  K  ++  L   + +N              ++ +P     + S+ F  VR  ++ K     D     +S     E G   +    S     +  + P    H+                 R+I+S  R +     AP RF+V                               + TSN RRW H FP+  + + IQ+HHQ   N  +L G   ++ S + AE  +  Y   T +N++
Sbjct:   19 DDELVINPKVFPYINLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETVSIDQTVAQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLK---KIPVLSQTCYWLFL-ICRAQVGELWVKSEKVTCGYISEDTRVVFRSTSAMVYIFIQMSSELWDFDIYGDLYFEKAVNGFLADLFNKWKDKNCSHEVTVVLFSRTFYDAKNIEDFPE-AHRNASVMQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLENAEGFPPGHN-----STSDQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFQVDRSLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSSPGDSRLGDD-YNIPHWINHSFYTS--QSQPLN-NSFTPRIKLAPRK--VLASLYPKETENALPIQVDYDAYDSQVFRLPGPSRAQRSITFRAVRETQVRKSSCSYDTSCSPVSRPFTAEEGRSQNSDESSLGKLSNILLIPRPHLHQYEASSSLGYTSTRDFLERMIESQQRDSS----APGRFHVGSAESMLHVRPGGYHPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSGMREASHSSAELLELAYHEATGSNHR 655          

HSP 2 Score: 141.354 bits (355), Expect = 7.919e-33
Identity = 93/271 (34.32%), Postives = 137/271 (50.55%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP--PALNYSSTIFXXXXXXXXXXXXXXXXA----IYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSK-DFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P  P    S               +    A     Y   +GR FH + +K  +I VT+Y P++    A I+Y Y L    S+ DF+ S  +FS + LE + WNY D YI + G      ++D   + LI SLKFWR+RF LLP+              + RCDIY ++   EQ    L++ F +F+EG+N
Sbjct:  687 VGVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGAQ----MTAQQVFEEFICQRLMQGYQIIVQPKHPKAISSVPPPLSSSPLYRRGLVSRNRAEEENQYWLSMGRTFHKVTLKDKIITVTRYLPKYPYESAQISYMYSLCPSHSECDFVSSWVEFSHERLEDYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPSCVG---PTKRITEGEQRCDIYGERPRSEQEEAQLLDGFLRFVEGLN 941          

HSP 3 Score: 129.798 bits (325), Expect = 2.605e-29
Identity = 133/488 (27.25%), Postives = 202/488 (41.39%), Query Frame = 3
Query: 3645 FTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            F S EAVHW ++ +  +     A+  +QK++  +YI HAS  +   F+YGF  Y +                              A  E D   ++ N ++    +  +ME     +R + E + +   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+  T AFE  + W+ AT   L E +  W +K       LVPV   PF+LPS +  DPLR  +F+PL+I CL++  +             D LF+ F  E    R+ LLQE I  RFGFI++    YS+      ++ K                           YIH +G +F  +P YSK              +  + N +SS T+++  +E         IG+ W++N MLT+ W    TG    DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1092 FISAEAVHWLVNNISWVQSQVMAMDIMQKMLEEQYITHASGETFRTFIYGFYLYKI-----------------------------PADKEPD---RASNLVQPCVWHSTAMEDFTAFQRKWFEVALVEEELLHSEIPP-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSSYYHGNFSLTAAFEIKLHWMAATAAMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNISCLVKAEN-------------DHLFEGFEPETYWERMYLLQEVIAYRFGFIQD---KYSASAFNFPSENKP-------------------------QYIHVTGTVFLQLP-YSKR----------KGQQRRRRNSTSSSTQNLFGEE--------RIGYNWAYNTMLTKTWRSIGTG----DERFADRLLKDFTDFCANRDNRLGTFW 1476          
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047706.1 (DEP domain containing 5 [Source:NCBI gene;Acc:100498286])

HSP 1 Score: 332.028 bits (850), Expect = 5.135e-92
Identity = 216/634 (34.07%), Postives = 335/634 (52.84%), Query Frame = 3
Query:   96 EDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKI--DENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF------------IYEIP-----ENSLNF--VR--KLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHK-----------------RIIQSDHRKALFNPFAPNRFNV-------------------------------RTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYG 1766
            +D+++   K F +I+ G ++EI    ND++   L+++ ++  +  QK+T+S D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R     +  VL  +    F    R  V E+W   ++   GY   +TRVVFRS +++V+IFIQMS+E+W+FD +G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR FY   N E+  +   RN  +  D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +       F    N     S+++  N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR+   +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +SS   S + D+ Y IP+WINHSFY S  + Q +    F PRIK++  K  ++  L   + +N              ++ +P     + S+ F  VR  ++ K     D     +S     E G   +    S     +  + P    H+                 R+I+S  R +     AP RF+V                               + TSN RRW H FP+  + + IQ+HHQ   N  +L G
Sbjct:   19 DDELVINPKVFPYINLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETVSIDQTVAQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLK---KIPVLSQTCYWLFL-ICRAQVGELWVKSEKVTCGYISEDTRVVFRSTSAMVYIFIQMSSELWDFDIYGDLYFEKAVNGFLADLFNKWKDKNCSHEVTVVLFSRTFYDAKNIEDFPE-AHRNASVMQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLENAEGFPPGHN-----STSDQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFQVDRSLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSSPGDSRLGDD-YNIPHWINHSFYTS--QSQPLN-NSFTPRIKLAPRK--VLASLYPKETENALPIQVDYDAYDSQVFRLPGPSRAQRSITFRAVRETQVRKSSCSYDTSCSPVSRPFTAEEGRSQNSDESSLGKLSNILLIPRPHLHQYEASSSLGYTSTRDFLERMIESQQRDS----SAPGRFHVGSAESMLHVRPGGYHPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQG 628          

HSP 2 Score: 141.739 bits (356), Expect = 5.541e-33
Identity = 93/271 (34.32%), Postives = 137/271 (50.55%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP--PALNYSSTIFXXXXXXXXXXXXXXXXA----IYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSK-DFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P  P    S               +    A     Y   +GR FH + +K  +I VT+Y P++    A I+Y Y L    S+ DF+ S  +FS + LE + WNY D YI + G      ++D   + LI SLKFWR+RF LLP+              + RCDIY ++   EQ    L++ F +F+EG+N
Sbjct:  706 VGVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGAQ----MTAQQVFEEFICQRLMQGYQIIVQPKHPKAISSVPPPLSSSPLYRRGLVSRNRAEEENQYWLSMGRTFHKVTLKDKIITVTRYLPKYPYESAQISYMYSLCPSHSECDFVSSWVEFSHERLEDYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPSCVG---PTKRITEGEQRCDIYGERPRSEQEEAQLLDGFLRFVEGLN 960          

HSP 3 Score: 135.961 bits (341), Expect = 3.305e-31
Identity = 139/522 (26.63%), Postives = 214/522 (41.00%), Query Frame = 3
Query: 3543 LSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            L  ++    +LE M +   G+  L   +      F S EAVHW ++ +  +     A+  +QK++  +YI HAS  +   F+YGF  Y +                              A  E D   ++ N ++    +  +ME     +R + E + +   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+  T AFE  + W+ AT   L E +  W +K       LVPV   PF+LPS +  DPLR  +F+PL+I CL++  +             D LF+ F  E    R+ LLQE I  RFGFI++    YS+      ++ K                           YIH +G +F  +P YSK              +  + N +SS T+++  +E         IG+ W++N MLT+ W    TG    DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1055 LPTTASLSEILEAMKHPTTGIPLLSEQKCLPPGCFISAEAVHWLVNNISWVQSQVMAMDIMQKMLEEQYITHASGETFRTFIYGFYLYKI-----------------------------PADKEPD---RASNLVQPCVWHSTAMEDFTAFQRKWFEVALVEEELLHSEIPP-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSSYYHGNFSLTAAFEIKLHWMAATAAMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNISCLVKAEN-------------DHLFEGFEPETYWERMYLLQEVIAYRFGFIQD---KYSASAFNFPSENKP-------------------------QYIHVTGTVFLQLP-YSKR----------KGQQRRRRNSTSSSTQNLFGEE--------RIGYNWAYNTMLTKTWRSIGTG----DERFADRLLKDFTDFCANRDNRLGTFW 1473          
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047348.1 (DEP domain containing 5 [Source:NCBI gene;Acc:100498286])

HSP 1 Score: 331.643 bits (849), Expect = 6.883e-92
Identity = 217/642 (33.80%), Postives = 337/642 (52.49%), Query Frame = 3
Query:   96 EDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKI--DENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIE-------KLAKPKDDNNF-------------IYEIP-----ENSLNF--VR--KLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHK-----------------RIIQSDHRKALFNPFAPNRFNV-------------------------------RTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYG 1766
            +D+++   K F +I+ G ++EI    ND++   L+++ ++  +  QK+T+S D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R     +  VL  +    F    R  V E+W   ++   GY   +TRVVFRS +++V+IFIQMS+E+W+FD +G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR FY   N E+  +   RN  +  D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +       F    N     S+++  N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR+   +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +SS   S + D+ Y IP+WINHSFY S  + Q +    F PRIK++  K++  +        +  PK+  N              ++ +P     + S+ F  VR  ++ K     D     +S     E G   +    S     +  + P    H+                 R+I+S  R +     AP RF+V                               + TSN RRW H FP+  + + IQ+HHQ   N  +L G
Sbjct:   19 DDELVINPKVFPYINLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETVSIDQTVAQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLK---KIPVLSQTCYWLFL-ICRAQVGELWVKSEKVTCGYISEDTRVVFRSTSAMVYIFIQMSSELWDFDIYGDLYFEKAVNGFLADLFNKWKDKNCSHEVTVVLFSRTFYDAKNIEDFPE-AHRNASVMQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLENAEGFPPGHN-----STSDQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFQVDRSLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSSPGDSRLGDD-YNIPHWINHSFYTS--QSQPLN-NSFTPRIKLAPRKTNSEKGRTGKDPSIGSPKETENALPIQVDYDAYDSQVFRLPGPSRAQRSITFRAVRETQVRKSSCSYDTSCSPVSRPFTAEEGRSQNSDESSLGKLSNILLIPRPHLHQYEASSSLGYTSTRDFLERMIESQQRDS----SAPGRFHVGSAESMLHVRPGGYHPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQG 638          

HSP 2 Score: 141.739 bits (356), Expect = 4.991e-33
Identity = 93/271 (34.32%), Postives = 137/271 (50.55%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP--PALNYSSTIFXXXXXXXXXXXXXXXXA----IYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSK-DFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P  P    S               +    A     Y   +GR FH + +K  +I VT+Y P++    A I+Y Y L    S+ DF+ S  +FS + LE + WNY D YI + G      ++D   + LI SLKFWR+RF LLP+              + RCDIY ++   EQ    L++ F +F+EG+N
Sbjct:  716 VGVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGAQ----MTAQQVFEEFICQRLMQGYQIIVQPKHPKAISSVPPPLSSSPLYRRGLVSRNRAEEENQYWLSMGRTFHKVTLKDKIITVTRYLPKYPYESAQISYMYSLCPSHSECDFVSSWVEFSHERLEDYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPSCVG---PTKRITEGEQRCDIYGERPRSEQEEAQLLDGFLRFVEGLN 970          

HSP 3 Score: 130.568 bits (327), Expect = 1.471e-29
Identity = 133/488 (27.25%), Postives = 202/488 (41.39%), Query Frame = 3
Query: 3645 FTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            F S EAVHW ++ +  +     A+  +QK++  +YI HAS  +   F+YGF  Y +                              A  E D   ++ N ++    +  +ME     +R + E + +   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+  T AFE  + W+ AT   L E +  W +K       LVPV   PF+LPS +  DPLR  +F+PL+I CL++  +             D LF+ F  E    R+ LLQE I  RFGFI++    YS+      ++ K                           YIH +G +F  +P YSK              +  + N +SS T+++  +E         IG+ W++N MLT+ W    TG    DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1100 FISAEAVHWLVNNISWVQSQVMAMDIMQKMLEEQYITHASGETFRTFIYGFYLYKI-----------------------------PADKEPD---RASNLVQPCVWHSTAMEDFTAFQRKWFEVALVEEELLHSEIPP-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSSYYHGNFSLTAAFEIKLHWMAATAAMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNISCLVKAEN-------------DHLFEGFEPETYWERMYLLQEVIAYRFGFIQD---KYSASAFNFPSENKP-------------------------QYIHVTGTVFLQLP-YSKR----------KGQQRRRRNSTSSSTQNLFGEE--------RIGYNWAYNTMLTKTWRSIGTG----DERFADRLLKDFTDFCANRDNRLGTFW 1484          
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Match: Depdc5 (DEP domain containing 5 [Source:MGI Symbol;Acc:MGI:2141101])

HSP 1 Score: 338.961 bits (868), Expect = 2.342e-96
Identity = 185/461 (40.13%), Postives = 285/461 (61.82%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY    TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S    S + D+ Y IP+WINHSFY S ++L       F PRIK++ +KS+  EK    +D +    +  EN+L
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEETRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAGGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKSA-SEKTKNGRDTSLGTPKESENTL 453          

HSP 2 Score: 150.599 bits (379), Expect = 6.350e-36
Identity = 108/336 (32.14%), Postives = 165/336 (49.11%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMI----------TNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNM 3131
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I          T PP L+ SS ++        S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+     F  + LE++ WNY D YI + G     S D    + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++
Sbjct:  730 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLS-SSPLY---SRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG-----SED----FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSL 1044          

HSP 3 Score: 63.1586 bits (152), Expect = 4.000e-9
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSRQRD 650          
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Match: Depdc5 (DEP domain containing 5 [Source:MGI Symbol;Acc:MGI:2141101])

HSP 1 Score: 338.961 bits (868), Expect = 2.788e-94
Identity = 185/461 (40.13%), Postives = 285/461 (61.82%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY    TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S    S + D+ Y IP+WINHSFY S ++L       F PRIK++ +KS+  EK    +D +    +  EN+L
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEETRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAGGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKSA-SEKTKNGRDTSLGTPKESENTL 453          

HSP 2 Score: 209.534 bits (532), Expect = 7.841e-54
Identity = 203/790 (25.70%), Postives = 328/790 (41.52%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXX------XXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENA 4496
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P     ++T+     +         S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+     F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++      +         +   + M   +Y+ +      +     V  P +  S    Q S  Q+A +V ++  +  S      R +        NQ       NS N    IE+      F S  +   SS       L+ SS  V +LE M +   G+  L   +  +   F S E VHW ++ ++ +      +  +QK++  + I HAS  +   F+YGF FY +                                 E +     + +  W   Y    +     +R + E +F+   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL++ CL++  
Sbjct:  739 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSLGEQQTTVHGKSSTQPAENSSVAM-TPTYVDSPRKD-GAFFMEFVRSPRTASSAFYPQASVDQTAPLVLDSTSLGVSTGQPMDRGN--------NQ----TFGNSQN----IEQ-----AFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIV-----------------------------MDKEPERVAMQQPSAPW---YTAGADDFASFQRKWFEVAFVAEELVHSEIPA-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEG 1449          

HSP 3 Score: 63.1586 bits (152), Expect = 3.685e-9
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSRQRD 650          
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Match: Depdc5 (DEP domain containing 5 [Source:MGI Symbol;Acc:MGI:2141101])

HSP 1 Score: 337.421 bits (864), Expect = 1.161e-93
Identity = 185/461 (40.13%), Postives = 285/461 (61.82%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY    TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S    S + D+ Y IP+WINHSFY S ++L       F PRIK++ +KS+  EK    +D +    +  EN+L
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEETRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAGGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKSA-SEKTKNGRDTSLGTPKESENTL 453          

HSP 2 Score: 149.058 bits (375), Expect = 2.963e-35
Identity = 103/332 (31.02%), Postives = 163/332 (49.10%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXX------XXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNM 3131
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P     ++T+     +         S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+     F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++
Sbjct:  730 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSL 1044          

HSP 3 Score: 145.206 bits (365), Expect = 3.597e-34
Identity = 131/512 (25.59%), Postives = 206/512 (40.23%), Query Frame = 3
Query: 3564 VRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            V +LE M +   G+  L   +  +   F S E VHW ++ ++ +      +  +QK++  + I HAS  +   F+YGF FY +                                 E +     + +  W   Y    +     +R + E +F+   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL++ CL++      S H         LFD F  E    R+ L QEAI  RFGF+++    YS      N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS  +++  +E         +G+ W++N MLT+ W +     DE+F DR+L DF +FC N DNRL  F+
Sbjct: 1144 VEILEAMKHPSTGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIV-----------------------------MDKEPERVAMQQPSAPW---YTAGADDFASFQRKWFEVAFVAEELVHSEIPA-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEG----SEH---------LFDSFEPETYWDRMHLFQEAIAHRFGFVQD---KYSVS--AFNFPAENKPQ-----------------------YIHVTGTVFLQLP-YSKRKFSGQ--------QRRRRNSTSSTNQNMFCEE--------RVGYNWAYNTMLTKTWRSS-ATGDEKFADRLLKDFTDFCINRDNRLVTFW 1557          

HSP 4 Score: 63.1586 bits (152), Expect = 4.311e-9
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSRQRD 650          
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Match: Depdc5 (DEP domain containing 5 [Source:MGI Symbol;Acc:MGI:2141101])

HSP 1 Score: 337.421 bits (864), Expect = 1.224e-93
Identity = 185/461 (40.13%), Postives = 285/461 (61.82%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY    TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S    S + D+ Y IP+WINHSFY S ++L       F PRIK++ +KS+  EK    +D +    +  EN+L
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEETRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAGGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKSA-SEKTKNGRDTSLGTPKESENTL 453          

HSP 2 Score: 268.47 bits (685), Expect = 5.056e-72
Identity = 260/988 (26.32%), Postives = 412/988 (41.70%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXX------XXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P     ++T+     +         S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+     F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++      +         +   + M   +Y+ +      +     V  P +  S    Q S  Q+A +V ++  +  S      R +        NQ       NS N    IE+      F S  +   SS       L+ SS  V +LE M +   G+  L   +  +   F S E VHW ++ ++ +      +  +QK++  + I HAS  +   F+YGF FY +                                 E +     + +  W   Y    +     +R + E +F+   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL++ CL++      S H         LFD F  E    R+ L QEAI  RFGF+++    YS      N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS  +++  +E         +G+ W++N MLT+ W +     DE+F DR+L DF +FC N DNRL  F+
Sbjct:  730 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSLGEQQTTVHGKSSTQPAENSSVAM-TPTYVDSPRKD-GAFFMEFVRSPRTASSAFYPQASVDQTAPLVLDSTSLGVSTGQPMDRGN--------NQ----TFGNSQN----IEQ-----AFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIV-----------------------------MDKEPERVAMQQPSAPW---YTAGADDFASFQRKWFEVAFVAEELVHSEIPA-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEG----SEH---------LFDSFEPETYWDRMHLFQEAIAHRFGFVQD---KYSVS--AFNFPAENKPQ-----------------------YIHVTGTVFLQLP-YSKRKFSGQ--------QRRRRNSTSSTNQNMFCEE--------RVGYNWAYNTMLTKTWRSS-ATGDEKFADRLLKDFTDFCINRDNRLVTFW 1579          

HSP 3 Score: 62.7734 bits (151), Expect = 4.663e-9
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSRQRD 650          
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Match: Depdc5 (DEP domain containing 5 [Source:MGI Symbol;Acc:MGI:2141101])

HSP 1 Score: 150.214 bits (378), Expect = 1.134e-36
Identity = 144/536 (26.87%), Postives = 235/536 (43.84%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXX------XXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADI--TYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINST-LDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMN 3740
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P     ++T+     +         S    ++   Y   +GR FH + +K  +I VT+Y P++    A I  TY+ C    DS +F+     F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++      +         +   + M   +Y+ +  P  +       V  P +  S    Q S  Q+A +V ++  +  S      R +        NQ       NS N    IE+      F S  +   SS       L+ SS  V +LE M +   G+  L   +  +   F S E VHW ++ ++ +      +  +Q L +
Sbjct:   92 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSLGEQQTTVHGKSSTQPAENSSVAM-TPTYVDS--PRKDGAFFMEFVRSPRTASSAFYPQASVDQTAPLVLDSTSLGVSTGQPMDRGN--------NQ----TFGNSQN----IEQ-----AFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQWLCS 586          
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W0E3|IML1_DROME (GATOR complex protein Iml1 OS=Drosophila melanogaster OX=7227 GN=Iml1 PE=1 SV=2)

HSP 1 Score: 338.576 bits (867), Expect = 2.341e-93
Identity = 180/424 (42.45%), Postives = 272/424 (64.15%), Query Frame = 3
Query:  102 DILFTAKDFSFISKGSLLEIYQ--QENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGY-FRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK-TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSL 1358
            D++   KD    + G ++EIY   +EN  H L++I   N +   +D IS +S + N+ K+ P  ++  +++    + LD ++I  +DQY+ RS+M+R   ++ ++ + ++KK+D+     R  V EMW  G+R  SG    +T++VFRS+TS+V++F+QMS+EMW+FD  G+LYF+KA+N F+++LF KW+  +C H++TIVLFSR FY   + +   ++++  ++ D  GRFYEDFY V +QNER   ++W  V+  L+  F +Y+ T L   ++ N        S   SA   NFLE LNI+LN +E +Y+DR F+RTG++ VVIT G GV++VDR  T+ITKQRI D GVG DLVC+GEQPLHAVPL  F  K ++  + + Y +P+WIN SFY S N  + I    FIPRIK+    S L
Sbjct:   20 DLVMNLKDHPNANVGDVVEIYAPDEENGTHLLLQITEFNGS-CGRDVISIESGIANAFKMRPYSNVVMRIVKPADVALDSIEITFKDQYMGRSEMWRLKTYLTDTCVYVNKKIDYNDMQIRCQVYEMWSQGERVASGVITEDTKIVFRSSTSMVYLFLQMSSEMWDFDIHGDLYFEKAVNGFLTELFQKWRKLSCNHEVTIVLFSRTFYAAKSLDEFPEHMRDCLQQDYKGRFYEDFYRVAIQNER--CDDWCTVLGQLRKLFTSYQATVLRYHERENMKIPPATNS---SATQGNFLEVLNISLNTFEKHYLDRTFDRTGQLSVVITPGVGVFSVDRELTNITKQRIIDNGVGSDLVCVGEQPLHAVPLLKFHNKDTTLTSADDYSLPHWINLSFY-STN--KKIVYSSFIPRIKLPLFGSQL 434          

HSP 2 Score: 161.384 bits (407), Expect = 2.908e-38
Identity = 93/268 (34.70%), Postives = 141/268 (52.61%), Query Frame = 3
Query: 2202 VDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMIT---NPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRR 2996
            VDWKSLT+PA LPIT+DY+P  R L ++++ S+Y L+ +  N +   +   +RKPL   +V +E++ QRL QGFQ+I     PP  +  S+        +     ++ N  Y   +GRIFH I +   +I VT Y PRH     ++ Y Y    P  + + +S   F+T+ LE FNWN+ D YI   G            Y L+ SLK+WR R YLLP  +       +      RCDI+ D +       +E+F + +E ++K+KR+
Sbjct:  765 VDWKSLTIPACLPITTDYFPDKRSLNNDYVISDYTLLPDDVNHDYAQSRAVYRKPLSTEEVCKEIVSQRLAQGFQLIVVDEKPPTASGCSS----GSAVQPVKLSRETNKEYLLSIGRIFHKISLSGSVITVTGYRPRHPYPPINVDYRYRFHAPQHETYEISGVNFTTEKLENFNWNHMDLYICTRGD---------VDYPLMESLKYWRYRMYLLPRENI-----VSKIASCQRCDIFPDVTADNTREQVEDFVRLIEAVSKLKRQ 1014          

HSP 3 Score: 134.806 bits (338), Expect = 3.657e-30
Identity = 98/307 (31.92%), Postives = 146/307 (47.56%), Query Frame = 3
Query: 4188 NGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ-LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKML-TRKW---TTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            N  +Y++  L+I+ ++  +R EWG  ++     P  AFE +V+W+ ++G  +A+ I  W +K +    LV VP DP A P +  SDPLRGPIF+PL    L   A                LFDEF +E R  R++  QEAIL +FGF+   C+                   +E K      L  +      + Y+H +G MFA+I   +     N  +  P+  E   +     +T + N  +         +GFLW+WN M+  +KW   T       E FQ +ML DFREFC+N+D RL  F+
Sbjct: 1266 NKRVYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKANQFNFLVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA---------------LFDEFPEESRSDRMLFFQEAILGKFGFL--PCV-------------------LEKKYSVGKDLPKE------YQYVHCTGNMFALIRCATN----NYQVESPILKEANVTRCVYGHTNNTNVPK--------KVGFLWAWNHMIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW 1518          
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Match: sp|O75140|DEPD5_HUMAN (GATOR complex protein DEPDC5 OS=Homo sapiens OX=9606 GN=DEPDC5 PE=1 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 7.346e-93
Identity = 182/460 (39.57%), Postives = 283/460 (61.52%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSS---SNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEK-------LAKPKDDNNFI 1400
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S+   S + D+ Y IP+WINHSFY S ++L       F PRIK++ +K +  +        L  PK+  N +
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAEGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKPASEKAKNGRDTSLGSPKESENAL 453          

HSP 2 Score: 262.692 bits (670), Expect = 2.296e-69
Identity = 258/988 (26.11%), Postives = 412/988 (41.70%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNP------PALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     + +       +    VF+E I QRL QG+Q+I  P      PA+    +          S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+    +FS + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        +  CDIY D+   +++   L++ F +F+EG+N+          +++ +     +M+ P+  +S      P   K  S    LLEM+ S   +      +      +   +   + +  +Y+ +      +     V  P +  S    Q S  Q+A  + +   +         R ++    N  N     I     +     +   +Q    SL ++   +  LE   +   S  V++L E    Q GL    SP     Y F S E VHW ++ ++ I     A+  +QK++  + I HAS  +   F+YGF FY +                                 E D     +    W   +   ++     +R + E +F+   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL+I CL++      S H         LFD F  E    R+ L QEAI  RFGF+++    YS+     N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS  +++  +E         +G+ W++N MLT+ W +     DE+F DR+L DF +FC N DNRL  F+
Sbjct:  740 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADIDRRDEDGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGLVSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVEFSHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEAHCDIYGDRPRADEDEWQLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGPISTHSLESTAPPVGKKGTSALSALLEMEASQKCLGEQQAAVHGGKSSAQSAESSSVAMTPTYMDSPRKD-GAFFMEFVRSPRTASSAFYPQVSVDQTATPMLDGTSLGICTGQSMDRGNSQTFGNSQN-----IGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILE--AMKHPSTGVQLLSE----QKGL----SP-----YCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIVT-----------------------------DKEPDRVAMQQPATTW---HTAGVDDFASFQRKWFEVAFVAEELVHSEIPA-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISCLLKEG----SEH---------LFDSFEPETYWDRMHLFQEAIAHRFGFVQD---KYSAS--AFNFPAENKPQ-----------------------YIHVTGTVFLQLP-YSKRKFSGQ--------QRRRRNSTSSTNQNMFCEE--------RVGYNWAYNTMLTKTWRSS-ATGDEKFADRLLKDFTDFCINRDNRLVTFW 1591          

HSP 3 Score: 62.3882 bits (150), Expect = 4.424e-8
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSGQRD 650          
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Match: sp|P61460|DEPD5_MOUSE (GATOR complex protein DEPDC5 OS=Mus musculus OX=10090 GN=Depdc5 PE=1 SV=2)

HSP 1 Score: 337.421 bits (864), Expect = 8.560e-93
Identity = 185/461 (40.13%), Postives = 285/461 (61.82%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKS---SSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            +LV HKK     +D+++   K F  I  G ++EI    ND++   L+++ ++  +  QK+TIS D  +    +L P + +   V++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R    E+W   ++   GY    TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F++DLF KW+  NC H++T+VLFSR FY   + +   +  + +I+ D  GRFYEDFY VVVQNER    EW  ++ T+K  F  Y   +   Q   F    N     S++   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    +S    S + D+ Y IP+WINHSFY S ++L       F PRIK++ +KS+  EK    +D +    +  EN+L
Sbjct:    8 KLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAG-IRAQAGELWVKNEKVMCGYISEETRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERR--EEWTSLLVTIKKLFIQYPVLVRLEQAGGFPQGDN-----STSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDD-YNIPHWINHSFYTSKSQLFC---NSFTPRIKLAGKKSA-SEKTKNGRDTSLGTPKESENTL 453          

HSP 2 Score: 268.47 bits (685), Expect = 3.537e-71
Identity = 260/988 (26.32%), Postives = 412/988 (41.70%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXX------XXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNY--CLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--SLIEEFFKFLEGINK----------IKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+  +     +         +    VF+E I QRL QG+Q+I  P     ++T+     +         S    ++   Y   +GR FH + +K  +I VT+Y P++    A I Y Y  C    DS +F+     F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A  T        ++ CDIY DK   +++   L++ F +F+EG+N+          I++ +     +M+ P+  +S      P   K  S    LLEM+ S  ++      +         +   + M   +Y+ +      +     V  P +  S    Q S  Q+A +V ++  +  S      R +        NQ       NS N    IE+      F S  +   SS       L+ SS  V +LE M +   G+  L   +  +   F S E VHW ++ ++ +      +  +QK++  + I HAS  +   F+YGF FY +                                 E +     + +  W   Y    +     +R + E +F+   L     P        FL+  +P +       H +     G       L        + V LD++ +   +R EW    Y  N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL++ CL++      S H         LFD F  E    R+ L QEAI  RFGF+++    YS      N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS  +++  +E         +G+ W++N MLT+ W +     DE+F DR+L DF +FC N DNRL  F+
Sbjct:  730 VGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDRRDEEGVQ----MTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDS-EFVSCWVDFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLP---ACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIRKGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQKSLGEQQTTVHGKSSTQPAENSSVAM-TPTYVDSPRKD-GAFFMEFVRSPRTASSAFYPQASVDQTAPLVLDSTSLGVSTGQPMDRGN--------NQ----TFGNSQN----IEQ-----AFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKIV-----------------------------MDKEPERVAMQQPSAPW---YTAGADDFASFQRKWFEVAFVAEELVHSEIPA-------FLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEG----SEH---------LFDSFEPETYWDRMHLFQEAIAHRFGFVQD---KYSVS--AFNFPAENKPQ-----------------------YIHVTGTVFLQLP-YSKRKFSGQ--------QRRRRNSTSSTNQNMFCEE--------RVGYNWAYNTMLTKTWRSS-ATGDEKFADRLLKDFTDFCINRDNRLVTFW 1579          

HSP 3 Score: 62.7734 bits (151), Expect = 3.262e-8
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+  + + IQ+HHQ   N  +L G  +++
Sbjct:  594 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHHQTRQNMAELQGSRQRD 650          
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54XA2|Y9099_DICDI (DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279099 PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.548e-60
Identity = 136/382 (35.60%), Postives = 214/382 (56.02%), Query Frame = 3
Query:   69 LVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDC--NSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIF 1205
            L  H +   +++++   + F  +    +L+IY   N    L       S  + K  IS    +         K +   ++ E    +D +++  +DQY+ RSDM+R   ++QN  + + KKL F    R  V EM  NGQ+  SG    +T+ VFRS ++   +FIQMS EMW++   GELYF+KA+N F+ +LF +W++ +  H +TI+LFSR F+ N   +++ D +  NI  +  G+ Y+DFY VVV  E     +W  +I  LK  FN+Y T +      N+D    ++     S+A   NFLE +N+ ++ ++ +YIDR+F RTG++ VVI+AG+G++ VD     ITKQR+ D G+G DL+C+   PLH VPLF F
Sbjct:   12 LWVHDQQFSKEELVVNPEYFPKLKIMDVLKIYSPSNPSKRLCLRVKQLSPLKTKLQISISKYVAGVFDFALRKEVVVNIIPEKQAIIDFVELSFKDQYIGRSDMWRLKLNLQNECVYVLKKLAFA-QIRAQVEEMVSNGQKVSSGLIDDSTKFVFRSRSAKFVLFIQMSKEMWDYSPDGELYFEKAVNGFLKNLFQRWKSLSVNHTITIILFSRTFHEN---DDILDEIP-NIPRNPQGKLYQDFYKVVVNEE--TRPDWSSIIVNLKREFNDYHTSV------NWDIYGRNSALGKNSTASQGNFLEAINLGMSYFDKHYIDRDFTRTGQMIVVISAGTGIFEVDPDINLITKQRMIDNGIGCDLICLNNHPLHVVPLFKF 380          
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4PE51|IML1_USTMA (Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=IML1 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.814e-50
Identity = 110/351 (31.34%), Postives = 194/351 (55.27%), Query Frame = 3
Query:  201 DNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTEL--------------EQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFR 1208
            D V   PQ +  IS    + N+             + ++  T+D +++  RDQY+ R++M+R   +++++ +   +K+   G  R T+  ++   ++  SGY  A+T+ +FRS ++  ++FIQ+S EMWEFD  GE+Y++KA+  FI +L  +W+     H +T++LF+R+ Y     E+    ++  I+ D  G++Y D+Y VVV  E      W  V+ TLK  F  ++ ++              E+   +      +    +SS+ + N LE +N+ LN ++ +YIDR+  RTG   V +TAG+G ++VD+    IT +R+ + G G+DLVC+ + PLH+VPLF F+
Sbjct:  120 DFVARQPQLQ--ISVSKNIANNYGFYNRAEAILTRVTKDDFTIDHVELYFRDQYVGRAEMWRVFQNLEDTCVYCGQKVTLAGSVRATIGRIFIKEKKVTSGYVSASTKAIFRSESAKYNLFIQLSREMWEFDEDGEIYYEKALQGFIPELLRRWRAVPTNHILTVILFARVHY----DESEIHMLEGPIRQDARGKYYIDYYKVVVDLESNC--NWDAVMTTLKEEFFRFQHDILLIRRPISGPAASHEELHADLIRDRVHMAGRISSSYEGNLLEAINLALNPFDEHYIDRDLNRTGLSMVFLTAGTGHFDVDKKLLRITTERMIENGTGLDLVCLTKMPLHSVPLFHFK 462          
BLAST of DEP domain-containing protein vs. TrEMBL
Match: A0A132AEU0 (DUF3608 domain-containing protein OS=Sarcoptes scabiei OX=52283 GN=QR98_0080000 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.924e-128
Identity = 342/1023 (33.43%), Postives = 517/1023 (50.54%), Query Frame = 3
Query:   63 CRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQ-QENDKHHLIKIDNVNSNPQQ--KDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAI-NFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFI---YEIPENSLNFVRKLSKPEIVSDNISGV-----ISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKXXXXXXXXXXXXXXXXXXXPKSPFRETDDSSVIMEKAEFHIINDK--ISDDSIGVSLLPXXXXXXXXXXXXXXXXXIKGSINRRVHT-LFTEGEQKWSWDQPKEDE-SPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXX------XXXXXXXHRKP--LGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXX---RCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSN 3050
             +L  H++   +DDI+   KDF  I  G ++EIY   +N    L++I N           TIS +  +  + +L     +   V+++N + LD +++  +DQYLSRSDM+R   H+ N+ + ++KK++F    R  V EMW  G R  SGY    T++VFRSA+S       MS+EMW++D  G+LYF+KA+  F+SDLF KW+ +NC HD+TIVLFSR FY+  +     ++++  ++ D  GRFYED+Y V VQNER+  ++W   +  L+  FN Y+ ++  + +      +N   Y S+A   NFLE LN++LN++E + +DR+F+RTG++ VVI+ G GVY VD   T+ITKQRI D G+G DLVC+GEQPLHAVPLF F  +  SNI ++ Y +P+WIN SFY S   +       FIPRIK+    S+ I    +  + N  I   ++I  +S N  +KLS  + +   +S +      S S + E   L + ++    SKDD  +   +    R       KAL NPF P+   ++  SN RRW+HVFP+      +Q HH  A+  P      + +S  M ++ +         NN                     ++ F +  DS V  +K     IN+K  I D +  ++L          Q +      I+   +++  + L T+    W+W    E E +P             GVDWKSL +PA LPIT+D+ P  R L+ +++   Y L+    +S       S+ + +   KP  L     ++ELI+QRL QGFQ+I  P   N  +            +        Y   +GRI+H +  K++ I +  Y PRH     +I Y Y ++ PD+  + +S   F+++ LE + WNY D+YI   G        D   Y L  SLK+WR R  +LPT  +    I           +CDIYD  S  E+  L + F K L+ IN IK       P +    I  SSN
Sbjct:    4 VKLNTHQRNHYQDDIVICQKDFPDIKIGDVVEIYSIDDNFSRLLLQITNTEKLKANCTSPTISIEQSIAMTFQLRNFSDVIMNVIDKNTVPLDSVELFFKDQYLSRSDMWRLRKHLTNTCVHLNKKVEFSN-IRCQVFEMWSQGCRMASGYINDETKIVFRSASS------MMSSEMWDYDINGDLYFEKAVKGFLSDLFNKWKTFNCSHDVTIVLFSRTFYQASDINEFPESMRECLQQDYKGRFYEDYYRVAVQNERF--DDWTPTLIYLRELFNLYEEDVIHYHERR--GFTNVRPYNSTASQGNFLEVLNMSLNVFERHNLDRSFDRTGQLSVVISPGVGVYEVDLDLTNITKQRIIDNGIGSDLVCLGEQPLHAVPLFKFISR-HSNIPNDEYNMPHWINLSFYSSKQSISL-SSNSFIPRIKMPNIDSNPITISNRRDNSNGSILINHKITSSSKNSSQKLSSIDTIDGFVSYIPKNNSFSLSTSVE-NKLNNENHIKIKSKDDIVVYNSRDEQHRT------KALINPFDPSHVTIKLNSNRRRWTHVFPLGPTGIFMQQHHYQAV--PQKKSLLQNDSNAMYDSNEILNGKLKNLNN---------------------RTSFDQI-DSPVTTQKT----INNKNCIGDGNKKLTL-------NKRQSTSESEKKIENDFHQKQRSQLLTDNSLLWAWGATGEQEWTP---------AITTGVDWKSLVMPACLPITTDFLPDKRTLQQDYVTYVYDLLPEEQSSYNDQYRFSKSDEKFETKPTILTNDQFYEELIFQRLQQGFQIIFLPKQDNRYAI-----------NDRTGNKFTYILSIGRIYHELAHKENKISIIYYHPRHPYKANNIRYCYRIRTPDNSTYGVSWVDFNSEKLETYKWNYLDNYICLKG--------DYAEYPLTESLKYWRFRLLVLPTQQSKTKKIIDKYLSGEDDFQCDIYDILSFEEKIHLQKGFIKLLKVINGIKL------PLLKAQTISQSSN 937          

HSP 2 Score: 128.257 bits (321), Expect = 1.174e-25
Identity = 88/305 (28.85%), Postives = 145/305 (47.54%), Query Frame = 3
Query: 4200 YKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXX-XXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKY--RDINDLITLPVKIEETQSNLSSS---YTRHVN--TDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +K   +D+E +  +R EW   +Y + Y P  AFE +++W+VATG  + + ++     K + L +VP+P DPFALP S  SDPLRGPI++ L+I+CL                       +  + E+L+     QE IL +FGF+                                     D  T     ++H SG +F +IP+ +    + I++     +K  E +   S      TRH +    +D D+   + IGFLW WN ++T++W T  +  DE    +++ DFR FC+N ++RL++F+
Sbjct: 1148 FKNFTIDLEQK-TDRVEWVNVKYHSLYDPEQAFELLIEWMVATGNAIPDIVATWGRTKGTNLHIVPIPWDPFALPFSSRSDPLRGPIYISLNIDCL--------------------QLSKMLEGEKLFN---FQEKILVKFGFLP----------------------------------FHDPSTDNQRQFVHVSGSIFVLIPNKTAVSSQKISNKRGKFLKTNEPKLACSPHEEYITRHFSGMQQKDEDAHIDIKIGFLWCWNYLITKRWKTN-VTGDENSMRKIMKDFRGFCSNKNDRLQEFW 1393          
BLAST of DEP domain-containing protein vs. TrEMBL
Match: A0A2T7PE36 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07099 PE=4 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 8.499e-123
Identity = 244/631 (38.67%), Postives = 356/631 (56.42%), Query Frame = 3
Query:   63 CRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQEND-KHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD--NHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF-----------IYEIPE---------------------NSLNFVRKLSKPEI--VSDNISGV---------------------ISTSNNCERGGLY--------HGSYGSHNSKDDTFINPI------KPGHKRIIQS-DHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHH 1733
            C+L  H+  K + DI+   KDF  +  G +LEIY  E +    L+++D++  + QQKDTIS D  + N+ KL   + +         + LD+++++ ++QY +RSDM+R ++ ++N+ + ++KK++F    R  V+EMW  G +   G    +TRVV+RS+T+VV IFIQMS+EMWEFD  G+LYF+KA+N F++DLF KW+  NC HD+TIVLFSR  Y + + ++   +++  +++D+ G  YED+Y V+VQNERY   EW   ++ L+  FN Y   + ++ QN +       + +S+A   NFLETLN++LNL+ENYY+DRNF+RTGKV VVIT G GV+ VDR  T ITKQR  D GVG DLVC+GEQPLHAVPLF FR K+S N  +  + Y IP+W+NHSFY S +++Q  Q  KFIPRIK   E    + K  + ++DNNF           ++++P                      ++    R++  P    VSD+  GV                     +++ +     G Y          S+ S  S D  F  P+        GH R        +AL NPFAP+R   + TSN RRW H  P D     +Q HH
Sbjct:    5 CKLWVHRNTKSQQDIIIPPKDFPGVMIGDVLEIYHPEEEFSRLLLQVDSLPEDFQQKDTISIDQSIANTFKLRAYQDVVVTKTEPQNVALDMVELLFKEQYFNRSDMWRLVNSVKNTCVYLNKKIEFSE-MRCQVNEMWSKGDKVTCGVITEDTRVVYRSSTAVVQIFIQMSSEMWEFDLNGDLYFEKAVNGFLTDLFAKWKEQNCCHDVTIVLFSRTCYSSTSLDDFPSDIRECLQVDDFGNIYEDYYRVIVQNERY--EEWNNTLRLLRKLFNEYPERVLRYHQNQWPKWKFPAARISTASQGNFLETLNMSLNLFENYYLDRNFDRTGKVSVVITPGPGVFEVDRELTFITKQRTIDCGVGSDLVCMGEQPLHAVPLFKFRSKNSQNSVEVGDDYNIPHWMNHSFYTSKSQIQNQQSAKFIPRIKPPPEFVKFLLK-TEGREDNNFPFVDYDEYDAQVFKLPSRMFQRTSRSASCFTSRLAAKHHTFAEARRMCGPRTRHVSDDFMGVTVDSSDKKTKMSSSAIAIPSTLTSPDTSYSVGCYPIYEKHISQESFDSWGSDDIPFPRPVVGSAGSPVGHSRPSGGFPPNRALINPFAPSRLQFKMTSNRRRWVHALPTDAKGLTVQPHH 631          

HSP 2 Score: 163.696 bits (413), Expect = 1.751e-36
Identity = 115/313 (36.74%), Postives = 158/313 (50.48%), Query Frame = 3
Query: 4185 KNGILYKKVVLDI-ESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXX--QLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSY--SKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETV----NIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLD 5096
            K  +L+K V +D+  S   +R EW    Y A Y P  AFE  +QW+VATG  L E I  W++K       L+PVP DPFALP+ +NSDPLR PIFVPL+++               + D+ + +F + S E R  RL+L+Q+ ILKR+GF+R   IN    D          T N   K +    L           Y+H + GMF +IP    S   + +     P     +     S+   H N      S + +    ++GFLWSWN M +++W +G    DE FQD+MLADFREFC N D RL+ F  D
Sbjct: 1284 KATLLHKYVNVDVNPSGKSDRQEWASACYNAYYSPLCAFEIQIQWMVATGCILGETIYSWARKAGPCGFHLIPVPVDPFALPNCVNSDPLRSPIFVPLAVD--------------DVEDS-ESIFTDCSSEVRQERLLLIQDTILKRYGFVR---INVPVPD-------PGKTDNSSSKSLSSQHLYMQ---EYVHQYVHCTAGMFVLIPDLYPSLLSNAHGPARYPPSPTVSYVAKKSTSDMHKNYIARQQSSQKMIQNHHVGFLWSWNFMSSKRWRSG-STGDEAFQDKMLADFREFCQNKDGRLEAFLKD 1567          

HSP 3 Score: 160.614 bits (405), Expect = 1.814e-35
Identity = 101/295 (34.24%), Postives = 153/295 (51.86%), Query Frame = 3
Query: 2169 LDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAX---XXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMI--------TNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKM 3020
            LD +   + I VDWKSLT+PA LPIT+DY+P +  L+ +++ ++Y L+ +   +     +      R PL  H+VF+ELI QRL QGFQ+I        ++ P++  S   F        + + +D    Y   +GRIFH + +K   I VT+  PRH       TY Y  + PDS  +  S T+F  + LE +NW+Y D YI   G            + L   LK+WRSRF+LLP+++           +  RCDIY++K+  E   L   F +F E +NK+KR   + + K+
Sbjct:  778 LDSDNFCQGISVDWKSLTMPACLPITTDYFPESGSLQYDYVFADYSLLPDDINADQLYDKNLKFYRRPPLTTHEVFRELISQRLGQGFQLIVSKKNGKKSDTPSVAKSQQ-FQHVTGMMQARQKEDSEEEYYLSIGRIFHNLHLKGSTITVTKSWPRHPQPKRTYTYFYRFQAPDSYCYDASSTEFFNEQLENYNWSYLDQYICTRGE---------ADHGLADFLKYWRSRFFLLPSNNT--ATKKIIDGQSSRCDIYEEKTPAELKQLTMSFVRFCEVLNKLKRLPQSRRTKV 1060          

HSP 4 Score: 71.633 bits (174), Expect = 2.346e-8
Identity = 34/91 (37.36%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 3537 DKLSDSSPYVRVLEEMMNSQNGLTFLQS-PEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFY 3806
            D+L+ SSP  +++E M++ Q GL+F+Q  P  P   TF S EAV WC   +        A + +Q+L++ + + HAS    H F+YGF  Y
Sbjct: 1095 DRLTQSSPSSKIVEAMLDPQTGLSFIQGQPGLPGN-TFISAEAVAWCQQHVSGAQTTAQATMVIQRLVDDQLVLHASGNPRHMFIYGFYLY 1184          
BLAST of DEP domain-containing protein vs. TrEMBL
Match: A0A0L8FG79 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22022561mg PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 9.918e-117
Identity = 242/636 (38.05%), Postives = 345/636 (54.25%), Query Frame = 3
Query:   66 RLVFHKKLKPEDDILFTAKDFSFISKGSLLEIY-QQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD--NHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIE--KLAKPKD--------DNNFIY----------------EIPENS---------------LNFVRKLSKPEI--VSDNISGV----------------ISTSNNCERGGL-----------YHGSYGSHNSKDDTFINPI------KPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHH 1733
            +L  H++   E D+L   KDF  I++G +LEIY  Q N    L++++ +  + Q K+ IS +S +  +  L P   +    ++   ++LD+++++ ++QY SRSDM+R    + N+   ++KK++F    R  VSE+W  G+R   G    NTR+VFRS+T+VV IFIQMS+EMW+FD  G+LYF+KA+N F++DLF KW+  NC HD+TIVLFSR FY   + +   + ++  I+ D  GRFYEDFY VVVQNERY   +W   +  L+  FN Y  ++ ++ +         E+  S+A   NFLETLN++LNL+E YY+DR+F+RTG+V VVIT G GV+ VDR  T+ITK R  D G+G DLVC+GEQPLHA PLF F  K+     +  + Y IP+W+NHSFY   + L   +   FIPRIK       ++E  K+   +D        DN+F +                 +P  S               +  V+K  KP    +SD+ SG+                I   N+ E G              H  +G  +S D T   PI        GH R      RKAL NPFAP+R   + TSN RRW H FP D +   +Q HH
Sbjct:   11 KLYVHERNFKEYDLLINPKDFPGINQGDVLEIYNAQVNYSRLLLQVNTLTEDLQAKECISVESSIAGAFHLKPYNDVYVNKVDPTEVSLDLVELLYKEQYYSRSDMWRMRKKLVNTCAYLNKKIEFAE-MRCQVSELWSKGERVTCGVIDDNTRIVFRSSTAVVQIFIQMSSEMWDFDVHGDLYFEKAVNGFLTDLFAKWKEQNCCHDVTIVLFSRTFYSASSCDEFPEIIRDWIQQDYKGRFYEDFYRVVVQNERY--EDWASTLIQLRVIFNEYPQKVVRYHEACGLTVPPAEN--STASQGNFLETLNMSLNLFERYYLDRSFDRTGQVAVVITPGPGVFEVDRELTNITKHRTIDCGIGSDLVCMGEQPLHAAPLFKFHSKTEKITLEVGDDYNIPHWMNHSFYTFKSPLLGTE-STFIPRIK----PPKILEDIKMKSKEDVYSSSYYSDNDFTFIDYDGYDTQVFKFPSRGVPRTSKGSGHFSSLRKRPTTVAEVKKNRKPRTRYISDDFSGLFTENTPKSTATSPAISIPIQNSTELGSPIVSYPLTDRSNAHDFFGLADSDDCTITRPIVGSAGSPVGHSRNYHHRPRKALINPFAPSRMRFKMTSNRRRWVHAFPTDPSGAAVQTHH 636          
BLAST of DEP domain-containing protein vs. TrEMBL
Match: A0A0L8FG47 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22022561mg PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 3.113e-113
Identity = 241/645 (37.36%), Postives = 346/645 (53.64%), Query Frame = 3
Query:   66 RLVFHKKLKPEDDILFTAKDFSFISKGSLLEIY-QQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD--NHYYIPYWINHSFYRSVNELQAIQMGKFI-----PRIKVSFEK----SSLIE--KLAKPKD--------DNNFIY----------------EIPENS---------------LNFVRKLSKPEI--VSDNISGV----------------ISTSNNCERGGL-----------YHGSYGSHNSKDDTFINPI------KPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHH 1733
            +L  H++   E D+L   KDF  I++G +LEIY  Q N    L++++ +  + Q K+ IS +S +  +  L P   +    ++   ++LD+++++ ++QY SRSDM+R    + N+   ++KK++F    R  VSE+W  G+R   G    NTR+VFRS+T+VV IFIQMS+EMW+FD  G+LYF+KA+N F++DLF KW+  NC HD+TIVLFSR FY   + +   + ++  I+ D  GRFYEDFY VVVQNERY   +W   +  L+  FN Y  ++ ++ +         E+  S+A   NFLETLN++LNL+E YY+DR+F+RTG+V VVIT G GV+ VDR  T+ITK R  D G+G DLVC+GEQPLHA PLF F  K+     +  + Y IP+W+NHSFY   + L   +   FI     P+I          +S++E  K+   +D        DN+F +                 +P  S               +  V+K  KP    +SD+ SG+                I   N+ E G              H  +G  +S D T   PI        GH R      RKAL NPFAP+R   + TSN RRW H FP D +   +Q HH
Sbjct:   11 KLYVHERNFKEYDLLINPKDFPGINQGDVLEIYNAQVNYSRLLLQVNTLTEDLQAKECISVESSIAGAFHLKPYNDVYVNKVDPTEVSLDLVELLYKEQYYSRSDMWRMRKKLVNTCAYLNKKIEFAE-MRCQVSELWSKGERVTCGVIDDNTRIVFRSSTAVVQIFIQMSSEMWDFDVHGDLYFEKAVNGFLTDLFAKWKEQNCCHDVTIVLFSRTFYSASSCDEFPEIIRDWIQQDYKGRFYEDFYRVVVQNERY--EDWASTLIQLRVIFNEYPQKVVRYHEACGLTVPPAEN--STASQGNFLETLNMSLNLFERYYLDRSFDRTGQVAVVITPGPGVFEVDRELTNITKHRTIDCGIGSDLVCMGEQPLHAAPLFKFHSKTEKITLEVGDDYNIPHWMNHSFYTFKSPLLGTE-STFIPRIKPPKIPGHLPHGGNCASVLEDIKMKSKEDVYSSSYYSDNDFTFIDYDGYDTQVFKFPSRGVPRTSKGSGHFSSLRKRPTTVAEVKKNRKPRTRYISDDFSGLFTENTPKSTATSPAISIPIQNSTELGSPIVSYPLTDRSNAHDFFGLADSDDCTITRPIVGSAGSPVGHSRNYHHRPRKALINPFAPSRMRFKMTSNRRRWVHAFPTDPSGAAVQTHH 649          
BLAST of DEP domain-containing protein vs. TrEMBL
Match: A0A1S3HEX7 (GATOR complex protein DEPDC5 OS=Lingula unguis OX=7574 GN=LOC106153972 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 7.888e-110
Identity = 221/560 (39.46%), Postives = 322/560 (57.50%), Query Frame = 3
Query:  315 NLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD--NHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEK---------SSLIEKLAKPKDDNNF---------IYEIPEN-------------------------SLNFVRKLSKP--EIVSDNISGVISTSNNCERGGLYHG------------------------------SYGSHNSKDDTFINPI------KPGHKRIIQSDH--RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQ 1736
             +++LD++++II+DQYLSRSDM+RF   ++N+ + + KK+DF G  R  V+E+W  G +   GY   +TR+V+RS+T+VVHIF+QMS+EMWEFD FG+LYF+KA++ F++DLF+KW+  NC HD+TIV+FSR FY   + E+  ++++  I+ D  GRFYEDFY VVVQNE Y   EW  V+  LK  F +Y     Q+ Q+        +++ S+A   NFLE LN++LN+YE YYIDRNF+R GKV +V+T G+GV+ VDR  T +TKQR  D G+G DLVC+GEQPLHAVPLF F   + ++  D  + Y+IP+WINHSFY S +++Q      F+PRIK++  K          ++++ +++  D   F         ++++P +                         SLN    + +P    +SD++SG++S   +  +     G                              S GS +S DD    P+        GH    Q  H  R+AL NPFAP+R   + TSN RRW H FP+D+    I  HHQ
Sbjct:    2 TVVSLDLMELIIKDQYLSRSDMWRFTKSLRNTCMYVGKKVDFIG-MRAQVNELWAKGDKMTCGYVSEDTRIVYRSSTAVVHIFLQMSSEMWEFDAFGDLYFEKAVSGFLTDLFVKWKEQNCLHDVTIVMFSRTFYDAHSLEDFPESMRECIQQDYKGRFYEDFYRVVVQNECY--KEWTGVLVDLKQFFIDYPKTTIQYHQDQ--GAKVPKAWNSTAAMGNFLEVLNMSLNVYEKYYIDRNFDRLGKVAIVVTPGAGVFEVDRELTTMTKQRTIDTGMGSDLVCMGEQPLHAVPLFRFHSSTPNDFLDVGDDYHIPHWINHSFYTSRSQIQTTSSLSFVPRIKLAKMKPNVKDKEDIENIVDGMSEEDDRLPFVDYDEYDAQVFKLPNSRTRTPKSRNTRSAASLYSSARKTPQSLNEAMAIKRPRNRTISDDVSGLLSDDQSVGKRSPAIGIPGKVKSADLLSTSLGTIPIPLAEISTSQHSVGSEDS-DDFMERPVVGSAGFPAGHHLPAQFRHPPRRALINPFAPSRMRFKMTSNRRRWVHAFPLDQQGAAILPHHQ 555          

HSP 2 Score: 187.578 bits (475), Expect = 9.270e-44
Identity = 108/335 (32.24%), Postives = 173/335 (51.64%), Query Frame = 3
Query: 2112 GEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALN-------YSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSG 3095
            G + W W        P+            GVDW+S++LPA+LP+++D++P  R L ++++ S Y+L+ +  NS+     +S+++P+   +VF+ELIYQR  QGFQ+I  P   +        +S ++    +   +     ++  Y+  +GRI+H + +    I V +Y PRH   L  + Y Y  K PDS ++ +S   F  Q LE +NWNY D+YI   G            Y L+ SLK+W+SRF LLP H+          +   RCD+Y++KS+ EQ  + E F K LE +NKI+R     KP ++ PV  +S+ +    +  K  S   
Sbjct:  689 GSKSWQW-------GPVTGEQEWSPTITTGVDWRSMSLPAVLPMSTDFFPDKRSLHNDYVISEYKLLPDVINSDISYECRSNKRPMTTMEVFKELIYQRFGQGFQVIVGPKNSSPNNQSDLSTSPMYKGTASLIRARSRTIQSEEYRLSIGRIYHKVNLTGPEITVVRYRPRHPYTLRTVHYKYRFKCPDSVNYDVSWVTFKNQQLENYNWNYLDNYICTKGEG---------DYGLMESLKYWKSRFLLLPCHNP---ATKKIIDGAERCDVYEEKSLEEQQQMTEGFVKILEMLNKIRRPGQGRKPGLT-PVSADSTVIAPADATAKTDSTPA 1003          

HSP 3 Score: 183.341 bits (464), Expect = 1.468e-42
Identity = 115/320 (35.94%), Postives = 161/320 (50.31%), Query Frame = 3
Query: 4200 YKKVVLDIE--SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXX--XXXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITL-------PVKIEE--TQSNLSSSYTRHVNTDED----------SDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            YK + +D +  S+ G R EW   +Y ANY+P  A+E  + WLV TG  L E +S  +         L+ VP DPFALP + NSDPLRGPI+VPL+++CL +             D I  +F E+  + R  RL LLQE ILKRFGF+ +SC+  + +   LN Q  +T                         ++H +GGMF MIP  +      +   L       P  + +  T+SN    Y        D          S   E + +GFLW WN ML+++W + P   DE FQD++LADFR FC+N DNRL++F+
Sbjct: 1191 YKHIKIDTDPASKCG-RPEWCTMRYHANYNPLCAYELTLNWLVCTGPVLGELVSGWVRKVSTCSYHLLAVPVDPFALPYTDNSDPLRGPIYVPLNVQCLTD-------------DEISPVFSEYDSDSRSERLRLLQEFILKRFGFMLDSCLVQTPRP--LNYQSDDTKPQ----------------------WVHCTGGMFVMIPDSAASAIPENSTCLTDRRMPNPTAMHKLFTKSNAHKDYIERQRNRADSVNISFSSDISAGTEDIKVGFLWCWNSMLSKRWRS-PNTGDESFQDKVLADFRAFCSNQDNRLREFW 1471          

HSP 4 Score: 63.5438 bits (153), Expect = 6.204e-6
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query: 3528 LELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFY 3806
            ++ +KLS SSP   VL++M +  NGL FL   E     +F S+EA  W    ++      +AV  LQ +++ K I H    + H++++GF  Y
Sbjct: 1010 IQEEKLSMSSPLSAVLKKMQDPSNGLKFLPVQEGLPSQSFVSFEATEWVQENVEGAAGFPTAVALLQTMVDEKMICHGCRNTRHRYIHGFYLY 1102          
BLAST of DEP domain-containing protein vs. Ensembl Cavefish
Match: depdc5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:ZFIN;Acc:ZDB-GENE-091204-356])

HSP 1 Score: 327.791 bits (839), Expect = 8.575e-91
Identity = 180/459 (39.22%), Postives = 281/459 (61.22%), Query Frame = 3
Query:   69 LVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLF-SRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD-NHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            LV HKK     +D+++   K F  +  G ++EI    ND++   L+++ ++  +  QK+TIS D  +  + KL   + +   +++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R   SE+W  G++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F+SDLF KW+  NC H++T+VLF + L Y         ++ + +I+ D  GRFYEDFY VV QNER   +EW  ++ T+K  F  Y   +     + F C  N     S+A   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    ++    +  + Y +P+WINHSFY S ++  +     F PRIK++  K    EK    KD +    +  ENSL
Sbjct:   12 LVVHKKGFGGSDDELMMNPKVFPQVKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVAQAFKLRAYQDVIINIVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYVTQKVEFAG-IRAQASELWVKGEKVTCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLSDLFAKWKEKNCSHEVTVVLFLTYLLY------EFPESQRGSIRQDHEGRFYEDFYRVVAQNERR--DEWTSLLITIKKLFIQYPVLVRLKGADGFPCGQN-----STAAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTVPGDSRLDDYNLPHWINHSFYTSKSQGSS---SCFTPRIKLAGRKLH-AEKSKSSKDHSLGAQKDSENSL 450          

HSP 2 Score: 147.517 bits (371), Expect = 6.437e-35
Identity = 138/508 (27.17%), Postives = 217/508 (42.72%), Query Frame = 3
Query: 3579 EMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVY-LCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +++  Q GL        PN   F S E VHW ++ ++ +     AV  +QK+++   + HAS  +   F+YGF FY + +                               ESD      N +    V+   ++E     +R + E +F+      + +P D      FL+  +P +       H +     G       L        K V LD++ +   +RAEW    YQ N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL+I+ L             + D+ D LFD F  E    R+ L QEAIL RFGF+++    +S+     N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS ++ +   E+        +G+ W++N MLT+ W TG ++ DE+  DR+L DF +FC+N DNRL  F+
Sbjct: 1107 QLLPEQKGLP-------PN--CFISAEVVHWLMNTVENVATQGIAVEIMQKMLDDGLVAHASGDAMRTFIYGFYFYKIVD------------------------------KESDKV--PTNQLPPAGVWSTAAVEDFALFQRKWFEVAFV----LEERRPCDLP---AFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQKTVTLDVDVNNRSDRAEWCSCYYQGNFSLNSAFEIKLHWMAVTAAVLFEMVQGWHRKAASCGFLLVPVLEVPFALPSYLYGDPLRAQLFIPLNIQSL-------------LRDSSDSLFDGFEPETYWDRMQLFQEAILYRFGFVQD---KFSAS--AFNFPAENKPQ-----------------------YIHVTGTVFMQLP-YSKRK-------YSCGQQRRRRNSASSASQSLFGCEE-------RVGYNWAYNTMLTKAWRTG-VLGDEKLADRLLRDFTDFCSNKDNRLVAFW 1509          

HSP 3 Score: 110.923 bits (276), Expect = 9.337e-24
Identity = 79/274 (28.83%), Postives = 128/274 (46.72%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRK---PLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKD-FMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--------SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+ ++                 PL I       I+ RL                           S  K +++ +++   +GR FH + +K  +I VT+Y P++      I Y+Y L  P ++  F+    +F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A         + +   D+Y D     ++        +L++ F +FLEG+N
Sbjct:  732 VGVDWKSLTTPACLPLTTDYFPDRQTLQNDYTEGCYDLLPHTDLDRYTHTYTGTHTAPVPLPIDLSIHPCIHSRL--------------------------VSRRKAEEEESLFWLSMGRTFHKVCLKDKIITVTRYLPKYPYESTQIQYSYSLCPPHAEGHFVPCWVEFGHERLEEYKWNYLDQYICSAG------SED---FSLIDSLKFWRTRFLLLPAGGA-----RRVADGEGHWDVYGDGPGAGRDGFGASGDWALLDGFIRFLEGLN 965          

HSP 4 Score: 64.6994 bits (156), Expect = 1.033e-9
Identity = 26/57 (45.61%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+    + IQ+HHQ   N  +L G E+++
Sbjct:  592 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPTGEAIQIHHQTRQNMAELQGSEQRD 648          
BLAST of DEP domain-containing protein vs. Ensembl Cavefish
Match: depdc5 (DEP domain containing 5, GATOR1 subcomplex subunit [Source:ZFIN;Acc:ZDB-GENE-091204-356])

HSP 1 Score: 327.405 bits (838), Expect = 8.914e-91
Identity = 180/459 (39.22%), Postives = 281/459 (61.22%), Query Frame = 3
Query:   69 LVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLF-SRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITD-NHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSL 1424
            LV HKK     +D+++   K F  +  G ++EI    ND++   L+++ ++  +  QK+TIS D  +  + KL   + +   +++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G  R   SE+W  G++   GY   +TRVVFRS +++V+IFIQMS EMW+FD +G+LYF+KA+N F+SDLF KW+  NC H++T+VLF + L Y         ++ + +I+ D  GRFYEDFY VV QNER   +EW  ++ T+K  F  Y   +     + F C  N     S+A   N+LE +N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+ D G+G+DLVC+GEQPLHAVPLF    ++    +  + Y +P+WINHSFY S ++  +     F PRIK++  K    EK    KD +    +  ENSL
Sbjct:   12 LVVHKKGFGGSDDELMMNPKVFPQVKLGDIVEI-AHPNDEYSPLLLQVKSLKED-LQKETISVDQTVAQAFKLRAYQDVIINIVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYVTQKVEFAG-IRAQASELWVKGEKVTCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLSDLFAKWKEKNCSHEVTVVLFLTYLLY------EFPESQRGSIRQDHEGRFYEDFYRVVAQNERR--DEWTSLLITIKKLFIQYPVLVRLKGADGFPCGQN-----STAAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTVPGDSRLDDYNLPHWINHSFYTSKSQGSS---SCFTPRIKLAGRKLH-AEKSKSSKDHSLGAQKDSENSL 450          

HSP 2 Score: 149.828 bits (377), Expect = 1.267e-35
Identity = 137/511 (26.81%), Postives = 218/511 (42.66%), Query Frame = 3
Query: 3570 VLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVY-LCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            +LE + +   G+  L   +      F S E VHW ++ ++ +     AV  +QK+++   + HAS  +   F+YGF FY + +                               ESD      N +    V+   ++E     +R + E +F+      + +P D      FL+  +P +       H +     G       L        K V LD++ +   +RAEW    YQ N+    AFE  + W+  T   L E +  W +K +     LVPV   PFALPS +  DPLR  +F+PL+I+ L             + D+ D LFD F  E    R+ L QEAIL RFGF+++    +S+     N   +N  +                       YIH +G +F  +P YSK +            +  + N +SS ++ +   E+        +G+ W++N MLT+ W TG ++ DE+  DR+L DF +FC+N DNRL  F+
Sbjct: 1080 ILEAIKHPTTGVQLLPEQKGLPPNCFISAEVVHWLMNTVENVATQGIAVEIMQKMLDDGLVAHASGDAMRTFIYGFYFYKIVD------------------------------KESDKV--PTNQLPPAGVWSTAAVEDFALFQRKWFEVAFV----LEERRPCDLP---AFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLAATVPEQKTVTLDVDVNNRSDRAEWCSCYYQGNFSLNSAFEIKLHWMAVTAAVLFEMVQGWHRKAASCGFLLVPVLEVPFALPSYLYGDPLRAQLFIPLNIQSL-------------LRDSSDSLFDGFEPETYWDRMQLFQEAILYRFGFVQD---KFSAS--AFNFPAENKPQ-----------------------YIHVTGTVFMQLP-YSKRK-------YSCGQQRRRRNSASSASQSLFGCEE-------RVGYNWAYNTMLTKAWRTG-VLGDEKLADRLLRDFTDFCSNKDNRLVAFW 1494          

HSP 3 Score: 110.538 bits (275), Expect = 1.073e-23
Identity = 79/274 (28.83%), Postives = 128/274 (46.72%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRK---PLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKD-FMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQN--------SLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+ ++                 PL I       I+ RL                           S  K +++ +++   +GR FH + +K  +I VT+Y P++      I Y+Y L  P ++  F+    +F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP   A         + +   D+Y D     ++        +L++ F +FLEG+N
Sbjct:  717 VGVDWKSLTTPACLPLTTDYFPDRQTLQNDYTEGCYDLLPHTDLDRYTHTYTGTHTAPVPLPIDLSIHPCIHSRL--------------------------VSRRKAEEEESLFWLSMGRTFHKVCLKDKIITVTRYLPKYPYESTQIQYSYSLCPPHAEGHFVPCWVEFGHERLEEYKWNYLDQYICSAG------SED---FSLIDSLKFWRTRFLLLPAGGA-----RRVADGEGHWDVYGDGPGAGRDGFGASGDWALLDGFIRFLEGLN 950          

HSP 4 Score: 64.6994 bits (156), Expect = 9.559e-10
Identity = 26/57 (45.61%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKN 1781
            ++AL NPFAP+R  ++ TSN RRW H FP+    + IQ+HHQ   N  +L G E+++
Sbjct:  590 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPTGEAIQIHHQTRQNMAELQGSEQRD 646          
BLAST of DEP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005893.1 (pep scaffold:Pmarinus_7.0:GL476980:101747:147917:1 gene:ENSPMAG00000005297.1 transcript:ENSPMAT00000005893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 322.013 bits (824), Expect = 8.840e-90
Identity = 178/469 (37.95%), Postives = 290/469 (61.83%), Query Frame = 3
Query:   75 FHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHH--LIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYK--TELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRIC--DLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNIT-DNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEI 1457
            FH+ +  +++++   K F  +  G +LEI   +++     L+++ ++  +  QK+T+S D  +    KL   + +   V+  + +TLD+L++  +DQY+SRSDM+R    + ++   +++K++F G  R   SE+W  G++   G+   +TRVVFRS +++V+IFIQM  EMW+F+  G+LYF+KA+N F++DLF KW++ NC H++T+VLFSR +Y   ++++  + +  +I+ D  GRFYEDFY VV QNER   ++W  ++ T+K  F  Y     L+   +  F      +++ S+A   N+LE++N++ N+++ +YI+RNF+RTG++ VVIT G GV+ VDR    +TKQR+   DLG+G+DLVC+GEQPLHAVPLF    +SS + +  + Y IP+WINHSFY S N         F PRIK++     + E   +   D  F    PEN+  F  K S+  +
Sbjct:   12 FHESV--DEEVVVNPKVFPNVKIGDILEIAHPDDEYRSPLLLQVKSLKED-LQKETVSVDQSVAGVFKLRAYQDVFVNVVEPSDVTLDLLELTFKDQYISRSDMWRLKKSLVSTCAYITQKVEFAG-IRAQASELWVKGEKVTCGFISEDTRVVFRSTSAMVYIFIQMCCEMWDFNISGDLYFEKAVNGFLTDLFTKWKDKNCSHEVTVVLFSRTYYEAKSKDDFPEALNCHIQQDFRGRFYEDFYRVVAQNER--RDDWMSLLVTIKKIFIQYPRLVRLKTVGKLGFP-----KAHNSTAAQGNYLESINLSFNVFDKHYINRNFDRTGQMTVVITPGVGVFEVDRQLMILTKQRMIDNDLGIGVDLVCMGEQPLHAVPLFKLHNRSSKDGSVGDDYNIPHWINHSFYTSKN---LSYCASFTPRIKLA--PKHIAEITLECSGDQQF----PENAKEFSCKESETSL 460          

HSP 2 Score: 134.42 bits (337), Expect = 1.288e-31
Identity = 87/266 (32.71%), Postives = 136/266 (51.13%), Query Frame = 3
Query: 2196 IGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPA--LNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDS-KDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYD-DKSVVEQNSLIEEFFKFLEGIN 2981
            +GVDWKSLT PA LP+T+DY+P  + L++++ E  Y L+ ++ +++        R  L    V++E I QRL QG+Q+I  P       S  ++                  +   +GR  H++ +K   I VT+Y P+H    A   Y Y L  P S  +F+    +F  + LE++ WNY D YI + G      ++D   + LI SLKFWR+RF LLP  +A    I   +     C+ Y+  +S  E+  LI+ F +F+E +N
Sbjct:  731 VGVDWKSLTTPACLPLTTDYFPDKQSLQNDYSEGCYDLLPDTFDADRSDEECVKR--LTTQQVYEEFISQRLMQGYQLIVQPRTRRAEISRNVYRPIKALVEEETH------HWLSMGRNLHMVSLKDKKISVTRYLPKHPYESAQFPYTYSLCTPHSDGEFLSCWVEFCHERLEEYKWNYLDQYICSAG------SED---FSLIESLKFWRTRFLLLPAATALTKRICEGEEP---CNSYEWQRSEDEELQLIDNFIRFMESLN 976          

HSP 3 Score: 127.487 bits (319), Expect = 1.471e-29
Identity = 94/327 (28.75%), Postives = 141/327 (43.12%), Query Frame = 3
Query: 4128 HKNVLDYIGNSHDPGMLFE---KNGILYKKVVLDIE-SELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXX--XXXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFY 5090
            H N+  ++  S  P  L +   +N      V L+++ +   +R EW    Y   Y  T AFE  +QW+VAT   L + +             LVP    PFALPS +  DPLR  +FVPLS+ CLI                 D LF  F  E  + R+ L QEAIL RFGFI++    YS+       + ++                          +IH +  +F++  ++         + LP  ++    +      R+  +     S     +GF W+ N MLT+ W +G    DE+F D++L DF EFC N DNRL  ++
Sbjct: 1176 HSNIPTFLLPSVLPADLTKTNIRNKTAIHTVTLEVDVNNRSDRLEWCSCYYHGQYSCTGAFELKLQWMVATAAVLFDMVQGWCRKATSCGFHLVPALDGPFALPSYLYGDPLRASLFVPLSVGCLITEGS-------------DHLFSAFDQETYMDRMHLFQEAILARFGFIQD---KYSAAAFNFPAESRS-------------------------QFIHVTEELFSLCVAF---------VQLPY-VKRKHPSGQQRRRRNSFSSTTPASLPEEKLGFCWAANGMLTKSWRSG-ATGDERFPDKLLRDFSEFCANKDNRLLHYW 1450          

HSP 4 Score: 59.3066 bits (142), Expect = 8.654e-9
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 3
Query: 1611 RKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEA 1802
            ++AL NPFAP+R  ++ TSN RRW H FP+    +  Q+HHQ+   NP+    +  +S+   E+
Sbjct:  578 QRALINPFAPSRMPMKLTSNRRRWMHTFPVGPTGEAFQIHHQMR-PNPEELALQLVDSEEFTES 640          

HSP 5 Score: 55.4546 bits (132), Expect = 1.521e-7
Identity = 28/79 (35.44%), Postives = 45/79 (56.96%), Query Frame = 3
Query: 3570 VLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFY 3806
            +L+ M +   G+ FL   +      F S EAVHW +S ++ + + + AV  LQK+++ + I HAS  +   F+YGF FY
Sbjct: 1060 ILDAMKHPNTGVQFLSEQKGLPTNCFISAEAVHWVMSTVEGMVNRQCAVDILQKMLDDQLISHASGDTLRAFIYGFYFY 1138          
BLAST of DEP domain-containing protein vs. Ensembl Yeast
Match: IML1 (GTPase-activating protein (GAP) subunit of the Iml1p/SEACIT complex; SEACIT (Iml1p-Npr2p-Npr3p) is a subcomplex of the SEA complex, a coatomer-related complex that associates dynamically with the vacuole; Iml1p functions in the SEACIT complex as a GAP for the Rag family GTPase Gtr1p (EGOC subunit), resulting in the inhibition of TORC1 signaling in response to amino acid deprivation; the Iml1p/SEACIT complex is required for non-nitrogen-starvation (NNS)-induced autophagy [Source:SGD;Acc:S000003899])

HSP 1 Score: 159.073 bits (401), Expect = 2.330e-39
Identity = 111/440 (25.23%), Postives = 213/440 (48.41%), Query Frame = 3
Query:   57 YECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEI-------YQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLT---PNKSLKFQVMNENLITL--DVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKV 1337
            Y+  L +H+    E+ ++    +F  I  G L+E+            DK       + +   +++   S  S+L   L+     P++S  +  +  N   L  DV++  I+D  L+R DM+     + ++ + M ++L F    RGT+  ++ NG++  SGY G  TR++FRS ++ +   IQ++ EMW F+  GE  F K +N F   +F KW++ +  H +TI     +        +LSD   +++   E+ +  +D++ +VV     +   W  +++TL+  F   + +L   Q +     +N     S    +NFLE +N    +  + +   +   T    ++I+ GSG+++VD +   +T +++  L + MDL+C+ + PLH VPLF +R   +      H+ +P W++  F+   N+       ++ PR K+
Sbjct:  102 YQAELGYHESRFSENLVMLNLVEFPDIKPGDLVELKTYHKNPSASNGDKKIYFIAKDFDGETKRRAKTSNVSILSGQLQTLLDLPSRSRIWIKLKPNKFDLQADVVEFNIKDCLLNRGDMWVLSSKLVDTCVFMDQRLAFLDSIRGTIKGIYRNGKKIVSGYIGEQTRIIFRSESARLIFLIQITDEMWNFEETGEQLFQKMVNSFFPKIFKKWKDVDTHHTITIAFAISM--------DLSDTSFKDLTPGESLKNSQDYFRIVVDQVSII--HWVDIMETLREEFMEIRKDLLNKQTDKGYSVANGR--FSPVIKSNFLELVNFATTILTDPFKQLDLRHTTTHVMIISPGSGLFDVDYSLLRLTGKKLLSLEMTMDLICLSKAPLHIVPLFRYRDFENK----LHHCVPLWLSVFFW---NDHDKKSNSEWTPRCKI 522          
BLAST of DEP domain-containing protein vs. Ensembl Nematostella
Match: EDO41898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S342])

HSP 1 Score: 298.901 bits (764), Expect = 9.154e-90
Identity = 168/431 (38.98%), Postives = 255/431 (59.16%), Query Frame = 3
Query:   66 RLVFHKKLKPEDDILFTAKDFSFISKGSLLEIY---QQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAIN-FISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQK---SSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKV 1337
            +L  H+    E++++   K+F    +G + EIY   +       L++I+N   + QQKDTIS    + N  +L     ++   ++   + +++ +I+I+DQYLSR+DM+R    + N+ + ++KK+   G  R  + E+W  G++   G    +TR+V+RS T+ V +FIQMS EMW+FD  G+LYF+K I+ F+ +LF KW+  N  H++TIVLFSR FY     E+     +  I  D   RFYEDFY VV+Q E+   ++W  V+ TLK  F  Y   +  +        + C S   +A D N LE  N+T+N++E +++DR F+RTG+  V++T G GV+ VDR+ T I KQR+ D GV  DLVC+ EQPLH+VPLF FR K      ++ D+ Y I +W+NHSFY S N     Q  +F+PRIKV
Sbjct:    7 KLWVHQHTFSENELIVNPKEFPDCKEGDVFEIYDPGEPVKAVRLLLQINNFIPDFQQKDTISILHSVANQFQLRTYWDVQVNKVDPKDVGIELAEILIKDQYLSRNDMWRLSKALDNTCVYVNKKVSSCG-IRCQIYELWTKGEKVSCGVINKDTRIVYRSLTAQVFLFIQMSQEMWDFDLNGDLYFEKTIHGFLYELFSKWKEQNATHEVTIVLFSRTFYDAKFIEDFPPERRPCILQDSYRRFYEDFYHVVIQREK--RDDWLPVLVTLKHHFTQYPKYINCYHDEP-GVPAGCNS---TAFDGNILEAYNLTMNIFEKHFVDRTFDRTGQTTVIVTPGPGVFEVDRSLTSIIKQRMVDSGVATDLVCMAEQPLHSVPLFKFRNKDLGQGVSLGDD-YNIAHWVNHSFYSSANA--KTQQDEFVPRIKV 427          
BLAST of DEP domain-containing protein vs. Ensembl Nematostella
Match: EDO41899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S344])

HSP 1 Score: 93.9745 bits (232), Expect = 2.519e-19
Identity = 92/320 (28.75%), Postives = 137/320 (42.81%), Query Frame = 3
Query: 4170 GMLFEKNGILYKKVVLDIESE-LGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQ--LVPVPCDPFALPSSINSDPLRGPIFVPLSIE-CLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAK 5117
             ML  +    YK V LD + +   +R EW   +Y  NY+P  AFE  V W+ ATG  + + +  W++K +     LVP P  PF  PSS N DPLR PIF+PL++  C++              D  D LF + + ++  +   LL    L RFGF+++S         L NT     T       V C   A D        ++H SG  F  I  + +  D+   +  PV         SS       +            GF W  N ML+++W +     D +   ++ A+F EFC++T   L+ F+   K    K
Sbjct:  340 AMLMGECACAYKLVNLDCDPQHKSDRPEWCTLRYHGNYNPAHAFEMEVHWIEATGSIVHDMVQSWARKATSCGFVLVPAPVSPFPDPSSGNIDPLRLPIFIPLNLSGCIV--------------DERDSLFKDLALQKIFHSFHLLS---LGRFGFLKDSPYG-----PLFNTFTFVATP------VQCR--ADD--------FVHVSGTAFVRI--HDQDEDVRLDLYGPV---------SSGLLGERGS------------GFYWETNYMLSKRWRSA-STGDLESARKLQAEFVEFCSDTKGVLRAFWESCKDEVRK 597          

HSP 2 Score: 66.6254 bits (161), Expect = 6.910e-11
Identity = 31/96 (32.29%), Postives = 51/96 (53.12%), Query Frame = 3
Query: 3531 ELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCN 3818
            E D LS  SP   +++ M++ + G+TFL S +  +   F + EAV W +  +D + D   AV   Q+++  + I HAS+ +   F YGF  +   N
Sbjct:  160 EGDVLSVKSPLEAIVDAMLDPKGGMTFLPSLKGLDSKCFLAIEAVWWLMHHVDGVADRNGAVALAQRMLEARVILHASKSTRQNFFYGFAIFQFAN 255          
BLAST of DEP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045034.1 (pep primary_assembly:ASM223467v1:17:6168060:6170188:1 gene:ENSORLG00000028003.1 transcript:ENSORLT00000045034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.241e-9
Identity = 33/130 (25.38%), Postives = 74/130 (56.92%), Query Frame = 3
Query:   66 RLVFHKKL--KPEDDILFTAKDFSFISKGSLLEIYQQEND-KHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGG 446
            +LV HKK     +D+++   K F  ++ G ++EI    ++    L+++ ++  +  QK+TIS D  +  + KL   + +   +++   +TLD++++  +DQY+ R DM+R    + ++   +++K++F G
Sbjct:    8 KLVLHKKGFGGSDDELVVNPKIFPQVNLGDVIEIAHPSDEYSPLLLQVKSLKED-LQKETISVDQTVAQAFKLRAYQDVIVNIVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYVTQKVEFAG 136          
BLAST of DEP domain-containing protein vs. Planmine SMEST
Match: SMESG000029435.1 (SMESG000029435.1)

HSP 1 Score: 3063.86 bits (7942), Expect = 0.000e+0
Identity = 1615/1699 (95.06%), Postives = 1622/1699 (95.47%), Query Frame = 3
Query:   48 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKXXXXXXXXXXXXXXXXXXXPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPXXXXXXXXXXXXXXXXXIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 5144
            MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMK S+                           IQS   AC                            + +A  ++ + P    R +  H      EPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV
Sbjct:    1 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKKSA---------------------------IQS---AC---------------------------IVTNANPMSPSRPAVHHRHSTTH------EPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 1636          
BLAST of DEP domain-containing protein vs. Planmine SMEST
Match: SMESG000029435.1 (SMESG000029435.1)

HSP 1 Score: 3039.21 bits (7878), Expect = 0.000e+0
Identity = 1606/1699 (94.53%), Postives = 1613/1699 (94.94%), Query Frame = 3
Query:   48 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKXXXXXXXXXXXXXXXXXXXPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPXXXXXXXXXXXXXXXXXIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVSSSNMXXXXXXXXXXXXXXXXDKIDLLMLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANPMSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 5144
            MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHL         GVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMK S+                           IQS   AC                            + +A  ++ + P    R +  H      EPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV
Sbjct:    1 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHL---------GVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKKSA---------------------------IQS---AC---------------------------IVTNANPMSPSRPAVHHRHSTTH------EPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 1627          
BLAST of DEP domain-containing protein vs. Planmine SMEST
Match: SMESG000029435.1 (SMESG000029435.1)

HSP 1 Score: 1935.61 bits (5013), Expect = 0.000e+0
Identity = 1022/1024 (99.80%), Postives = 1023/1024 (99.90%), Query Frame = 3
Query:   48 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKXXXXXXXXXXXXXXXXXXXPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPXXXXXXXXXXXXXXXXXIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMAXXXXXXXXXXXXXHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFXXXXXXXXXXXXXXXXAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSAXXXXXXXXXXXXXRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKVS 3119
            MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMK +
Sbjct:    1 MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIKIDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDIIIRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNHSGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDLFLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYEDFYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCESYLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVDRAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYYIPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNFIYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNSKDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFPIDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKSDQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSIGVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKEDESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLESNYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPALNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQYSPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYILNYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKIRCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSSNLMNNPSMVKVKSVSGNLLEMKFT 1024          

HSP 2 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 554/555 (99.82%), Postives = 555/555 (100.00%), Query Frame = 3
Query: 3480 QFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNIXXXXXXXXXXXXXXXDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEXXXXXXXXXXXXQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 5144
            +FTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV
Sbjct: 1022 KFTFDSLENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTFTSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGFVFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNIEWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDIPEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERAEWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPVPCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFLFDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTKNVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITLPVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTGPMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV 1576          
The following BLAST results are available for this feature:
BLAST of DEP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DEPDC54.121e-10040.64DEP domain containing 5, GATOR1 subcomplex subunit... [more]
DEPDC54.121e-10040.64DEP domain containing 5, GATOR1 subcomplex subunit... [more]
DEPDC52.067e-9940.64DEP domain containing 5, GATOR1 subcomplex subunit... [more]
DEPDC52.067e-9940.64DEP domain containing 5, GATOR1 subcomplex subunit... [more]
DEPDC52.423e-9839.57DEP domain containing 5, GATOR1 subcomplex subunit... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T08A11.13.182e-6336.22pep chromosome:WBcel235:III:4248155:4263048:-1 gen... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iml11.837e-9442.45gene:FBgn0035227 transcript:FBtr0333402[more]
Iml12.099e-9442.45gene:FBgn0035227 transcript:FBtr0333401[more]
Iml12.262e-9442.45gene:FBgn0035227 transcript:FBtr0072704[more]
Iml12.336e-9442.45gene:FBgn0035227 transcript:FBtr0072703[more]
Iml12.560e-9442.45gene:FBgn0035227 transcript:FBtr0072705[more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
depdc51.823e-9539.52DEP domain containing 5, GATOR1 subcomplex subunit... [more]
depdc52.189e-9539.52DEP domain containing 5, GATOR1 subcomplex subunit... [more]
depdc58.559e-1633.33DEP domain containing 5, GATOR1 subcomplex subunit... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047719.13.053e-9734.76DEP domain containing 5 [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000047756.12.989e-9334.58DEP domain containing 5 [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000047660.12.054e-9233.59DEP domain containing 5 [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000047706.15.135e-9234.07DEP domain containing 5 [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000047348.16.883e-9233.80DEP domain containing 5 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Depdc52.342e-9640.13DEP domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Depdc52.788e-9440.13DEP domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Depdc51.161e-9340.13DEP domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Depdc51.224e-9340.13DEP domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Depdc51.134e-3626.87DEP domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of DEP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W0E3|IML1_DROME2.341e-9342.45GATOR complex protein Iml1 OS=Drosophila melanogas... [more]
sp|O75140|DEPD5_HUMAN7.346e-9339.57GATOR complex protein DEPDC5 OS=Homo sapiens OX=96... [more]
sp|P61460|DEPD5_MOUSE8.560e-9340.13GATOR complex protein DEPDC5 OS=Mus musculus OX=10... [more]
sp|Q54XA2|Y9099_DICDI1.548e-6035.60DEP domain-containing protein DDB_G0279099 OS=Dict... [more]
sp|Q4PE51|IML1_USTMA2.814e-5031.34Vacuolar membrane-associated protein IML1 OS=Ustil... [more]
back to top
BLAST of DEP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A132AEU04.924e-12833.43DUF3608 domain-containing protein OS=Sarcoptes sca... [more]
A0A2T7PE368.499e-12338.67Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0L8FG799.918e-11738.05Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FG473.113e-11337.36Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1S3HEX77.888e-11039.46GATOR complex protein DEPDC5 OS=Lingula unguis OX=... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
depdc58.575e-9139.22DEP domain containing 5, GATOR1 subcomplex subunit... [more]
depdc58.914e-9139.22DEP domain containing 5, GATOR1 subcomplex subunit... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005893.18.840e-9037.95pep scaffold:Pmarinus_7.0:GL476980:101747:147917:1... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
IML12.330e-3925.23GTPase-activating protein (GAP) subunit of the Iml... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO418989.154e-9038.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418992.519e-1928.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DEP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000045034.11.241e-925.38pep primary_assembly:ASM223467v1:17:6168060:617018... [more]
back to top
BLAST of DEP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029435.10.000e+095.06SMESG000029435.1[more]
SMESG000029435.10.000e+094.53SMESG000029435.1[more]
SMESG000029435.10.000e+099.80SMESG000029435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010473 ID=SMED30010473|Name=DEP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5196bp
ATATTCTTCATTGAATGCGATAGATTAAATATTTTAGGTGATTTTGAATG
GATATTTATGAGTGTCGATTAGTATTTCATAAAAAGCTTAAACCAGAAGA
TGATATACTGTTTACCGCGAAAGACTTTTCATTTATCTCAAAAGGGTCTT
TGTTGGAAATATACCAACAAGAAAATGATAAACACCATTTAATAAAAATT
GACAATGTTAATTCAAATCCTCAACAAAAGGACACTATTAGTTTTGATAG
TGTCCTTGGTAATAGTTTAAAATTAACTCCGAATAAGTCATTAAAATTTC
AAGTTATGAATGAAAATTTAATCACACTTGATGTTTTGGATATTATCATT
CGTGATCAATATCTTAGCAGAAGTGATATGTATAGATTTATTCATCACAT
ACAAAATTCTGTTCTTCAAATGTCGAAAAAACTGGATTTTGGTGGGTATT
TTAGGGGAACAGTTAGTGAAATGTGGTGTAACGGCCAGAGAAATCACAGT
GGATATTTTGGCGCCAACACGAGGGTGGTTTTTCGATCTGCCACTTCTGT
TGTGCACATTTTCATTCAAATGAGCACTGAAATGTGGGAATTTGATTATT
TTGGGGAATTGTATTTCGATAAAGCAATTAACTTCATTTCAGACTTGTTC
CTCAAATGGCAAAATTACAATTGCGGACATGACATGACTATTGTACTATT
TAGTAGATTGTTTTATAGGAATTTGAATCAAGAAAACCTTTCAGATAATG
TTAAACGGAACATAAAAATAGACGAAAATGGGAGATTCTATGAAGATTTT
TACATCGTTGTTGTTCAAAATGAGCGCTATGTCGGAAATGAATGGCGGAA
AGTGATCAAAACTCTGAAATTTCGATTTAATAACTATAAAACTGAACTCG
AGCAATTTCAACAGAACAATTTCGATTGCAACAGTAATTGCGAGAGTTAT
CTGTCATCGGCGGAAGACGCAAACTTCCTTGAGACATTGAATATCACATT
AAACTTGTATGAGAATTACTATATCGATCGGAATTTTGAGAGAACTGGAA
AGGTTTGCGTCGTGATTACGGCAGGATCAGGAGTTTATAATGTTGATCGA
GCCCAAACTCATATTACAAAGCAGAGGATTTGCGATTTGGGTGTTGGCAT
GGATCTCGTATGTATTGGAGAACAGCCGTTACACGCCGTTCCATTATTTA
TATTCCGACAAAAAAGTTCTTCAAATATAACAGATAACCATTATTATATT
CCCTATTGGATAAATCACAGTTTCTATCGGTCTGTAAATGAGCTTCAAGC
CATTCAAATGGGTAAATTTATACCAAGAATTAAAGTATCTTTTGAAAAGA
GTTCTTTGATAGAAAAATTAGCTAAACCAAAAGATGATAATAATTTTATT
TACGAAATACCAGAAAATTCATTGAATTTCGTCAGGAAGTTATCGAAACC
AGAAATTGTAAGTGATAATATTTCGGGTGTGATTTCCACATCCAATAATT
GTGAGCGAGGTGGTTTGTATCATGGAAGTTATGGTAGTCACAATAGTAAA
GATGATACTTTTATCAATCCTATTAAACCGGGACACAAACGAATTATTCA
ATCAGACCACAGAAAGGCTCTTTTCAATCCTTTTGCTCCTAATAGATTTA
ATGTCCGCACCACATCTAACAGTCGTCGATGGTCTCACGTTTTCCCAATT
GATAAAAATAATAAACCGATTCAATTACATCATCAATTAGCCATTAATAA
TCCTGATTTATATGGATTCGAAAAGAAAAATTCAAAAAATATGGCTGAAG
CTTGGAAAAATTATTATAAACTGTATACTGAGGCCAATAATAAATCTGAT
CAGTCTGATGAATCTACATCTAGCTTATCTACTCGAGAAACTATCCTAAC
GCCTAAAAGTCCATTTCGTGAGACGGACGATTCAAGTGTAATAATGGAAA
AAGCTGAATTTCATATTATCAATGACAAGATTAGTGATGATTCTATTGGA
GTCAGCCTTTTGCCAAGCTCATTTCAAGGGGGAGGCAGTCAAAAATCCTT
TCATCAAAGCTCGTCAATAAAAGGGTCCATAAACCGTCGCGTTCATACAT
TATTTACCGAAGGGGAACAGAAATGGAGTTGGGATCAACCGAAAGAAGAT
GAAAGTCCTATAAATCATTTGGATGTTGAAGAATCTATCAAACTCATTGG
AGTCGACTGGAAATCTTTGACTTTACCTGCAATGTTGCCTATTACCTCTG
ATTATTATCCGAGCGCCAGAATCCTCGAGGATGAATTTTTGGAATCGAAC
TATCAATTAATGGCTAACAGTTCGAATAGTAACAGTGAAATGAATAATCA
ATCTCACAGAAAACCTCTAGGGATTCATGATGTTTTCCAAGAGCTGATTT
ATCAGCGATTAAATCAGGGATTTCAAATGATTACAAATCCCCCGGCTTTG
AATTACTCATCTACCATCTTTTCTAAGGATGTTAATAAAAAAAGTTCTTC
TAAAATCAAGGATAAAAATGCCATTTATAAATTCGGACTTGGTCGCATTT
TTCACATTATTCAAATGAAGCAGGATCTCATCCATGTTACGCAATATAGT
CCACGACATACGAATAATTTGGCTGATATTACTTATAATTATTGTCTGAA
AATGCCAGACTCCAAAGACTTCATGATGTCCAAAACAAAATTCTCTACTC
AAATGCTAGAAAAGTTCAATTGGAATTATCATGATCATTACATTCTGAAT
TACGGGGGAAATATCAATGAAAGCACTGATGATATTTGTCGCTACAAATT
AATTCCGTCTCTAAAGTTTTGGCGTAGCAGATTTTATTTGCTGCCAACAC
ATTCGGCCACTAAAACCATAATCGATACGGATAAAAACAAAAAGATTCGA
TGCGACATATATGATGATAAATCAGTTGTGGAACAGAATTCACTGATTGA
AGAATTTTTCAAATTTCTCGAAGGTATTAACAAAATAAAAAGACGATCTC
CCAATTCTAAGCCGAAAATGTCGATGCCCGTCATTGATAATTCATCAAAT
TTGATGAACAATCCCAGCATGGTGAAAGTGAAATCCGTCAGCGGTAATCT
ATTAGAAATGAAAGTAAGCTCATCAAATATGCTATGTTTATTGTTGAAAA
TTTTACTGTTAATTATGCGCTCTTTGATTGATAAAATTGATTTGCTTATG
CTTATCCAGTCTTATTTAATTGCGTGTGAACCTTCCATAAACTCAACCTT
GGACAATTTAGTCAATGTTCCTAGTAGTGGGGGTTCATTAAATCAACATC
AGAAATCAGCCATTCAATCGGCATGCATAGTCACGAATGCAAACCCAATG
TCTCCGAGTAGACCAGCGGTTCACCATCGGCATTCTACAACTCACGAACC
TAATCATTACAATCAACTCTGTGAACTCATTTCCAACAATAGTTCCAATC
CGGTAACACCGATAGAAAAGTATCCGCGTCAGTTCACGTTTGACTCGCTA
GAAAATACTATGAAATCTTCAAGTGGTTTAGAATTGGATAAGCTTAGTGA
TTCCTCACCTTATGTTAGAGTTTTAGAAGAAATGATGAATTCTCAAAATG
GTTTGACATTTTTACAATCTCCGGAATTTCCTAATGAATATACGTTCACC
TCATACGAAGCTGTCCATTGGTGCATCAGTAAATTGGACAAAATTACTGA
CGTCAAATCAGCTGTAGTATATCTACAGAAATTAATGAATTTAAAATATA
TATTTCATGCGTCGGAGTATTCTTCTCATAAATTTGTCTACGGATTTGTG
TTCTATTGTTTGTGTAATCCAACAAAATTTCTAGGAAATGGCTGGTTAGA
TGTGCGAAATATTAGCAATGCCAATAGCAGTAGTAGCTCGCTCACAAATT
TGGCTACCGATGAATCAGATAACTTTATTAAATCCAAGAATAATATTGAA
TGGGTGGAAGTGTATTTATGTTCAATGGAAATTGATGGAAAACCCGAACG
AGATTATTTAGAGAGATCGTTCCTCGGATTTCATTTGCCTGGTGATTATA
AGCCTGTTGATTCTTCCAATAATTTCATATTTCTGATGAAAGACATACCG
GAAAAATATCTCATTAATTGTTTAACTCATAAAAATGTTCTCGACTATAT
TGGTAATTCTCATGATCCCGGAATGCTATTTGAGAAAAATGGAATTTTAT
ATAAGAAAGTCGTTTTGGATATTGAAAGTGAACTGGGTGAACGAGCTGAG
TGGGGCGTGTTTCAGTATCAAGCTAACTACCATCCGACTATGGCGTTTGA
ATTTATGGTACAATGGTTGGTAGCTACCGGTGGTAAATTGGCAGAAAAAA
TTAGTCTATGGAGTAAGAAAAAGTCCATTCTTCAATTAGTTCCTGTTCCT
TGTGACCCATTTGCACTTCCCAGTTCTATCAATTCAGATCCTTTGCGTGG
ACCAATTTTTGTACCCCTGAGTATTGAATGTTTGATAGAGAATGCAGATT
ATTTCAAATCATCTCACCGTTCTATTAATGATACGATTGATTTCTTATTT
GATGAATTTTCAGATGAAGAGAGACTATATAGATTAATGTTATTGCAAGA
AGCTATTTTGAAAAGATTTGGTTTTATTCGTGAATCATGTATAAACTACT
CATCCAAAGATCATTTGTTAAATACTCAAATTAAAAATACCACAAAAAAT
GTAGAAGGAAAACAAGTGTATTGTGATTCATTGGCAACTGATGGCTGTAC
CTCTTTAACTTGGTCATATATACATTACAGTGGAGGAATGTTCGCAATGA
TTCCTTCCTATAGTAAATATAGGGATATCAACGATCTGATCACTCTGCCA
GTAAAGATTGAAGAGACCCAATCTAATTTATCTAGTTCATACACCAGACA
TGTTAATACAGACGAAGATTCAGATAGCTGGGAAACTGTTAACATTGGTT
TTCTTTGGTCTTGGAATAAAATGTTGACTCGAAAATGGACAACTGGTCCC
ATGGTTATTGACGAGCAATTCCAGGATCGAATGCTGGCTGACTTTCGTGA
ATTTTGCACCAACACCGACAATCGACTGAAACAATTTTATTTGGATGTCA
AAACGACCGCCGCAAAATATTTCTGTGATAAAACTTCACATGTTTAAATT
ATGAACTTTTTGATGCAATTTCTATTAAAATAAATCTTATTTTTGT
back to top

protein sequence of SMED30010473-orf-1

>SMED30010473-orf-1 ID=SMED30010473-orf-1|Name=SMED30010473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1700bp
MDIYECRLVFHKKLKPEDDILFTAKDFSFISKGSLLEIYQQENDKHHLIK
IDNVNSNPQQKDTISFDSVLGNSLKLTPNKSLKFQVMNENLITLDVLDII
IRDQYLSRSDMYRFIHHIQNSVLQMSKKLDFGGYFRGTVSEMWCNGQRNH
SGYFGANTRVVFRSATSVVHIFIQMSTEMWEFDYFGELYFDKAINFISDL
FLKWQNYNCGHDMTIVLFSRLFYRNLNQENLSDNVKRNIKIDENGRFYED
FYIVVVQNERYVGNEWRKVIKTLKFRFNNYKTELEQFQQNNFDCNSNCES
YLSSAEDANFLETLNITLNLYENYYIDRNFERTGKVCVVITAGSGVYNVD
RAQTHITKQRICDLGVGMDLVCIGEQPLHAVPLFIFRQKSSSNITDNHYY
IPYWINHSFYRSVNELQAIQMGKFIPRIKVSFEKSSLIEKLAKPKDDNNF
IYEIPENSLNFVRKLSKPEIVSDNISGVISTSNNCERGGLYHGSYGSHNS
KDDTFINPIKPGHKRIIQSDHRKALFNPFAPNRFNVRTTSNSRRWSHVFP
IDKNNKPIQLHHQLAINNPDLYGFEKKNSKNMAEAWKNYYKLYTEANNKS
DQSDESTSSLSTRETILTPKSPFRETDDSSVIMEKAEFHIINDKISDDSI
GVSLLPSSFQGGGSQKSFHQSSSIKGSINRRVHTLFTEGEQKWSWDQPKE
DESPINHLDVEESIKLIGVDWKSLTLPAMLPITSDYYPSARILEDEFLES
NYQLMANSSNSNSEMNNQSHRKPLGIHDVFQELIYQRLNQGFQMITNPPA
LNYSSTIFSKDVNKKSSSKIKDKNAIYKFGLGRIFHIIQMKQDLIHVTQY
SPRHTNNLADITYNYCLKMPDSKDFMMSKTKFSTQMLEKFNWNYHDHYIL
NYGGNINESTDDICRYKLIPSLKFWRSRFYLLPTHSATKTIIDTDKNKKI
RCDIYDDKSVVEQNSLIEEFFKFLEGINKIKRRSPNSKPKMSMPVIDNSS
NLMNNPSMVKVKSVSGNLLEMKVSSSNMLCLLLKILLLIMRSLIDKIDLL
MLIQSYLIACEPSINSTLDNLVNVPSSGGSLNQHQKSAIQSACIVTNANP
MSPSRPAVHHRHSTTHEPNHYNQLCELISNNSSNPVTPIEKYPRQFTFDS
LENTMKSSSGLELDKLSDSSPYVRVLEEMMNSQNGLTFLQSPEFPNEYTF
TSYEAVHWCISKLDKITDVKSAVVYLQKLMNLKYIFHASEYSSHKFVYGF
VFYCLCNPTKFLGNGWLDVRNISNANSSSSSLTNLATDESDNFIKSKNNI
EWVEVYLCSMEIDGKPERDYLERSFLGFHLPGDYKPVDSSNNFIFLMKDI
PEKYLINCLTHKNVLDYIGNSHDPGMLFEKNGILYKKVVLDIESELGERA
EWGVFQYQANYHPTMAFEFMVQWLVATGGKLAEKISLWSKKKSILQLVPV
PCDPFALPSSINSDPLRGPIFVPLSIECLIENADYFKSSHRSINDTIDFL
FDEFSDEERLYRLMLLQEAILKRFGFIRESCINYSSKDHLLNTQIKNTTK
NVEGKQVYCDSLATDGCTSLTWSYIHYSGGMFAMIPSYSKYRDINDLITL
PVKIEETQSNLSSSYTRHVNTDEDSDSWETVNIGFLWSWNKMLTRKWTTG
PMVIDEQFQDRMLADFREFCTNTDNRLKQFYLDVKTTAAKYFCDKTSHV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR027244IML1
IPR000591DEP_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: cellular component
TermDefinition
GO:0005773vacuole
GO:0005774vacuolar membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 270..290
IPR027244Vacuolar membrane-associated protein Iml1PFAMPF12257IML1coord: 98..386
e-value: 1.7E-93
score: 312.9
IPR027244Vacuolar membrane-associated protein Iml1PANTHERPTHR13179DEP DOMAIN CONTAINING PROTEIN 5coord: 6..431
coord: 518..1689
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 1153..1256
e-value: 4.2E-7
score: 31.6
IPR000591DEP domainPROSITEPS50186DEPcoord: 1197..1257
score: 9.556
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 1198..1292