RBR-type E3 ubiquitin transferase

Overview
NameRBR-type E3 ubiquitin transferase
Smed IDSMED30010468
Length (bp)2744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RBR-type E3 ubiquitin transferase (SMED30010468) t-SNE clustered cells

Violin plots show distribution of expression levels for RBR-type E3 ubiquitin transferase (SMED30010468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RBR-type E3 ubiquitin transferase (SMED30010468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RBR-type E3 ubiquitin transferase (SMED30010468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010468SMESG000046507.1 Contig5308GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010468SMESG000062644.1 PL06015B1E06ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010468SMESG000062644.1 Contig5308GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010468SMESG000062644.1 Contig38759newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010468SMESG000062644.1 Contig38759uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30010468SMESG000062644.1 dd_Smed_v6_3281_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30010468SMESG000046507.1 Contig5308GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010468SMESG000062644.1 Contig5308GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010468SMESG000062644.1 dd_Smed_v4_3281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Match: ARIH1 (ariadne RBR E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:689])

HSP 1 Score: 74.7146 bits (182), Expect = 3.789e-13
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYR-LETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C S +L  + +E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   +K       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  202 ECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLKK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 375          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Match: RNF217 (ring finger protein 217 [Source:HGNC Symbol;Acc:HGNC:21487])

HSP 1 Score: 65.855 bits (159), Expect = 8.032e-11
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLE--YKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            C   +CEECL  +L  +++ G   + CP  +C    +   ++ +++ +   K    LE   I      C +C   T  K+        R E  YK  C     + C  C    H   +C EY+K D+ L+     EI   +R     N   CPKC   + +  GCDHM+C+ C  +FC+ CG+
Sbjct:   17 CKKAVCEECLKVYLSAQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWAS-EIEHGQR-----NAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGE 193          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Match: RNF217 (ring finger protein 217 [Source:HGNC Symbol;Acc:HGNC:21487])

HSP 1 Score: 65.4698 bits (158), Expect = 2.641e-10
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLE--YKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            C   +CEECL  +L  +++ G   + CP  +C    +   ++ +++ +   K    LE   I      C +C   T  K+        R E  YK  C     + C  C    H   +C EY+K D+ L+     EI   +R     N   CPKC   + +  GCDHM+C+ C  +FC+ CG+
Sbjct:  278 CKKAVCEECLKVYLSAQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWAS-EIEHGQR-----NAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGE 454          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Match: ARIH2 (ariadne RBR E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:690])

HSP 1 Score: 60.077 bits (144), Expect = 1.162e-8
Identity = 54/195 (27.69%), Postives = 79/195 (40.51%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G+ + +SC    C  +T  D    L      R + R  L    V      Q        M+  I  +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  149 ENLLSL-ACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMV--IRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 334          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Match: ARIH2 (ariadne RBR E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:690])

HSP 1 Score: 60.077 bits (144), Expect = 1.162e-8
Identity = 54/195 (27.69%), Postives = 79/195 (40.51%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G+ + +SC    C  +T  D    L      R + R  L    V      Q        M+  I  +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  149 ENLLSL-ACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMV--IRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 334          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Match: ari-1.4 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:D3NQB5])

HSP 1 Score: 65.855 bits (159), Expect = 8.549e-11
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRL-ETGMKILSCPGVQCKTEFDCAAILQSVS----FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKML-KDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC-GD 2174
            C H+ C+EC  ++L  ++ + G   + C  + CK   +   ++  ++       YRK +    +ETN  Q K      CG           EP  R    C CG+  C  C +  H P SC       + +KM  K     +E    +  N   CPKC   + K  GC+HMSC   +C  +FCWLC GD
Sbjct:  139 CAHRACDECWKAYLTEKIVDVGQSEIECMMMDCKLLIEDEKVMSYITDPFVIAAYRKLIISSYVETNS-QLKWCPGAGCGKAV------KGEPSDREPAVCTCGERFCFACAQDWHDPLSC-------RHMKMWRKKCSDDSETLNWINANTKPCPKCSVTIEKNGGCNHMSCKSSSCRYEFCWLCLGD 313          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Match: ari-1.4 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:D3NQB5])

HSP 1 Score: 65.855 bits (159), Expect = 8.549e-11
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRL-ETGMKILSCPGVQCKTEFDCAAILQSVS----FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKML-KDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC-GD 2174
            C H+ C+EC  ++L  ++ + G   + C  + CK   +   ++  ++       YRK +    +ETN  Q K      CG           EP  R    C CG+  C  C +  H P SC       + +KM  K     +E    +  N   CPKC   + K  GC+HMSC   +C  +FCWLC GD
Sbjct:  139 CAHRACDECWKAYLTEKIVDVGQSEIECMMMDCKLLIEDEKVMSYITDPFVIAAYRKLIISSYVETNS-QLKWCPGAGCGKAV------KGEPSDREPAVCTCGERFCFACAQDWHDPLSC-------RHMKMWRKKCSDDSETLNWINANTKPCPKCSVTIEKNGGCNHMSCKSSSCRYEFCWLCLGD 313          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Match: ari-1.4 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:D3NQB5])

HSP 1 Score: 64.6994 bits (156), Expect = 1.715e-10
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRL-ETGMKILSCPGVQCKTEFDCAAILQSVS----FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKML-KDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC-GD 2174
            C H+ C+EC  ++L  ++ + G   + C  + CK   +   ++  ++       YRK +    +ETN  Q K      CG           EP  R    C CG+  C  C +  H P SC       + +KM  K     +E    +  N   CPKC   + K  GC+HMSC   +C  +FCWLC GD
Sbjct:   90 CAHRACDECWKAYLTEKIVDVGQSEIECMMMDCKLLIEDEKVMSYITDPFVIAAYRKLIISSYVETNS-QLKWCPGAGCGKAV------KGEPSDREPAVCTCGERFCFACAQDWHDPLSC-------RHMKMWRKKCSDDSETLNWINANTKPCPKCSVTIEKNGGCNHMSCKSSSCRYEFCWLCLGD 264          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Match: ari-1.3 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:O01963])

HSP 1 Score: 63.5438 bits (153), Expect = 4.284e-10
Identity = 50/185 (27.03%), Postives = 82/185 (44.32%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKI-LSCPGVQCKTEFDCAAILQSVS----FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            CNH+ C EC  ++L  ++ +  +  + C    CK   +   +L  +S      +YRK +    +E N + +     I+CG      ++   EP   +   C CG   C  CG+  H P +C   +      K +K  +  +E    +  N  +CPKCM  + K  GC+ M C    C  +FCW+C
Sbjct:  140 CNHRACAECWQAYLTNKIVSDAQSEIECMAPNCKLLIEDEKVLSYISDPTMVSKYRKLMVASYVEINCLLR-WCPGIDCGKAV---KVSHWEPRLVV---CSCGTCFCFSCGQNWHEPLNCRHLK------KWIKKCQDDSETMNWINANTKDCPKCMIPIEKNGGCNRMLCTNSGCRYEFCWMC 311          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Match: ari-1.1 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:O01965])

HSP 1 Score: 61.6178 bits (148), Expect = 1.711e-9
Identity = 53/186 (28.49%), Postives = 81/186 (43.55%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKI-LSCPGVQCKTEFDCAAILQSVS----FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKM-LKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN---CGADFCWLC 2168
            CNH+ C +C  ++L  ++    +  + C    CK   +   ++  ++       YRK +    +ETN + K     I+CG    +   E      RL   C CG   C  CG   H P +C       + LK+ LK     +E    +  N   CPKCM  + K  GC+HM+C    C  +FCW+C
Sbjct:  142 CNHRACTQCWKAYLTNKIANNAQSEIECMAPNCKLLIEDEKVMFYITDPTVIATYRKLIVASYVETNRLLK-WCPGIDCGKAVRVSHWEP-----RL-VVCSCGSRFCFSCGHDWHEPVNC-------RLLKLWLKKCNDDSETSNWINANTKECPKCMITIEKDGGCNHMTCKNTACRFEFCWMC 313          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0089508)

HSP 1 Score: 69.3218 bits (168), Expect = 8.148e-12
Identity = 80/331 (24.17%), Postives = 132/331 (39.88%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTI--TMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKL--YIRSLSQRLNNFEDKR--RKLFYHINLMFGNKWKFEMPDFNVKQLEDQF-----------KNLLIVTENIFVKAYQLDKRKQFSL----QNYLKSSACILSFY 2555
            EC H+ C  C   +L  ++  E   + +SC    C    D   +   V+  R R + + L TN   +       C ++  T   ++   EP +     C CG + C  CG+  H P  C   +K       +K  +  +E    +  N   CP+C   + K  GC+HM C   NC  +FCW+C  + +   H    + C    ED+  T           ++R  L  Y+   ++ +N+ +  +   KL+  +          EM   N+  +E QF           +  L+ T   +V AY L K  Q  +    Q  L+S+  +LS Y
Sbjct:  149 ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHVFCFACGENWHDPVKCRWLKK------WIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP--HGSSWYNCNRYDEDEAKT-----ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKME-----EMQQHNMSWIEVQFLKKAVDILCQCRQTLMYT---YVFAYYLKKNNQSMIFEDNQKDLESATEMLSEY 455          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0332850)

HSP 1 Score: 69.3218 bits (168), Expect = 8.148e-12
Identity = 80/331 (24.17%), Postives = 132/331 (39.88%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTI--TMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKL--YIRSLSQRLNNFEDKR--RKLFYHINLMFGNKWKFEMPDFNVKQLEDQF-----------KNLLIVTENIFVKAYQLDKRKQFSL----QNYLKSSACILSFY 2555
            EC H+ C  C   +L  ++  E   + +SC    C    D   +   V+  R R + + L TN   +       C ++  T   ++   EP +     C CG + C  CG+  H P  C   +K       +K  +  +E    +  N   CP+C   + K  GC+HM C   NC  +FCW+C  + +   H    + C    ED+  T           ++R  L  Y+   ++ +N+ +  +   KL+  +          EM   N+  +E QF           +  L+ T   +V AY L K  Q  +    Q  L+S+  +LS Y
Sbjct:  149 ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHVFCFACGENWHDPVKCRWLKK------WIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP--HGSSWYNCNRYDEDEAKT-----ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKME-----EMQQHNMSWIEVQFLKKAVDILCQCRQTLMYT---YVFAYYLKKNNQSMIFEDNQKDLESATEMLSEY 455          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0332851)

HSP 1 Score: 69.3218 bits (168), Expect = 8.148e-12
Identity = 80/331 (24.17%), Postives = 132/331 (39.88%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTI--TMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKL--YIRSLSQRLNNFEDKR--RKLFYHINLMFGNKWKFEMPDFNVKQLEDQF-----------KNLLIVTENIFVKAYQLDKRKQFSL----QNYLKSSACILSFY 2555
            EC H+ C  C   +L  ++  E   + +SC    C    D   +   V+  R R + + L TN   +       C ++  T   ++   EP +     C CG + C  CG+  H P  C   +K       +K  +  +E    +  N   CP+C   + K  GC+HM C   NC  +FCW+C  + +   H    + C    ED+  T           ++R  L  Y+   ++ +N+ +  +   KL+  +          EM   N+  +E QF           +  L+ T   +V AY L K  Q  +    Q  L+S+  +LS Y
Sbjct:  149 ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHVFCFACGENWHDPVKCRWLKK------WIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP--HGSSWYNCNRYDEDEAKT-----ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKME-----EMQQHNMSWIEVQFLKKAVDILCQCRQTLMYT---YVFAYYLKKNNQSMIFEDNQKDLESATEMLSEY 455          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0089506)

HSP 1 Score: 69.3218 bits (168), Expect = 8.148e-12
Identity = 80/331 (24.17%), Postives = 132/331 (39.88%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTI--TMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKL--YIRSLSQRLNNFEDKR--RKLFYHINLMFGNKWKFEMPDFNVKQLEDQF-----------KNLLIVTENIFVKAYQLDKRKQFSL----QNYLKSSACILSFY 2555
            EC H+ C  C   +L  ++  E   + +SC    C    D   +   V+  R R + + L TN   +       C ++  T   ++   EP +     C CG + C  CG+  H P  C   +K       +K  +  +E    +  N   CP+C   + K  GC+HM C   NC  +FCW+C  + +   H    + C    ED+  T           ++R  L  Y+   ++ +N+ +  +   KL+  +          EM   N+  +E QF           +  L+ T   +V AY L K  Q  +    Q  L+S+  +LS Y
Sbjct:  149 ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHVFCFACGENWHDPVKCRWLKK------WIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP--HGSSWYNCNRYDEDEAKT-----ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKME-----EMQQHNMSWIEVQFLKKAVDILCQCRQTLMYT---YVFAYYLKKNNQSMIFEDNQKDLESATEMLSEY 455          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0306057)

HSP 1 Score: 69.3218 bits (168), Expect = 8.148e-12
Identity = 80/331 (24.17%), Postives = 132/331 (39.88%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTI--TMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKL--YIRSLSQRLNNFEDKR--RKLFYHINLMFGNKWKFEMPDFNVKQLEDQF-----------KNLLIVTENIFVKAYQLDKRKQFSL----QNYLKSSACILSFY 2555
            EC H+ C  C   +L  ++  E   + +SC    C    D   +   V+  R R + + L TN   +       C ++  T   ++   EP +     C CG + C  CG+  H P  C   +K       +K  +  +E    +  N   CP+C   + K  GC+HM C   NC  +FCW+C  + +   H    + C    ED+  T           ++R  L  Y+   ++ +N+ +  +   KL+  +          EM   N+  +E QF           +  L+ T   +V AY L K  Q  +    Q  L+S+  +LS Y
Sbjct:  149 ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHVFCFACGENWHDPVKCRWLKK------WIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP--HGSSWYNCNRYDEDEAKT-----ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKME-----EMQQHNMSWIEVQFLKKAVDILCQCRQTLMYT---YVFAYYLKKNNQSMIFEDNQKDLESATEMLSEY 455          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Match: rnf217 (ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-060503-400])

HSP 1 Score: 79.337 bits (194), Expect = 8.052e-15
Identity = 52/188 (27.66%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHK-RLEYKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            ++ L+ C   +CEECL  ++I ++  G   L CP  +C    +   ++  ++ +   K    LE + +      C +C   T ++    +   K   +YK  C K   + C  C    H    C +YRK D   K+L+      ER Q    N   CP+C   + +  GCDHM+C  C  +FC+ CG+
Sbjct:  272 IMPLHCCKKAVCEECLKRYIISQVHVGRAHLVCPITECSGFLEENLVISHLTSEELAKYKYFLELSQLDSSTKPCPQCSLFTSLRGRSQQSSTKSEHKYKIQCTKCQFVWCFKCHSPWHEGLKCRDYRKGD---KLLRHWASVIERGQ---RNAQKCPRCKIHIQRTEGCDHMTCTQCSTNFCYRCGE 453          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Match: rnf217 (ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-060503-400])

HSP 1 Score: 79.337 bits (194), Expect = 8.397e-15
Identity = 52/188 (27.66%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHK-RLEYKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            ++ L+ C   +CEECL  ++I ++  G   L CP  +C    +   ++  ++ +   K    LE + +      C +C   T ++    +   K   +YK  C K   + C  C    H    C +YRK D   K+L+      ER Q    N   CP+C   + +  GCDHM+C  C  +FC+ CG+
Sbjct:  272 IMPLHCCKKAVCEECLKRYIISQVHVGRAHLVCPITECSGFLEENLVISHLTSEELAKYKYFLELSQLDSSTKPCPQCSLFTSLRGRSQQSSTKSEHKYKIQCTKCQFVWCFKCHSPWHEGLKCRDYRKGD---KLLRHWASVIERGQ---RNAQKCPRCKIHIQRTEGCDHMTCTQCSTNFCYRCGE 453          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Match: rnf217 (ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-060503-400])

HSP 1 Score: 78.9518 bits (193), Expect = 1.048e-14
Identity = 52/188 (27.66%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHK-RLEYKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            ++ L+ C   +CEECL  ++I ++  G   L CP  +C    +   ++  ++ +   K    LE + +      C +C   T ++    +   K   +YK  C K   + C  C    H    C +YRK D   K+L+      ER Q    N   CP+C   + +  GCDHM+C  C  +FC+ CG+
Sbjct:  272 IMPLHCCKKAVCEECLKRYIISQVHVGRAHLVCPITECSGFLEENLVISHLTSEELAKYKYFLELSQLDSSTKPCPQCSLFTSLRGRSQQSSTKSEHKYKIQCTKCQFVWCFKCHSPWHEGLKCRDYRKGD---KLLRHWASVIERGQ---RNAQKCPRCKIHIQRTEGCDHMTCTQCSTNFCYRCGE 453          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Match: arih1l (ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 like [Source:NCBI gene;Acc:405859])

HSP 1 Score: 75.8702 bits (185), Expect = 9.218e-14
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  178 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHNCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 351          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Match: arih1l (ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 like [Source:NCBI gene;Acc:405859])

HSP 1 Score: 75.8702 bits (185), Expect = 9.218e-14
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  178 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHNCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 351          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Match: arih1 (ariadne RBR E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100144731])

HSP 1 Score: 74.3294 bits (181), Expect = 4.832e-13
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C S +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   +K       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  174 ECGHKFCMQCWSEYLTTKIIEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLKK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 347          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Match: trit1 (tRNA isopentenyltransferase 1 [Source:Xenbase;Acc:XB-GENE-494505])

HSP 1 Score: 71.2478 bits (173), Expect = 3.364e-12
Identity = 55/192 (28.65%), Postives = 87/192 (45.31%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKE-------IESEEPHKRLEYKCL-CGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            L  L  C   +C+ECL  +L  +++ G   + CP  +C    D + IL S+      K    LE + +      C +C   T  +         +SE    +L+ +C  C  I C  C    H   +C EY+K D+ L+   + EI   +R     N   CP+C   + +  GCDHM+C+ C  +FC+ CG+
Sbjct:  204 LKPLPCCKKPVCDECLKRYLSSQVQLGQAEIRCPITECNKHLDESTILYSLPHDDIIKYKYFLELSRVDSSTKPCPQCKHFTTFRSKTHIPNLTKSE---NKLKIQCPSCQFIWCFKCHAPWHEGVNCREYKKGDKLLRHWAN-EIEHGQR-----NAQKCPRCKVHIQRTEGCDHMTCSQCNTNFCYRCGE 386          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Match: adarb2 (adenosine deaminase, RNA-specific, B2 (inactive) [Source:Xenbase;Acc:XB-GENE-1011921])

HSP 1 Score: 59.6918 bits (143), Expect = 1.569e-8
Identity = 53/195 (27.18%), Postives = 80/195 (41.03%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G  + +SC   +C  +T  D    L      + + R  L    V      Q        M+  I+ +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  149 ENLLSL-ACQHQFCRSCWEQHCTVLVKDGAGVGISCMAQECLLRTPEDFVFPLLPNEELKDKYRRYLFRDYVESHYQLQLCPGADCPMV--IQVQEPKARRVQCNRCSEVFCFRCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 334          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Match: adarb2 (adenosine deaminase, RNA-specific, B2 (inactive) [Source:Xenbase;Acc:XB-GENE-1011921])

HSP 1 Score: 59.6918 bits (143), Expect = 1.622e-8
Identity = 53/195 (27.18%), Postives = 80/195 (41.03%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G  + +SC   +C  +T  D    L      + + R  L    V      Q        M+  I+ +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  123 ENLLSL-ACQHQFCRSCWEQHCTVLVKDGAGVGISCMAQECLLRTPEDFVFPLLPNEELKDKYRRYLFRDYVESHYQLQLCPGADCPMV--IQVQEPKARRVQCNRCSEVFCFRCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 308          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Match: adarb2 (adenosine deaminase, RNA-specific, B2 (inactive) [Source:Xenbase;Acc:XB-GENE-1011921])

HSP 1 Score: 59.3066 bits (142), Expect = 2.115e-8
Identity = 53/195 (27.18%), Postives = 80/195 (41.03%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G  + +SC   +C  +T  D    L      + + R  L    V      Q        M+  I+ +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  147 ENLLSL-ACQHQFCRSCWEQHCTVLVKDGAGVGISCMAQECLLRTPEDFVFPLLPNEELKDKYRRYLFRDYVESHYQLQLCPGADCPMV--IQVQEPKARRVQCNRCSEVFCFRCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 332          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Match: Arih1 (ariadne RBR E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:1344363])

HSP 1 Score: 74.7146 bits (182), Expect = 1.991e-13
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYR-LETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C S +L  + +E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   +K       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  121 ECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLKK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 294          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Match: Arih1 (ariadne RBR E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:1344363])

HSP 1 Score: 75.0998 bits (183), Expect = 2.354e-13
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYR-LETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C S +L  + +E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   +K       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  200 ECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLKK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 373          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Match: Rnf217 (ring finger protein 217 [Source:MGI Symbol;Acc:MGI:3610311])

HSP 1 Score: 66.6254 bits (161), Expect = 8.319e-11
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKE----IESEEPHKRLEYKC-LCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            C   +CEECL  +L  +++ G   + CP  +C    +   ++ +++ +   K    LE   I      C +C   T  K+            R + +C  C  I C  C    H   +C EY+K D+ L+     EI   +R     N   CPKC   + +  GCDHM+C+ C  +FC+ CG+
Sbjct:  251 CKKAVCEECLKIYLSSQVQLGQVEIKCPVTECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESRYKIQCPTCQLIWCFKCHSPWHEGVNCKEYKKGDKLLRHWAS-EIEHGQR-----NAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGE 427          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Match: Arih2 (ariadne RBR E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:1344361])

HSP 1 Score: 59.6918 bits (143), Expect = 1.315e-8
Identity = 54/195 (27.69%), Postives = 79/195 (40.51%), Query Frame = 3
Query: 1620 EDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQC--KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            E+L++L  C H+ C  C   H    ++ G+ + +SC    C  +T  D    L      R + R  L    V      Q        M+  I  +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  148 ENLLSL-ACQHQFCRSCWEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHFQLQLCPGADCPMV--IRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 333          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Match: Rnf14 (ring finger protein 14 [Source:MGI Symbol;Acc:MGI:1929668])

HSP 1 Score: 52.373 bits (124), Expect = 2.424e-6
Identity = 57/210 (27.14%), Postives = 85/210 (40.48%), Query Frame = 3
Query: 1623 DLITLNECNHKICEECLSSHLIYRLETG-MKILSCPGVQC---KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIE-CGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCY-----------EYRKHDQKLK-----------MLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            D +   EC H  C+ CL  +   +++ G +K L+CP  QC    T      ++++  F RY  RL L  T  +      C   C  + +M     +EP   +     C    C LC  T H  S C            EY + D+  K           + K +E   E +  L  N  +CP C   + K+ GC+ M+C  C   FCW+C
Sbjct:  232 DCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARY-DRLLLQSTLDLMADVVYCPRPCCQLPVM-----QEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEM-ESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWIC 434          
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Match: sp|Q9LVW9|ARI4_ARATH (Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana OX=3702 GN=ARI4 PE=5 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.931e-14
Identity = 63/209 (30.14%), Postives = 85/209 (40.67%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETG-MKILSCPGVQCKTEFDCAAILQSVSFKRYRKRL---KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDAN--DEGIHVIDGFPCYTIPEDK 2237
            +T  EC H+ C +C   H   R+  G  K + C   +C T  D A  L S        R      +E N + K       CG    ++ I+ +     +E  C CG   C  C    H P SC  ++   +K       E  +E    +  N   CPKC   + K  GC+HM+C CG  FCWLCG A   D     I G  C    E+K
Sbjct:  132 MTRMECGHRFCNDCWKEHFTVRINEGEGKRIRCMAYKCNTICDEARQLVSTELAEKFDRFLIESYVEDNNMVKWCPSTPHCGNA--IRNIKDDGDVDEVE--CSCGLQFCFSCLSESHSPCSCLMWKLWKKK------CEDESETVNWMTVNTKLCPKCSKPIQKRDGCNHMTCKCGQHFCWLCGQATGRDHSYSSIAGHSCGRYKEEK 330          
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Match: sp|Q9LVX0|ARI3_ARATH (Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana OX=3702 GN=ARI3 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.793e-13
Identity = 63/213 (29.58%), Postives = 93/213 (43.66%), Query Frame = 3
Query: 1623 DLITLNECNHKICEECLSSHLIYRLETG-MKILSCPGVQCKTEFDCAAILQSVS---FKRYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDAN--DEGIHVIDGFPCYTIPEDK 2237
            +++T  EC H+ C +C   H   ++  G  K + C   +CK   D   + + VS     RY + L    +E N + K       CG+   +++IE  + H  +E  C CG   C  C    H P SC  ++   +K       E  +E    +  N   CPKC   + K  GC+ M+C CG  FCWLCG A   D     I G  C    ++K
Sbjct:  132 NVMTRMECGHRFCNDCWIGHFTVKINEGESKRILCMAHECKAICDEDVVRKLVSPELADRYDRFLIESYVEDNNMVKWCPSKPHCGS--AIRKIE--DGHDVVEVGCSCGLQFCFSCLSESHSPCSCLMWKLWKKK------CEDESETVNWITVNTKLCPKCSKPIQKRDGCNLMTCKCGQHFCWLCGQATGRDHTYTSIAGHSCGRYKDEK 334          
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Match: sp|Q6NW85|ARI1L_DANRE (E3 ubiquitin-protein ligase arih1l OS=Danio rerio OX=7955 GN=arih1l PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 6.959e-13
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  178 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHNCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 351          
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Match: sp|Q6PFJ9|ARI1_DANRE (E3 ubiquitin-protein ligase arih1 OS=Danio rerio OX=7955 GN=arih1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.868e-13
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  172 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHSCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 345          
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Match: sp|Q9Z1K5|ARI1_MOUSE (E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 1.647e-12
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYR-LETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C S +L  + +E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   +K       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  200 ECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLKK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 373          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A267DXU8 (RBR-type E3 ubiquitin transferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007798g2 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.852e-18
Identity = 73/267 (27.34%), Postives = 108/267 (40.45%), Query Frame = 3
Query: 1617 FEDLIT-LNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAIL--------QSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLC-GKILCNLCGKTQHWPSSCYEYRKHDQKLK-------MLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDL--------TYITPGSSEIRPKLYIRSLSQRLNNFEDK 2342
            F D  T L EC H+ C  C   H+   +  G   +SCPG +C+T  D A +L         +++   +R  L       +Q++      CG +        E P   +   C C G  LC  CG+  HWPS C    K+  K+K       +L D+   T+       N   CP C   + K  GC+HMSC CG  FCW CG    + +      PC+         F +        +++ P S++ R   Y  ++  RL     K
Sbjct:  641 FADGATMLGECGHRFCNPCWLQHVASSVARGRADVSCPGFRCETPLDPATLLWFCPADLVSALAAAAFRLWLSDRSEQRVQRRLCPLTNCGRVL-------ESPTG-VNAVCQCSGWGLCVGCGQEPHWPSDCATASKYRAKMKSLGHEKLLLSDLNAETD------VNAKQCPSCFLLMEKGVGCNHMSCPCGEHFCWWCG----QTMRDHKSGPCFGAKVKTRSEFRVQRVFTAQDSFLVPNSTQSR--AYCAAVRVRLGRASSK 887          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A1I8ITL8 (RBR-type E3 ubiquitin transferase OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.756e-18
Identity = 73/267 (27.34%), Postives = 108/267 (40.45%), Query Frame = 3
Query: 1617 FEDLIT-LNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAIL--------QSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLC-GKILCNLCGKTQHWPSSCYEYRKHDQKLK-------MLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDL--------TYITPGSSEIRPKLYIRSLSQRLNNFEDK 2342
            F D  T L EC H+ C  C   H+   +  G   +SCPG +C+T  D A +L         +++   +R  L       +Q++      CG +        E P   +   C C G  LC  CG+  HWPS C    K+  K+K       +L D+   T+       N   CP C   + K  GC+HMSC CG  FCW CG    + +      PC+         F +        +++ P S++ R   Y  ++  RL     K
Sbjct:  938 FADGATMLGECGHRFCNPCWLQHVASSVARGRADVSCPGFRCETPLDPATLLWFCPADLVSALAAAAFRLWLSDRSEQRVQRRLCPLTNCGRVL-------ESPTG-VNAVCQCSGWGLCVGCGQEPHWPSDCATASKYRAKMKSLGHEKLLLSDLNAETD------VNAKQCPSCFLLMEKGVGCNHMSCPCGEHFCWWCG----QTMRDHKSGPCFGAKVKTRSEFRVQRVFTAQDSFLVPNSTQSR--AYCAAVRVRLGRASSK 1184          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A1S3KC32 (RBR-type E3 ubiquitin transferase OS=Lingula unguis OX=7574 GN=LOC106180580 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 9.176e-17
Identity = 58/187 (31.02%), Postives = 85/187 (45.45%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKL-------LETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLC 2168
            + ++ C H  C  C   H+  R++ G  IL CP  QC +  D A ++  V  +  R+ L         +E N+   K     +CG + M K   +EE    +   C CG  +C  C K  HWP+ C     + +KL + KD +     +  ++F    CP C   + K  GC HM C CG DFCW C
Sbjct:  581 VAISPCYHWFCRNCWQQHIESRVQQGDMILYCPEYQCSSRLDTATLVSLVDVRTVRRHLMQKHELALSMEENL---KWCPNHKCGRMIMAKGHAAEES---VPVSCKCGTAVCFKCLKASHWPARCDLADDYQRKLTVRKD-DSDPGSKDAVVFV-RRCPHCRLPIEKNGGCPHMICRCGTDFCWGC 759          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A1S3I515 (RBR-type E3 ubiquitin transferase OS=Lingula unguis OX=7574 GN=LOC106161030 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.349e-16
Identity = 57/187 (30.48%), Postives = 86/187 (45.99%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKL-------LETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLC 2168
            + ++ C H  C  C   H+  +++ G  IL CP  QC +  D A ++  V  +  R+ L         +E N+   K     +CG + M K   +EE    +   C CG  +C  C K  HWP+ C     + +KL + KD +  +  +  ++F    CP C   + K  GC HM C CG DFCW C
Sbjct:  581 VAISPCYHWFCRNCWQQHIESKVQQGDMILYCPEYQCSSRLDTATLVSLVDVRTVRRHLMQKHELALSMEENL---KWCPNHKCGRMIMAKGHAAEES---VSVSCKCGTAVCFKCLKASHWPARCDLADDYQRKLTVRKD-DSDSGSKDAVVFVR-RCPHCRLPIEKNGGCPHMICRCGKDFCWGC 759          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A2R2MRH2 (RBR-type E3 ubiquitin transferase OS=Lingula unguis OX=7574 GN=LOC106161030 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.495e-16
Identity = 57/187 (30.48%), Postives = 86/187 (45.99%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKL-------LETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLC 2168
            + ++ C H  C  C   H+  +++ G  IL CP  QC +  D A ++  V  +  R+ L         +E N+   K     +CG + M K   +EE    +   C CG  +C  C K  HWP+ C     + +KL + KD +  +  +  ++F    CP C   + K  GC HM C CG DFCW C
Sbjct:  581 VAISPCYHWFCRNCWQQHIESKVQQGDMILYCPEYQCSSRLDTATLVSLVDVRTVRRHLMQKHELALSMEENL---KWCPNHKCGRMIMAKGHAAEES---VSVSCKCGTAVCFKCLKASHWPARCDLADDYQRKLTVRKD-DSDSGSKDAVVFVR-RCPHCRLPIEKNGGCPHMICRCGKDFCWGC 759          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Match: rnf217 (ring finger protein 217 [Source:NCBI gene;Acc:103021552])

HSP 1 Score: 78.5666 bits (192), Expect = 1.183e-14
Identity = 50/185 (27.03%), Postives = 84/185 (45.41%), Query Frame = 3
Query: 1635 LNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHK-RLEYKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCGD 2174
            L+ C   +CEECL +++  ++  G   + CP  +C    + + ++  ++ +   K    LE + +      C +C   T +K    + P K   +YK  C K   + C  C    H    C EYRK D+ L+    +    +R      N   CP+C   + +  GCDHM+C  C  +FC+ CG+
Sbjct:  288 LHCCQKAVCEECLKTYISSQVLVGRTDIVCPITECSGFLEESVVVTHLASEELAKYKYFLELSRLDSSTKPCPQCSLFTSLKGRSLQAPSKAEHKYKIQCSKCQFVWCFKCHAPWHEGLKCREYRKGDKLLRHWASVIEHGQR------NAQKCPRCKIHIQRTEGCDHMTCTQCNTNFCYRCGE 466          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Match: arih1 (E3 ubiquitin-protein ligase arih1 [Source:NCBI gene;Acc:103031606])

HSP 1 Score: 75.485 bits (184), Expect = 1.089e-13
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  172 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHSCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 345          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Match: arih2 (ariadne RBR E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103035190])

HSP 1 Score: 58.5362 bits (140), Expect = 1.981e-8
Identity = 52/196 (26.53%), Postives = 83/196 (42.35%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCA---------AILQSVSFK-RYRKRL--KLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            C H  C+ C   H    ++ G+ +    G+ C  + DC+          +L S   K +YR+ L    +E++  Q +     +C  +     I+ +EP  R      C ++ C  C +  H P+ C   RK       L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  154 CQHSFCKSCWEQHCTVLVKDGVGV----GISCMAQ-DCSLRMPEDFVLPLLPSEELKEKYRRYLFRDYVESH-FQLQLCPGADCPIV-----IKVQEPRARRVQCSRCAEVFCFKCRQMYHAPTDCATIRK------WLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHG 332          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 50.447 bits (119), Expect = 7.164e-6
Identity = 56/194 (28.87%), Postives = 86/194 (44.33%), Query Frame = 3
Query: 1632 TLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQS------VSFKRYRK----RLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKC-LCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEI--FTERRQPLIFNG--INCPKCMFFVIKITGCDHMSC-NCGADFCWL 2165
            TL EC H  C ECL   ++   +  ++   CP      E+ CA  LQ       +S + Y+K    RL + E+        +  +CG   + ++  +       E+ C  CG+  C LC K  H   +C EY + D +++   D      TE  + L+ NG  + CPKC   V K  GCD + C  C  + CW+
Sbjct:  303 TLRECLHSFCRECLKQTIVNCTDAEVQ---CPYRD--DEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVN-------EFICDSCGEKNCLLC-KAIHKDMNCKEY-QDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWV 482          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 50.447 bits (119), Expect = 8.417e-6
Identity = 57/198 (28.79%), Postives = 87/198 (43.94%), Query Frame = 3
Query: 1632 TLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQS------VSFKRYRK----RLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKC-LCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEI--FTERRQPLIFNG--INCPKCMFFVIKITGCDHMSC-NCGADFCWLCGDA 2177
            TL EC H  C ECL   ++   +  ++   CP      E+ CA  LQ       +S + Y+K    RL + E+        +  +CG   + ++  +       E+ C  CG+  C LC K  H   +C EY + D +++   D      TE  + L+ NG  + CPKC   V K  GCD + C  C  + CW+   A
Sbjct:  333 TLRECLHSFCRECLKQTIVNCTDAEVQ---CPYRD--DEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVN-------EFICDSCGEKNCLLC-KAIHKDMNCKEY-QDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQA 516          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Sea Lamprey
Match: zmp:0000000524 (zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-527])

HSP 1 Score: 56.6102 bits (135), Expect = 1.723e-8
Identity = 53/213 (24.88%), Postives = 89/213 (41.78%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETG-MKILSCPGVQCKTEFDCAAILQSVS---FKRYRKRLKLLETNVIQKKGAQC--IECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSC--------------------------YEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            + L+ C H  C +CLS++   +++ G +  L+CP  +C+T    + + + V    F RY  RL L  +  +      C    C T  ++      EP+K + +   C    CN+C    H  S+C                            Y KH  K + ++++      +  L  N   CP+C   + K+ GC+ M+C +C   FCWLC
Sbjct:  239 VNLSGCEHVYCRDCLSAYFQLQIQEGNVHSLTCPEPKCQTVATPSQVRELVGEELFSRY-DRLLLQSSLDLMADVVYCPRTSCQTPVLL------EPNKTMGHCPQCKFAFCNVCRHAYHGISACIIKSENLENILKKYNNADAASRAFLEQRYGKHTIK-RAIEEV----HSKDWLAQNAKACPRCCTNIQKVDGCNKMTCSSCQLYFCWLC 439          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Yeast
Match: HEL1 (RING finger ubiquitin ligase (E3); involved in ubiquitination and degradation of excess histones; interacts with Ubc4p and Rad53p; null mutant sensitive to hydroxyurea (HU) [Source:SGD;Acc:S000001725])

HSP 1 Score: 53.9138 bits (128), Expect = 8.673e-8
Identity = 49/197 (24.87%), Postives = 83/197 (42.13%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKR---YRKRLKLLETNV---IQK-----KGAQCIECGTITMMKEIESEEPHKRLEY----KCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGI-----NCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            EC H+ C  C   ++  +L  G  I++C         DC+  L++    +   +    KL+++++   +QK     K     +C +I  +++  S   + RL Y    KC      C  CG   H P+ C            +    +   R++  I N +      CPKC   + K  GC+HM C +C  +FCW+C
Sbjct:  194 ECGHEYCINCYRHYIKDKLHEG-NIITC--------MDCSLALKNEDIDKVMGHPSSSKLMDSSIKSFVQKHNRNYKWCPFADCKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHSPADC-----------KITTAWVKKARKESEILNWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWIC 370          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO47093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN86])

HSP 1 Score: 80.1073 bits (196), Expect = 2.852e-15
Identity = 53/187 (28.34%), Postives = 81/187 (43.32%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQ--CIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGI---NCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            +  L  C H  C EC   +L  ++  G   + CPG  C    D   I+ S++   Y K LK      ++   +   C       ++   E           C CG I C  CG   HWP+SC E RK  +     + + +  ER++  + N +   NCP C + + K  GC+ M+C  C  +FCW+C
Sbjct:  558 MTALMSCGHSFCTECWEFYLKSQISRGEGDIGCPGYNCDVTLDNVTIM-SLTPSWYPKFLKRKLNRALEMTSSWRWCPGKNCRQVVNGTELSPNSSAWSVLCKCGGIWCFKCGSQAHWPASCVEARKFYRIAGNYEKL-LINERKE--LINSVMVKNCPSCHYPIEKHLGCNFMTCVMCKTNFCWIC 740          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO37844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN1])

HSP 1 Score: 75.0998 bits (183), Expect = 9.633e-14
Identity = 51/186 (27.42%), Postives = 77/186 (41.40%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSV-----SFKRYRKRLKLLETNVIQKKGAQCIECGTIT--MMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGI---NCPKCMFFVIKITGCDHMSCN-CGADFCWLC 2168
            C+HK C  C   +L  ++ +G   L CPG  C    D   ++  V      F R +  +KL      Q    QC +C      ++    +      +   C CG   C+ C    HWP+SC +  +       LK  +  +E ++  +F  +    CP C + + K  GC HM C  C A FCW C
Sbjct:  549 CSHKFCNSCWHQYLTVQIRSGHSPLKCPGHMCDAIIDDTTVMSLVPELLEQFIRNKVNMKLCSGQQWQ----QCEKCAFYVKLVLPTCIANSTEVPVHVVCRCGNTWCSRCKDEPHWPASCSQAERF-----WLKYADQLSEYQRKDLFYSVYIKRCPHCRYPIEKNGGCPHMYCILCKATFCWHC 725          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO36616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI45])

HSP 1 Score: 66.2402 bits (160), Expect = 3.287e-11
Identity = 49/181 (27.07%), Postives = 73/181 (40.33%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL--ETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN---CGADFCWLC 2168
            EC  + C+ C   +L  ++  E   + +SCP  +C    D A + Q ++  + + +   L  N           C        I++   H  L   CLCG   C  C +  H P  C   +K       +K     +E    +  N   CPKC   + K  GC+HM C    C ADFCW+C
Sbjct:  155 ECGDRFCQRCWKEYLTTKIIDEHVGENISCPATKCDILVDEAFVGQIIADPKVKSQYHHLIANSFVVSNRLMKWCPGPDCDNAIKANY-HDALPVTCLCGFTFCFGCSEPVHEPVKCVWLKK------WIKKTNDDSETSNWISANTKECPKCHVTIEKNGGCNHMVCRNTACKADFCWVC 328          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO48096 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK36])

HSP 1 Score: 64.6994 bits (156), Expect = 1.000e-10
Identity = 50/182 (27.47%), Postives = 75/182 (41.21%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLET------NVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            C H  C+ C S+H   +L+ G+      G++C    +C  ++         K  KL E       N   K  ++   C  I     + +EEP  +      C  + C  CG+  H P+ C   R      K L   E  +E    +  N  +CP+C   + K  GC+HM C  C  DFCW+C
Sbjct:  137 CGHFFCDSCWSAHFASQLQIGVS----SGIEC---MNCNLLVGETVVLNVLKGGKLREKFINFLFNDQIKTFSKLRWCPGINCGFLVRAEEPAAKRVICSKCNTMFCFSCGEKYHAPTDCATIR------KWLTKCEDDSETANYITANTKDCPECGSCIEKNGGCNHMQCIKCKHDFCWMC 305          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO31527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP1])

HSP 1 Score: 54.299 bits (129), Expect = 8.116e-8
Identity = 45/195 (23.08%), Postives = 78/195 (40.00%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHK---------------RLEYKCLCGK---ILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLCG 2171
            C  K C+ECL  H+  ++  G+  + CP   C        I +    + ++K +K             C  C  +   + ++ ++                    + K +C +   + C  C    H+  SC ++ K D  L+      I+   R  L  N   CPKC  ++ +I+GCD M+C+ C   FC+ CG
Sbjct:   26 CGGKTCKECLRYHIEEKVTQGIVQIICPFENCDGVLSETVIKEISDEEIWKKYVKFKVDRDPNSSVKTCPNCAMVFRKQPLKEQDQQNVCATKSKKKEKKEQISKDCKIVCEECKFVWCFDCHAPWHYGISCEKFCKGDTSLR------IWARNRGALTRNATQCPKCRVYIQRISGCDSMACSRCQTQFCYRCG 214          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Match: arih1 (ariadne RBR E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101164054])

HSP 1 Score: 75.8702 bits (185), Expect = 8.048e-14
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1641 ECNHKICEECLSSHLIYRL-ETGM-KILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC---NCGADFCWLC 2168
            EC HK C +C   +L  ++ E GM + +SCP   C    D   +++ ++  + + + + L TN   +       C        ++ + P  +   +C CG+  C  CG+  H P  C   RK       +K  +  +E    +  N   CPKC   + K  GC+HM C   NC A+FCW+C
Sbjct:  172 ECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHSCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAK-PVRCKCGRQFCFNCGENWHDPVKCKWLRK------WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC 345          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Match: rnf217 (ring finger protein 217 [Source:NCBI gene;Acc:101169898])

HSP 1 Score: 73.9442 bits (180), Expect = 4.078e-13
Identity = 45/185 (24.32%), Postives = 81/185 (43.78%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCL-CGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLCGD 2174
            + +L  C   +C+ CL  ++  ++  G  ++SCP  +C    +   +L  ++ +   K    LE + +      C +C   T +K         + + +C  C  + C  C    H    C +YRK D+ L+    +    +R      N   CP+C   + +  GCDHM+C  C  +FC+ CG+
Sbjct:  291 IASLPCCGKAVCDACLKLYVSSQVRLGKHLISCPIPECSGTLEEKLVLSHLTTEDVAKYQYFLELSQLDSSTKPCPQCSKFTSLKTHNPNRSESKFKIQCSNCQFVWCFKCHAPWHDGIKCRDYRKGDKLLRSWASVIEHGQR------NAQKCPRCKIHIQRTEGCDHMTCAQCNTNFCYRCGE 469          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Match: arih2 (ariadne RBR E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101159099])

HSP 1 Score: 60.077 bits (144), Expect = 7.491e-9
Identity = 57/199 (28.64%), Postives = 83/199 (41.71%), Query Frame = 3
Query: 1626 LITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQCKTEFD---CAAILQSVSFK-RYRKRL--KLLETNVIQK--KGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN-CGADFCWLC-GDANDEG 2189
            L+TL  C H  C  C   H    ++ G  + +SC    C           +LQ    K +YR+ L    +E++   +   GA C     I     I+ +EP  R      CG++ C  C +  H P+ C   R      K L      +E    +  +  +CPKC   + K  GC+HM C+ C  DFCW+C GD    G
Sbjct:  153 LLTL-PCQHYFCTACWEQHCTVLVKDGTGVGISCMAQDCPLRMPEDFVLPLLQGEELKDKYRRYLFRDYIESHFRLQLCPGADC----PIV----IKVQEPRARRVQCSRCGEVFCFKCRQMYHAPTDCATIR------KWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKSHG 336          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Match: zmp:0000000524 (ring finger protein 14 [Source:NCBI gene;Acc:101167638])

HSP 1 Score: 55.0694 bits (131), Expect = 2.876e-7
Identity = 55/208 (26.44%), Postives = 80/208 (38.46%), Query Frame = 3
Query: 1629 ITLNECNHKICEECLSSHLIYRLETG-MKILSCPGVQC---KTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIE--CGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCY----EYRK-HDQKLKMLKDIEIFTERR----------------QPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            +   EC H  C  C++ +   ++  G ++ L+CP  +C    T      ++    F RY  RL L  T  +      C    CGT  M+      EP   +     C    C +C    H  S C     E R   D+ L    + + F E+R                  L  N   CPKC   + K+ GC+ M+C +C   FCWLC
Sbjct:  237 LCFKECQHVYCNACMTEYFQIQIRDGNVQCLNCPEPKCTSLATPLQVKQLVDEELFARY-DRLLLQSTLDLMADVVYCPRQFCGTAVMV------EPDTTMGICSACQHAFCTMCKLAYHGVSHCKFPAEELRNLRDEYLSATSEGKKFMEKRFGKRVIQKAVEESFSRDWLTENCKCCPKCGTNIQKVDGCNKMTCTSCKQYFCWLC 437          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Match: ankib1a (ankyrin repeat and IBR domain-containing protein 1-like [Source:NCBI gene;Acc:101160672])

HSP 1 Score: 52.373 bits (124), Expect = 2.451e-6
Identity = 51/206 (24.76%), Postives = 81/206 (39.32%), Query Frame = 3
Query: 1617 FEDLITLNECNHKICEECLSSHLIYRLETGMKI-LSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGA-------QCIECGTITMMKEIESEEPHK-----RLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEI--FTERRQP------LIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLC 2168
            FED + ++ C H+ C  C    L  R++ G    + CP  +C        I   VS +  ++ L+      ++   A       +C     ++     +S+ PH           C  G + C  C    H P  C  +R   QK+  +K  E+   +E  +       L+ N   C  C   + K  GC+HM C  C  DFCW+C
Sbjct:  327 FEDPVDMS-CGHEFCRSCWEGFLNVRIQEGAAHNIFCPAYECYQLVPVHVIESVVSREMDQRYLQFDIKAFVENNSAIRWCPVPRCERAVRLSRPGPGDSD-PHSFPLLPSPAVDCGKGHLFCWECLGEAHEPCDCQTWRNWLQKVTEMKPEELAGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWIC 530          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000062644.1 (SMESG000062644.1)

HSP 1 Score: 1554.27 bits (4023), Expect = 0.000e+0
Identity = 868/882 (98.41%), Postives = 872/882 (98.87%), Query Frame = 3
Query:   78 MSVERGGKTFRKIADHSHQNPLLTVQAKSLKRQYVDLFDKRYWTSVSYSMKKKNRWMLSTLLTKDFYSLDEVIIYKERQSLFSDVPYITGYLFDSLTGKEFGSQINTDRKLINVFINEDSIIHSIENEHNHTAREITRFEXXXXXXXXXXXXXXQHRLVQSYIPRPEESLPPTKEYLSDVENRKDCIYINTNVHINDFSKVNSFKTIHKKRRQISEKYKRNSKKIKSSLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--LHKDEFTLSTQPITLSKSDXXXXXXXXXXXXXXXXXXXXXXXXXXTLKKELFEKSNENDEKMEFFVDFKRDILPFISIHLPYHVFVDDLETILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLKILFNMFNLNYGKLLDKFFPNVREVLKALQETDKLEEEKISINSKVMILEKPFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHXXXXXXXXXXXXXXXXFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKLYIRSLSQRLNNFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVKAYQLDKRKQFSLQNYLKSSACILSFYQNQIKETLETISYLVKQSLKNHCHRKHQIKENLEKLNSSMIGVGQFINRLHLIL 2717
            MSVERGGKTFRKIADHSHQNPLLTVQAKSLKRQYVDLFDKRYWTSVSYSMKKKNRWMLSTLLTKDFYSLDEVIIYKERQSLFSDVPYITGYLFDSLTGKEFGSQINTDRKLINVFINEDSIIHSIENEHNHTAREITRFEKSKYKQKKSKKSRKQHRLVQSYIPRPEESLPPTKEYLSDVENRKDCIYINTNVHINDFSKVNSFKTIHKKRRQISEKYKR SKKIKSSLNFDFFDDMDDSNGNESENENENENE   + +  LHKDEFTLSTQPITLS+SDFLLKNLKQKKKKKISKKSFYFNNFNKTLKKELFEKSNENDEKMEFFVD KRDILPFISIHLPYHVFVDDLE ILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLKILFNMFNLNYGKLLDKFFPNVREVLKALQETDKLEEEKISINSKVMI+EKPFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHETEIIETCEICYTEVCFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKLYIRSLSQRLNNFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVKAYQLDKRKQFSLQNYLKSSACILSFYQ QIKETLETISYLVKQSLKNHCHRKHQIKENLEKLNSSMIGVGQFINRLHLIL
Sbjct:    1 MSVERGGKTFRKIADHSHQNPLLTVQAKSLKRQYVDLFDKRYWTSVSYSMKKKNRWMLSTLLTKDFYSLDEVIIYKERQSLFSDVPYITGYLFDSLTGKEFGSQINTDRKLINVFINEDSIIHSIENEHNHTAREITRFEKSKYKQKKSKKSRKQHRLVQSYIPRPEESLPPTKEYLSDVENRKDCIYINTNVHINDFSKVNSFKTIHKKRRQISEKYKRKSKKIKSSLNFDFFDDMDDSNGNESENENENENENEINTSENLHKDEFTLSTQPITLSQSDFLLKNLKQKKKKKISKKSFYFNNFNKTLKKELFEKSNENDEKMEFFVDLKRDILPFISIHLPYHVFVDDLEAILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLKILFNMFNLNYGKLLDKFFPNVREVLKALQETDKLEEEKISINSKVMIVEKPFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHETEIIETCEICYTEVCFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKLYIRSLSQRLNNFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVKAYQLDKRKQFSLQNYLKSSACILSFYQIQIKETLETISYLVKQSLKNHCHRKHQIKENLEKLNSSMIGVGQFINRLHLIL 882          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000054560.1 (SMESG000054560.1)

HSP 1 Score: 199.134 bits (505), Expect = 9.752e-53
Identity = 151/564 (26.77%), Postives = 267/564 (47.34%), Query Frame = 3
Query: 1059 FKRDILPFISIHLPYHVFVDDLETILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLKILFNMFNLNYGKLLDKFFPNVREVLKALQET-DKLEE-EKISINSKVMILEKPFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHXXXXXXXXXXXXXXXXFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKG-AQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGS----SEIRPKLYIRSLSQRL----NNFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVKAYQLDKRKQFSLQNYLKSSACILSFYQNQIKETLETISYLVKQSLKNHCHRKHQIKENLEKLNSSMIGVGQFINRLHLIL 2717
            F  + LP I I L   +F+++L+TI   C+ W S T     LI +  +     ++Y+V+KP        I+  ++FN+FN ++ +++ K F +V E++  +Q T D++E  E+      ++ L  P + L+  W+ K I   K  F ++DEW+K      +I   L  +  +  + I  CEIC      E++  L  C HKIC +C ++HL   L++      CP + C +  DC ++L  + F+ Y+K ++ LE  VI  +G +QC  C ++ +  ++  E   K   Y C CG I+C  CG  QHWP+SC +  +H  +L  L D +   +  +P+   G  C  C  F ++     ++ C+CG  FC+ CG  +         F      ++  + F +  +  GS       R KLY  S + R     +N    +R+L   I+  F N    E   F+  ++  Q++ +L V E IFV  YQ +++     Q  LK +   L  + N+ +  ++ +  +  +  K+       +K+  EK++  M      + + H  +
Sbjct:  320 FASNKLPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFLIDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFVSVVELVTFVQSTIDQVENFERADKAENILSLSNPMEDLSNTWNIKTIITTKPLFCFNDEWKKLELHQSEIN--LQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYICKCGIIICGFCGNRQHWPASCDDMVQHGNQLVKLND-KYNIQLPKPVKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKD-----CTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLM-QIDHQFKNA---EDLHFDRDKVISQYQQILKVIELIFVFQYQSNEKSSTKSQ-ILKKALQNLMLFVNEFRAIIDQLHLIAHKKRKSQISSLEMLKKR-EKVDVCMNNAMDIVKKCHTFI 869          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000071009.1 (SMESG000071009.1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.617e-7
Identity = 59/203 (29.06%), Postives = 81/203 (39.90%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLE---TGMKILSCPGVQCKTEFDCAAILQSVSFKRYRK-RLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCL-CGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLCGDANDEGIHVIDGFPCYTIPED 2234
            C H+ C EC   +   +LE   T   ++ C G  CK       IL+ +S  + R   LK    NVI+      +   T +  K I   E  K    KC  C    C  CG   H P+SC   R   Q L   +D     E    +     +CP C   + K  GC+HM C  C  +FCW+C    D   H  + + C    E+
Sbjct:  174 CGHQYCRECWYHYFSIQLEQKSTSNGLIECMGNHCKLLVLEDMILEVLSGSKLRDVYLKYQFNNVIESHTL--LRFCTNSDCKIIVYAENPKAKRVKCSKCHSEYCFKCGLAYHAPTSC---RTIKQWLLKCRDD---WETANYITAYTKDCPACGVCIEKNGGCNHMMCFKCKFNFCWMC--LQDWKTHQAEYYECSRYKEN 366          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000071009.1 (SMESG000071009.1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.302e-7
Identity = 59/203 (29.06%), Postives = 81/203 (39.90%), Query Frame = 3
Query: 1644 CNHKICEECLSSHLIYRLE---TGMKILSCPGVQCKTEFDCAAILQSVSFKRYRK-RLKLLETNVIQKKGAQCIECGTITMMKEIESEEPHKRLEYKCL-CGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSC-NCGADFCWLCGDANDEGIHVIDGFPCYTIPED 2234
            C H+ C EC   +   +LE   T   ++ C G  CK       IL+ +S  + R   LK    NVI+      +   T +  K I   E  K    KC  C    C  CG   H P+SC   R   Q L   +D     E    +     +CP C   + K  GC+HM C  C  +FCW+C    D   H  + + C    E+
Sbjct:  168 CGHQYCRECWYHYFSIQLEQKSTSNGLIECMGNHCKLLVLEDMILEVLSGSKLRDVYLKYQFNNVIESHTL--LRFCTNSDCKIIVYAENPKAKRVKCSKCHSEYCFKCGLAYHAPTSC---RTIKQWLLKCRDD---WETANYITAYTKDCPACGVCIEKNGGCNHMMCFKCKFNFCWMC--LQDWKTHQAEYYECSRYKEN 360          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000072176.1 (SMESG000072176.1)

HSP 1 Score: 52.7582 bits (125), Expect = 9.079e-7
Identity = 50/190 (26.32%), Postives = 73/190 (38.42%), Query Frame = 3
Query: 1644 CNHKICEECLSSHL---IYRLETGMKILSCPGVQCKTEFDCAAILQSV-SFKRYRKRLKLLETNVIQK-----KGAQCIECGTITMMKEIESEEPHKRLEYKCL-CGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCN---CGADFCWLCGD 2174
            C H  C  C   +L   I     G +IL CP  QC    D + +   +      ++R ++   N              +EC  I     +   EP   +   C  C  + C  CG++ H P  C    K       LK +   +E    ++ N   CPKC   + K  GC+HM C    C  +FCW+C D
Sbjct:  135 CGHIFCLGCWVRYLNQKIVNENQGDQIL-CPAHQCDIIIDDSMVYNLIRDHPDIKQRFQITVANSFVNCNPLLTWCPGVECNHIV---RVARREP---IRIDCSSCSSVFCFACGESWHDPVQCSFLEK------WLKKMRDDSETSNWIMANTKECPKCRATIEKNGGCNHMVCKNVACKYEFCWVCLD 311          
The following BLAST results are available for this feature:
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARIH13.789e-1328.18ariadne RBR E3 ubiquitin protein ligase 1 [Source:... [more]
RNF2178.032e-1128.42ring finger protein 217 [Source:HGNC Symbol;Acc:HG... [more]
RNF2172.641e-1028.42ring finger protein 217 [Source:HGNC Symbol;Acc:HG... [more]
ARIH21.162e-827.69ariadne RBR E3 ubiquitin protein ligase 2 [Source:... [more]
ARIH21.162e-827.69ariadne RBR E3 ubiquitin protein ligase 2 [Source:... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ari-1.48.549e-1129.63RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
ari-1.48.549e-1129.63RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
ari-1.41.715e-1029.63RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
ari-1.34.284e-1027.03RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
ari-1.11.711e-928.49RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ari-18.148e-1224.17gene:FBgn0017418 transcript:FBtr0089508[more]
ari-18.148e-1224.17gene:FBgn0017418 transcript:FBtr0332850[more]
ari-18.148e-1224.17gene:FBgn0017418 transcript:FBtr0332851[more]
ari-18.148e-1224.17gene:FBgn0017418 transcript:FBtr0089506[more]
ari-18.148e-1224.17gene:FBgn0017418 transcript:FBtr0306057[more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf2178.052e-1527.66ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf2178.397e-1527.66ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf2171.048e-1427.66ring finger protein 217 [Source:ZFIN;Acc:ZDB-GENE-... [more]
arih1l9.218e-1428.18ariadne homolog, ubiquitin-conjugating enzyme E2 b... [more]
arih1l9.218e-1428.18ariadne homolog, ubiquitin-conjugating enzyme E2 b... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arih14.832e-1328.18ariadne RBR E3 ubiquitin protein ligase 1 [Source:... [more]
trit13.364e-1228.65tRNA isopentenyltransferase 1 [Source:Xenbase;Acc:... [more]
adarb21.569e-827.18adenosine deaminase, RNA-specific, B2 (inactive) [... [more]
adarb21.622e-827.18adenosine deaminase, RNA-specific, B2 (inactive) [... [more]
adarb22.115e-827.18adenosine deaminase, RNA-specific, B2 (inactive) [... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arih11.991e-1328.18ariadne RBR E3 ubiquitin protein ligase 1 [Source:... [more]
Arih12.354e-1328.18ariadne RBR E3 ubiquitin protein ligase 1 [Source:... [more]
Rnf2178.319e-1127.87ring finger protein 217 [Source:MGI Symbol;Acc:MGI... [more]
Arih21.315e-827.69ariadne RBR E3 ubiquitin protein ligase 2 [Source:... [more]
Rnf142.424e-627.14ring finger protein 14 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9LVW9|ARI4_ARATH1.931e-1430.14Putative E3 ubiquitin-protein ligase ARI4 OS=Arabi... [more]
sp|Q9LVX0|ARI3_ARATH3.793e-1329.58Probable E3 ubiquitin-protein ligase ARI3 OS=Arabi... [more]
sp|Q6NW85|ARI1L_DANRE6.959e-1328.18E3 ubiquitin-protein ligase arih1l OS=Danio rerio ... [more]
sp|Q6PFJ9|ARI1_DANRE9.868e-1328.18E3 ubiquitin-protein ligase arih1 OS=Danio rerio O... [more]
sp|Q9Z1K5|ARI1_MOUSE1.647e-1228.18E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus ... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DXU81.852e-1827.34RBR-type E3 ubiquitin transferase OS=Macrostomum l... [more]
A0A1I8ITL82.756e-1827.34RBR-type E3 ubiquitin transferase OS=Macrostomum l... [more]
A0A1S3KC329.176e-1731.02RBR-type E3 ubiquitin transferase OS=Lingula ungui... [more]
A0A1S3I5151.349e-1630.48RBR-type E3 ubiquitin transferase OS=Lingula ungui... [more]
A0A2R2MRH21.495e-1630.48RBR-type E3 ubiquitin transferase OS=Lingula ungui... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf2171.183e-1427.03ring finger protein 217 [Source:NCBI gene;Acc:1030... [more]
arih11.089e-1328.18E3 ubiquitin-protein ligase arih1 [Source:NCBI gen... [more]
arih21.981e-826.53ariadne RBR E3 ubiquitin protein ligase 2 [Source:... [more]
rbck17.164e-628.87RANBP2-type and C3HC4-type zinc finger containing ... [more]
rbck18.417e-628.79RANBP2-type and C3HC4-type zinc finger containing ... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zmp:00000005241.723e-824.88zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-52... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEL18.673e-824.87RING finger ubiquitin ligase (E3); involved in ubi... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470932.852e-1528.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378449.633e-1427.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366163.287e-1127.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480961.000e-1027.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315278.116e-823.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arih18.048e-1428.18ariadne RBR E3 ubiquitin protein ligase 1 [Source:... [more]
rnf2174.078e-1324.32ring finger protein 217 [Source:NCBI gene;Acc:1011... [more]
arih27.491e-928.64ariadne RBR E3 ubiquitin protein ligase 2 [Source:... [more]
zmp:00000005242.876e-726.44ring finger protein 14 [Source:NCBI gene;Acc:10116... [more]
ankib1a2.451e-624.76ankyrin repeat and IBR domain-containing protein 1... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062644.10.000e+098.41SMESG000062644.1[more]
SMESG000054560.19.752e-5326.77SMESG000054560.1[more]
SMESG000071009.14.617e-729.06SMESG000071009.1[more]
SMESG000071009.15.302e-729.06SMESG000071009.1[more]
SMESG000072176.19.079e-726.32SMESG000072176.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010468 ID=SMED30010468|Name=RBR-type E3 ubiquitin transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2744bp
ATTTTGTGCAATTAATATTCAATATAAAACCTGACATAGTTATTTAATTA
ATTTTAAGTTTTATTCAATTTAATAAAATGTCAGTAGAAAGAGGTGGTAA
AACGTTTCGAAAAATTGCAGATCATTCTCATCAAAATCCATTGTTGACAG
TACAAGCGAAAAGTTTGAAGCGTCAATATGTAGATTTATTTGACAAAAGA
TACTGGACCAGTGTTTCGTATTCGATGAAAAAGAAAAATCGCTGGATGTT
ATCGACATTATTAACTAAAGATTTCTACAGTCTTGATGAGGTAATTATAT
ATAAAGAACGCCAATCGTTATTCTCAGACGTTCCATACATAACCGGGTAT
TTATTTGACTCTTTGACTGGAAAAGAATTCGGTTCCCAAATTAATACAGA
TCGAAAATTAATAAACGTTTTTATCAATGAAGATAGCATAATTCATTCTA
TCGAAAACGAGCACAATCACACTGCACGGGAAATAACCAGATTTGAAAAA
TCAAAATATAAACAAAAAAAATCGAAAAAATCAAGAAAACAACATCGACT
AGTTCAATCATATATTCCACGACCCGAGGAATCGTTACCTCCTACGAAAG
AGTATTTGTCTGATGTAGAGAATAGAAAGGATTGTATTTATATCAACACA
AATGTTCACATAAATGATTTTTCAAAAGTTAACTCATTCAAAACAATTCA
CAAAAAACGAAGACAAATCTCAGAAAAATATAAAAGAAATTCGAAAAAAA
TCAAAAGTTCCTTAAATTTTGATTTTTTTGACGACATGGATGATAGTAAT
GGTAATGAAAGTGAAAATGAAAATGAAAATGAAAACGAAATAAATACCTC
CGAAAACCTACACAAAGACGAATTTACACTATCGACTCAGCCAATAACAT
TATCCAAAAGTGACTTTCTTCTTAAAAATCTCAAACAAAAAAAAAAGAAA
AAAATTTCCAAAAAAAGTTTTTATTTCAATAATTTTAACAAAACATTGAA
AAAAGAATTATTCGAGAAATCAAATGAAAATGATGAAAAAATGGAATTTT
TTGTTGATTTTAAAAGAGACATTCTTCCGTTTATCAGTATACATTTGCCT
TATCATGTTTTTGTCGATGATTTAGAAACGATATTGAATATTTGCAATTG
CTGGTTCAGTAACACTTTTCCGGTGTCGATTTTAATTGGTCTATCCAATG
TTTTAGCGACATCCACAGAAAGCTATCTCGTATTGAAACCGACATTTTCT
GAAGACTCAGAGAATATATCGTTGAAAATTTTATTCAACATGTTTAACCT
TAATTATGGTAAATTATTGGATAAATTTTTCCCAAATGTTCGAGAGGTTC
TCAAAGCATTACAAGAAACGGACAAACTGGAAGAGGAAAAAATTTCTATC
AATTCAAAAGTGATGATTTTAGAGAAGCCTTTCGATGGATTAAATGGGAT
TTGGAGTACAAAACCAATTGAAAATGAAAAAGATTTTTTTAAATATCACG
ATGAATGGAGAAAAAATGTGTTTTCCTCTAAGGATATTGAAACAGTATTG
AATAAAATTTTCAAACACGAAACTGAAATAATAGAGACCTGTGAAATTTG
TTATACTGAAGTCTGTTTTGAAGATTTAATTACATTAAATGAATGCAATC
ACAAAATTTGTGAAGAATGTTTATCTAGTCATTTGATATATAGACTGGAA
ACCGGGATGAAAATTTTAAGTTGCCCTGGAGTCCAGTGCAAAACAGAATT
TGATTGTGCTGCTATCTTACAATCGGTCTCCTTTAAACGATATCGCAAAA
GGTTGAAATTATTAGAAACTAATGTTATCCAGAAAAAGGGAGCCCAATGT
ATTGAGTGTGGAACGATAACAATGATGAAGGAAATAGAATCAGAAGAACC
TCATAAAAGACTTGAATACAAATGCCTTTGTGGAAAAATACTATGCAATC
TTTGTGGAAAAACTCAACACTGGCCCAGTTCTTGTTATGAGTATAGAAAA
CACGATCAAAAGCTTAAGATGCTTAAAGATATTGAAATCTTTACCGAAAG
ACGTCAACCGTTAATTTTTAATGGAATTAACTGTCCGAAATGTATGTTTT
TCGTAATCAAAATTACTGGATGTGATCACATGTCATGCAATTGCGGTGCT
GATTTCTGTTGGTTATGCGGTGATGCAAATGACGAAGGTATACATGTGAT
AGATGGATTTCCGTGCTACACAATTCCAGAAGATAAGCATTTGACTTTTG
ATTTGACATATATTACTCCGGGATCAAGTGAAATCAGACCAAAATTGTAT
ATTCGCAGTTTATCTCAGCGGTTAAACAATTTTGAAGACAAACGTCGAAA
ATTGTTTTATCATATCAATCTCATGTTCGGAAATAAATGGAAATTTGAAA
TGCCCGATTTCAACGTGAAACAGCTAGAAGACCAATTTAAAAATTTGTTA
ATTGTTACGGAAAATATTTTCGTTAAAGCATATCAGTTGGACAAAAGAAA
ACAATTTTCTTTGCAGAATTATTTGAAGTCGTCAGCGTGCATATTAAGTT
TTTATCAAAACCAAATCAAGGAGACCCTGGAAACCATTTCGTATTTAGTA
AAACAATCTCTGAAAAACCATTGCCACAGAAAACACCAAATAAAAGAAAA
CCTAGAAAAACTGAATTCATCCATGATTGGAGTGGGGCAATTTATCAATC
GTTTGCATTTAATATTATAAAGAATATTTTTACAAAATATAATT
back to top

protein sequence of SMED30010468-orf-1

>SMED30010468-orf-1 ID=SMED30010468-orf-1|Name=SMED30010468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=881bp
MSVERGGKTFRKIADHSHQNPLLTVQAKSLKRQYVDLFDKRYWTSVSYSM
KKKNRWMLSTLLTKDFYSLDEVIIYKERQSLFSDVPYITGYLFDSLTGKE
FGSQINTDRKLINVFINEDSIIHSIENEHNHTAREITRFEKSKYKQKKSK
KSRKQHRLVQSYIPRPEESLPPTKEYLSDVENRKDCIYINTNVHINDFSK
VNSFKTIHKKRRQISEKYKRNSKKIKSSLNFDFFDDMDDSNGNESENENE
NENEINTSENLHKDEFTLSTQPITLSKSDFLLKNLKQKKKKKISKKSFYF
NNFNKTLKKELFEKSNENDEKMEFFVDFKRDILPFISIHLPYHVFVDDLE
TILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLK
ILFNMFNLNYGKLLDKFFPNVREVLKALQETDKLEEEKISINSKVMILEK
PFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHETE
IIETCEICYTEVCFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCP
GVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKGAQCIECGTITMM
KEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLK
DIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDA
NDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGSSEIRPKLYIRSLSQRLN
NFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVK
AYQLDKRKQFSLQNYLKSSACILSFYQNQIKETLETISYLVKQSLKNHCH
RKHQIKENLEKLNSSMIGVGQFINRLHLIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0061630ubiquitin protein ligase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR031127E3_UB_ligase_RBR
IPR002867IBR_dom
IPR017907Znf_RING_CS
IPR001841Znf_RING
IPR013783Ig-like_fold
Vocabulary: biological process
TermDefinition
GO:0050691regulation of defense response to virus by host
GO:0070936protein K48-linked ubiquitination
GO:0006915apoptotic process
GO:0016032viral process
GO:0016567protein ubiquitination
GO:0032480negative regulation of type I interferon production
GO:0032648regulation of interferon-beta production
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002867IBR domainSMARTSM00647ibrneu5coord: 572..638
e-value: 0.019
score: 21.0
coord: 649..715
e-value: 0.24
score: 8.6
IPR002867IBR domainPFAMPF01485IBRcoord: 669..706
e-value: 1.5E-5
score: 25.1
NoneNo IPR availableGENE3DG3DSA:1.20.120.1750coord: 634..871
e-value: 1.4E-6
score: 30.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..165
NoneNo IPR availablePROSITEPS51873TRIADcoord: 503..719
score: 21.34
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 664..703
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 505..577
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 503..584
e-value: 8.7E-12
score: 46.9
IPR031127E3 ubiquitin ligase RBR familyPANTHERPTHR11685RBR FAMILY RING FINGER AND IBR DOMAIN-CONTAININGcoord: 240..745
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 525..534
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 507..552
score: 9.406