Dynamin-binding protein

Overview
NameDynamin-binding protein
Smed IDSMED30010461
Length (bp)1050
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-binding protein (SMED30010461) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-binding protein (SMED30010461) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010461

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010461SMESG000001434.1 dd_Smed_v4_16150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010461SMESG000001434.1 dd_Smed_v4_16150_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010461SMESG000001434.1 dd_Smed_v4_16150_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-binding protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23846200 (tr|V3ZQX0|V3ZQX0_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236732 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 5.973e-19
Identity = 93/346 (26.88%), Postives = 163/346 (47.11%), Query Frame = 1
Query:   16 FKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDV-QAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNY--LKGKVVQSNHDISIANGTCFKFNSRSNSKL------ISETQKNEETNDLSFXXXXXXXXXXXXXFSK-----RPKT-------APIVTTEDYEVSRNLIEESKNY-LLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESC 987
            F+E++ +R  +  YE  D KG+ L+ + LL  IKMCGR+IAPMKL HR+KHM+    E+ R+QL+EFLEL +W D+ + F  +    R T    ++ +  + D EK LS  + D +  ++ N +Y+++EW    G  K   + ++K     T   +R+    + +Y  LK +V  S   +  A     +    +  +L       S+    E +   ++K  +        + SK     RPKT        P + T    +   L ++S N+ +  +  + +E    D++YL PG+  +   +P +       V  +     + E +E +S+   +  K  H+SC
Sbjct:   95 FEEIHSIRLSYETYEAIDMKGMVLNKHILLRAIKMCGRMIAPMKLMHRIKHMRDEFDEKGRIQLYEFLELILWCDLYEKFYCDF---RGTANIKENKLFQLVDFEKVLS--HHDEKIHKDLNSQYLQDEWDF--GQEKLGSKRLFKDPTVHTEDSIRRTTYHKEDYKHLKSEVATSQKQVHQARAGFVRPRPVTAPQLSHYRRKFSQQTMTERSVAETYKIVQRRLRSAPARSSKIVLPERPKTCDYYRKPTPCIVTSTDIIDLYLKKQSLNFDITTVKTRAEENGNDDLDYLLPGYREKRSRQPKQQERVEEPVKEKKPTKNTEEVLENLSQPKLRHYKQHHKSC 433          
BLAST of Dynamin-binding protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20329738 (tr|A0A1S3JKC7|A0A1S3JKC7_LINUN uncharacterized protein LOC106174045 OS=Lingula unguis OX=7574 GN=LOC106174045 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.791e-16
Identity = 81/307 (26.38%), Postives = 139/307 (45.28%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFI-TELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIE----RSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKL-----ISETQKNEETNDLSFXXXXXXXXXXXXXFSK------------------RPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTR 849
            SF+EL  +R  +  YE  D KG+ +D + +L  +KMCGR+IAP+K+  RLKHM     E  RMQL+EFL+L +W D+   +  E  ++       K  +  + D E DL + + D     + N  Y+ EEW       K + +    P+K     + RK++++    +  +LK +VV +   +  A     +    S   L     I  T     +ND+  +        + +  +K                  RP  +  VT +D + + NLI+  +  +  +  +Y+  +  D++YL PG+  R
Sbjct:   97 SFEELQDVRIAYQVYEAGDMKGILVDEHIVLRALKMCGRVIAPLKMMQRLKHMSQNFDENGRMQLYEFLDLILWCDLYKDVQVERPSKVEATGKTKYGLYKLDDFE-DL-LHHQDEVIATHLNQNYLNEEWDFGKEIIKSLKQSREPPVKAT---DKRKQMVKFHKGKYQHLKSEVVNAQKRVYHAKAGYVRPRPISAPDLEMYDRIDPTMVA-PSNDIRPQTVYETLEQMKKARAKKTETDSAERHPLKVDTYVRPHPSMTVTDKDIKDTENLIQSLQFEMETLENRYQHLVDTDLDYLMPGYRER 397          
BLAST of Dynamin-binding protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23908124 (tr|K1QYQ5|K1QYQ5_CRAGI Dynamin-binding protein OS=Crassostrea gigas OX=29159 GN=CGI_10025280 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.413e-15
Identity = 51/130 (39.23%), Postives = 76/130 (58.46%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEW 402
            +F+EL  +R  +  +E+ D KGL +D + LL  IKMCGR IAPMKL HRLKHMK    ++ R+QL E+LEL +W    ++        T  +  ++ +  ++D E+ LS  + D    +  N  Y+KEEW
Sbjct: 1808 TFEELYNIRVAYQAFEQFDMKGLLIDQDILLSSIKMCGRSIAPMKLMHRLKHMKVHFEDKTRIQLSEYLELILW--CGSYKDYTPEDGTAPQGKENELYKLADFEQLLS--HYDARLAKKLNDEYLKEEW 1933          
BLAST of Dynamin-binding protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17236042 (tr|A0A433TX26|A0A433TX26_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006091 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.299e-13
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query:   16 FKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNY--LKGKVVQS 534
            ++ L+ +R  +  YE  D KGL +  + LL  +KMCGR IAP+KL HR+KHMK    E+ R+QL+EF  L +W D+         +    K D  ++  + D E+ LS  + D       N +Y+ EEW    G  +   R ++K     T   + +    + NY  LK +V  S
Sbjct:   59 YEGLHDVRVAYGTYEHVDMKGLLIHKHILLRTLKMCGRSIAPLKLMHRIKHMKGEFEEKGRIQLYEFFNLIVWCDLYTAFDPQDVESPIGKDD--DLFKLVDFEQLLS--HHDARVDARLNAQYLAEEWDF--GMERLGSRDMFKEPPVYTEARISQAKYHKQNYKALKKEVTHS 227          
BLAST of Dynamin-binding protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17692160 (tr|A0A2G8K087|A0A2G8K087_STIJA Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_21766 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.196e-12
Identity = 34/82 (41.46%), Postives = 54/82 (65.85%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFIT 258
            +F EL+ +R  F  YE  D +G+ +D   L+  +K+CGR +AP+KL HR+KHM+ RL E  R+Q +EFL+L +  ++   I+
Sbjct:  100 NFDELSEVRVAFQVYEAGDMRGMMIDQQTLMRTLKLCGRTVAPLKLMHRVKHMERRLDEPGRLQFYEFLDLIVLCELTDVIS 181          
BLAST of Dynamin-binding protein vs. Ensembl Nematostella
Match: EDO49257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY7])

HSP 1 Score: 64.3142 bits (155), Expect = 2.560e-11
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWS--DVQAFITELLNQRTTYKSDKSNICDISDI 324
            SF+EL  +R  F  YE +D  GL +D   L   +K+CGR ++P+KL   +KHM   + +  R+ L+EFL+L +    DV+  +  L       +S    ICD   +
Sbjct:   96 SFEELREVRVAFQLYEHEDMMGLVIDEQILFRTLKVCGRTVSPVKLMQHIKHMVRHVPD--RLMLYEFLDLMLLCERDVEVEVPPLPPVSGFDRSKLYKICDFRKV 199          
BLAST of Dynamin-binding protein vs. Planmine SMEST
Match: SMESG000001434.1 (SMESG000001434.1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 328/329 (99.70%), Postives = 328/329 (99.70%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFXXXXXXXXXXXXXFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM 999
            SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFKNKKLLENLLV KFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM
Sbjct:  105 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFKNKKLLENLLVGKFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM 433          
BLAST of Dynamin-binding protein vs. Planmine SMEST
Match: SMESG000001434.1 (SMESG000001434.1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 328/329 (99.70%), Postives = 328/329 (99.70%), Query Frame = 1
Query:   13 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFXXXXXXXXXXXXXFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM 999
            SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFKNKKLLENLLV KFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM
Sbjct:  107 SFKELNMMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHRLYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEKDLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFELRKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEETNDLSFKNKKLLENLLVGKFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLKMPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREHIERISKSASKSSKTFHESCIELM 435          
The following BLAST results are available for this feature:
BLAST of Dynamin-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238462005.973e-1926.88tr|V3ZQX0|V3ZQX0_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|203297385.791e-1626.38tr|A0A1S3JKC7|A0A1S3JKC7_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|239081241.413e-1539.23tr|K1QYQ5|K1QYQ5_CRAGI Dynamin-binding protein OS=... [more]
gnl|BL_ORD_ID|172360425.299e-1332.57tr|A0A433TX26|A0A433TX26_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|176921601.196e-1241.46tr|A0A2G8K087|A0A2G8K087_STIJA Uncharacterized pro... [more]
back to top
BLAST of Dynamin-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492572.560e-1133.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000001434.10.000e+099.70SMESG000001434.1[more]
SMESG000001434.10.000e+099.70SMESG000001434.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010461 ID=SMED30010461|Name=Dynamin-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1050bp
TTCTTGTCGTAAAGCTTTAAAGAACTAAATATGATGCGATGTGTTTTTCA
CTTTTATGAAGAAGATGACGGCAAGGGTCTTGAATTAGATACAAATAAAT
TATTGCATCATATTAAAATGTGTGGCAGAATCATCGCGCCCATGAAACTG
ACCCATCGGTTGAAGCATATGAAACACAGACTTTATGAACGGTGCAGAAT
GCAACTTTGGGAATTTTTAGAACTCAATATTTGGAGTGATGTGCAAGCAT
TCATTACAGAACTCTTAAATCAACGAACGACTTATAAATCTGACAAGAGT
AATATCTGCGACATTTCTGACATTGAGAAAGATTTATCAATAATATATAC
TGATGTAGAAGCCTGGGAAAATGAGAATGTTCGTTACATCAAAGAAGAAT
GGACCTTACCCGTAGGAAATTTTAAAAAGATTTTAAGGCTGATATATAAA
CCGTTGAAAACCAAAACAAATTTTGAATTGAGAAAGAAACTTATAGAAAG
AAGCAATTATTTGAAAGGGAAAGTTGTTCAGTCTAATCATGATATTTCAA
TTGCAAATGGAACCTGTTTCAAGTTTAACAGTAGAAGCAACTCGAAGCTC
ATTTCGGAAACCCAAAAAAACGAAGAAACGAATGATTTATCTTTTAAGAA
CAAAAAGTTATTAGAAAATTTACTTGTGGAAAAATTTTCGAAAAGACCTA
AAACAGCCCCGATAGTCACTACGGAAGACTATGAAGTTAGCAGGAATTTG
ATTGAAGAATCAAAAAACTATTTATTGAAAATGCCTGAAAAATATAAAGA
AAGAATTCGACTTGATATGGAGTATTTGAAACCAGGATTCTGGACTAGAT
GGGAAAGTCGACCATCTAAGCATTTTTCTCAACTAACTCATGTCAATTTG
GAATTGAAAAGAATACCTTCTAGAGAACATATCGAAAGAATTTCAAAATC
AGCTTCTAAATCTTCAAAAACCTTTCACGAATCTTGTATTGAATTAATGT
AATAGGAATTTAATATTTATTATATCACTTTTTAACTAATACATGATTAC
back to top

protein sequence of SMED30010461-orf-1

>SMED30010461-orf-1 ID=SMED30010461-orf-1|Name=SMED30010461-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MMRCVFHFYEEDDGKGLELDTNKLLHHIKMCGRIIAPMKLTHRLKHMKHR
LYERCRMQLWEFLELNIWSDVQAFITELLNQRTTYKSDKSNICDISDIEK
DLSIIYTDVEAWENENVRYIKEEWTLPVGNFKKILRLIYKPLKTKTNFEL
RKKLIERSNYLKGKVVQSNHDISIANGTCFKFNSRSNSKLISETQKNEET
NDLSFKNKKLLENLLVEKFSKRPKTAPIVTTEDYEVSRNLIEESKNYLLK
MPEKYKERIRLDMEYLKPGFWTRWESRPSKHFSQLTHVNLELKRIPSREH
IERISKSASKSSKTFHESCIELM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0035556intracellular signal transduction
GO:0043547positive regulation of GTPase activity