SMED30010458

Overview
NameSMED30010458
Smed IDSMED30010458
Length (bp)2461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010458 (SMED30010458) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010458 (SMED30010458) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010458 (SMED30010458) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010458 (SMED30010458) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010458SMESG000026243.1 SmedASXL_011708SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30010458SMESG000026243.1 SmedASXL_011708SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010458SMESG000026243.1 dd_Smed_v4_7664_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig45051newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig45051uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig13179newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig13179uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig48863newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010458SMESG000026243.1 Contig48863uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30010458SMESG000026243.1 dd_Smed_v6_7664_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010458SMESG000026243.1 OX_Smed_1.0.10759ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010458 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001629:6887..31998 +9969
Homology
BLAST of SMED30010458 vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 62.3882 bits (150), Expect = 3.419e-9
Identity = 115/509 (22.59%), Postives = 193/509 (37.92%), Query Frame = 2
Query:  659 RSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSF-IQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQII-HSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETN--YHIGDD-----------LPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +S +C+ CEK F  S+ L+ H+ ++     E+  +  + C      +++  +H  I     I K      +FL      R +   T       +   + F   + +  H + H  ++ +K  CE+CG  +SR   L +H     G +              +C  C   F++   L  H++                     T+TE  ++P K  + D   K LS+    T+H I    E                       N +     H F    +K ++CE C K+F+  SSL+ H + H  +R +PF C++C K FI   +L  H+R    +K    E+    +    + +++  I      I++  +P     C   F   L L +H +  HS E+    C  C ++F     L  H     G     C    +       L T+   H G+            L +   R+ KRI+  +K Y C+ C + FS   AL  HKR
Sbjct:  208 KSCKCKECEKTFHWSSTLTNHKEIH----TEDKPYKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYK--CEECGKAFSRSSTLAKHKRIHTGEK------------PYKCKECGKAFSNSSTLANHKI---------------------THTE--EKPYKCKECDKAFKRLST---LTKHKIIHAGEKLYKCEECGK-----------AFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH--TREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEE-CGKAFRQSSTLTKHKI------IHTGEKPYKFEECGKAFRQSLTLNKHKII-HSREK-PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKR 650          

HSP 2 Score: 51.6026 bits (122), Expect = 6.784e-6
Identity = 56/225 (24.89%), Postives = 91/225 (40.44%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            H F    +K ++CE C K+F+  SSL+ H + H  +R +PF C++C K FI   +L  H+R    +K    E+            S+         I++  +P  C  C   F     L +H +  H+ E+    C  C ++F  +  L  H              +     P    E +      + +    + KRI+  +K Y C+ C + FS    L  HKR
Sbjct:  732 HKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIH--TREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEE-------CGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKII-HAGEK-LYKCEECGKAFNQSSNLTTHKI------------IHTKEKPSKSEECDKAF---IWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKR 930          
BLAST of SMED30010458 vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 62.003 bits (149), Expect = 4.852e-9
Identity = 115/509 (22.59%), Postives = 193/509 (37.92%), Query Frame = 2
Query:  659 RSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSF-IQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQII-HSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETN--YHIGDD-----------LPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +S +C+ CEK F  S+ L+ H+ ++     E+  +  + C      +++  +H  I     I K      +FL      R +   T       +   + F   + +  H + H  ++ +K  CE+CG  +SR   L +H     G +              +C  C   F++   L  H++                     T+TE  ++P K  + D   K LS+    T+H I    E                       N +     H F    +K ++CE C K+F+  SSL+ H + H  +R +PF C++C K FI   +L  H+R    +K    E+    +    + +++  I      I++  +P     C   F   L L +H +  HS E+    C  C ++F     L  H     G     C    +       L T+   H G+            L +   R+ KRI+  +K Y C+ C + FS   AL  HKR
Sbjct:  176 KSCKCKECEKTFHWSSTLTNHKEIH----TEDKPYKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYK--CEECGKAFSRSSTLAKHKRIHTGEK------------PYKCKECGKAFSNSSTLANHKI---------------------THTE--EKPYKCKECDKAFKRLST---LTKHKIIHAGEKLYKCEECGK-----------AFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH--TREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEE-CGKAFRQSSTLTKHKI------IHTGEKPYKFEECGKAFRQSLTLNKHKII-HSREK-PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKR 618          

HSP 2 Score: 51.6026 bits (122), Expect = 7.996e-6
Identity = 56/225 (24.89%), Postives = 91/225 (40.44%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            H F    +K ++CE C K+F+  SSL+ H + H  +R +PF C++C K FI   +L  H+R    +K    E+            S+         I++  +P  C  C   F     L +H +  H+ E+    C  C ++F  +  L  H              +     P    E +      + +    + KRI+  +K Y C+ C + FS    L  HKR
Sbjct:  700 HKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIH--TREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEE-------CGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKII-HAGEK-LYKCEECGKAFNQSSNLTTHKI------------IHTKEKPSKSEECDKAF---IWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKR 898          
BLAST of SMED30010458 vs. Ensembl Human
Match: ZNF112 (zinc finger protein 112 [Source:HGNC Symbol;Acc:HGNC:12892])

HSP 1 Score: 55.0694 bits (131), Expect = 5.236e-7
Identity = 55/219 (25.11%), Postives = 85/219 (38.81%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K ++CE C K FS  S L  H + H   +  PF C +C K F    +LQ H+R    +K    E+          G S+         +++  +P  C  C   F  R  L+ H  S HS E+  I C +C + F+    L+ H           C    +      +LE +               +R++   K Y C+ C + FS    L  H+R 
Sbjct:  600 EKPYKCEECGKGFSRSSHLQGHQRVHTGEK--PFKCEECGKGFSWSFNLQIHQRVHTGEKPYKCEE-------CGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQ-SVHSGERPYI-CEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAH---------------RRVHTGGKPYKCEVCTKGFSESSRLQAHQRV 792          
BLAST of SMED30010458 vs. Ensembl Human
Match: ZNF112 (zinc finger protein 112 [Source:HGNC Symbol;Acc:HGNC:12892])

HSP 1 Score: 55.0694 bits (131), Expect = 5.382e-7
Identity = 55/219 (25.11%), Postives = 85/219 (38.81%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K ++CE C K FS  S L  H + H   +  PF C +C K F    +LQ H+R    +K    E+          G S+         +++  +P  C  C   F  R  L+ H  S HS E+  I C +C + F+    L+ H           C    +      +LE +               +R++   K Y C+ C + FS    L  H+R 
Sbjct:  606 EKPYKCEECGKGFSRSSHLQGHQRVHTGEK--PFKCEECGKGFSWSFNLQIHQRVHTGEKPYKCEE-------CGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQ-SVHSGERPYI-CEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAH---------------RRVHTGGKPYKCEVCTKGFSESSRLQAHQRV 798          
BLAST of SMED30010458 vs. Ensembl Human
Match: CTCFL (CCCTC-binding factor like [Source:HGNC Symbol;Acc:HGNC:16234])

HSP 1 Score: 53.5286 bits (127), Expect = 6.188e-7
Identity = 43/161 (26.71%), Postives = 74/161 (45.96%), Query Frame = 2
Query: 1457 FHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHG 1939
            F+ H      +K   C +C K+F + + L NHV +H  +R  P+ C DCN  F+    L  HRR          E+    S+  +  V    +  ++ + ++  +P  C  CS    D  +L+ H +  HS E+    C +C   FT +  +++H+ + HG
Sbjct:   10 FNRHMKTHTSEKPHLCHLCLKTFRTVTLLRNHVNTHTGTR--PYKCNDCNMAFVTSGELVRHRRY-----KHTHEKPFKCSMCKYASVEASKLKRHVRS-HTGERPFQCCQCSYASRDTYKLKRH-MRTHSGEKP-YECHICHTRFTQSGTMKIHILQKHG 160          
BLAST of SMED30010458 vs. Ensembl Fly
Match: D19B (gene:FBgn0022699 transcript:FBtr0077017)

HSP 1 Score: 55.4546 bits (132), Expect = 1.731e-7
Identity = 61/248 (24.60%), Postives = 99/248 (39.92%), Query Frame = 2
Query: 1475 DENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTC--RDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQP---VTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCP--GVSQNLPPMPKLETNYHIGDDLPTKKKRKD------------------KRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            + ++ ++  C +C + F        H+K H      PF C    C K F     L+ H     ++ S  +     Y   N +    V +  ++  ++ V+ P     C  C  VF     L++H + KH+ E+    C +C + F  N  LR HL +  G  N  CP  GV +      + E N HI     TK+K+ +                  K ++E  KD+AC  C + F    A   H+R+
Sbjct:  246 ERDRHRLIDCHICHQKFKKAIRYEEHMKHHNDLL--PFQCTVESCRKGFTTANGLRVHVEHAHTETS--AMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQRDFPCTECEKVFRCPTALKKH-MYKHTGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVCPYCGVGKTT----RQEWNKHILTH--TKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFGKSHACKIHERS 482          
BLAST of SMED30010458 vs. Ensembl Fly
Match: CG8319 (gene:FBgn0037722 transcript:FBtr0082077)

HSP 1 Score: 54.299 bits (129), Expect = 3.071e-7
Identity = 57/230 (24.78%), Postives = 89/230 (38.70%), Query Frame = 2
Query: 1490 KIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVP----IWPNITNINS-------VNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNIL--CLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            + F+CE+C K F  + +L +H+K H +S      C++C +RF+    L +H+                    N N   + P    ++ +  +++S          P  C HC   F     L+ H L    ++QGN    C  C   F    AL+VH+    G     CP    N      L+   HI             RI+  +K Y C +C + FS    L  H+R
Sbjct:  149 QTFKCELCIKQFKRQINLLDHMKVHSNSH----VCQNCEERFLFKADLDNHQ-----------------CYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKV--HI-------------RIHTGEKPYQCPHCPKTFSDNNNLAKHRR 342          
BLAST of SMED30010458 vs. Ensembl Fly
Match: D19A (gene:FBgn0022935 transcript:FBtr0077016)

HSP 1 Score: 50.8322 bits (120), Expect = 4.852e-6
Identity = 61/242 (25.21%), Postives = 91/242 (37.60%), Query Frame = 2
Query: 1490 KIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCR--DCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPI-WPNITNINSVNQPV---TCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCP--GVSQNLPPMPKLETNYHIGDDLPTKKKR----------------KDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +I  C +C + F        H+K  Y +   PF C+   C K F     L+ H     ++ S+            F  V  +      +  I     P+    C  C  VF     L++H + KH+ E+    C +C + F  N ALR HL +  G  N  CP  GV +      + E N HI      KK +                  K ++E  KD+AC  C + F    A   H+R+
Sbjct:  276 RIIDCHICHQKFKKAIRYEEHMK--YHNDLLPFQCKVETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRCPTALKKH-MYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTT----RQEWNAHILTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERS 510          
BLAST of SMED30010458 vs. Ensembl Fly
Match: CG30431 (gene:FBgn0050431 transcript:FBtr0085991)

HSP 1 Score: 50.0618 bits (118), Expect = 6.023e-6
Identity = 60/259 (23.17%), Postives = 104/259 (40.15%), Query Frame = 2
Query: 1187 HQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINS--------VNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHG 1939
            HQ      F  E P   ++++    +     + ++   + DN+K    K+    H                +     +  +  T N   K H        +  +QCE C+K+F+SR SL  HVKS +S+  +PF C+ C++RFI    L  H R      + +++ +I      F        WP  +++ +        + +P  C  CS  F+ R  L  H L  H+ E+    C  CD+ + +   L  H+ + H 
Sbjct:  173 HQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPKERKASGAVHP--------------RSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTE-RPFGCQHCDRRFILRTQLLSHLR----THTGEAKPRI------FECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLV-HTGEKP-FACEYCDKCYQSVGNLNNHMVRLHA 404          
BLAST of SMED30010458 vs. Ensembl Zebrafish
Match: CABZ01066719.1 (zinc finger protein 501-like [Source:NCBI gene;Acc:100536030])

HSP 1 Score: 61.6178 bits (148), Expect = 2.142e-9
Identity = 66/252 (26.19%), Postives = 105/252 (41.67%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNG-VSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR--------ACLNLPNECISSQTPKSNSKLHSIE 2215
            +K ++C  C K FS   SL +H + H   R  P+ C  C+KRF  L SLQ H R    +K         Y+ S+ +   SQ+         ++  +P  C HC   F     L+ H    H+ E+   +C  CD+SF+    L+ H     G     C    Q    +  L+++               +RI+  +K Y C +C + FS   +L  H+R         CL+     I S+  K + ++H+ E
Sbjct:  190 EKPYKCSHCDKRFSLLESLKSHERIHTGER--PYKCSHCDKRFSTLGSLQRHERIHTGEKP--------YTCSHCDQRFSQLENLKTHERTHTGEKPYMCSHCDKGFSTLGSLKTHE-RIHTGER-PYMCSHCDKSFSQLETLKTHKRIHTGEKPYECSHCDQRFRQLASLKSH---------------ERIHTGEKPYTCSHCDKKFSRSGSLKTHERFHTGERPYMCLHCDKRFIDSRNLKKHERIHATE 414          
BLAST of SMED30010458 vs. Ensembl Zebrafish
Match: CU570689.2 (si:ch73-266f23.4 [Source:NCBI gene;Acc:571254])

HSP 1 Score: 61.6178 bits (148), Expect = 2.393e-9
Identity = 63/235 (26.81%), Postives = 93/235 (39.57%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            + N  +K   H      +K F C+ C +  +++  L+ H+K H   +  PFTC  C K F     L+ H R    +K     Q    S +  NG++          I+S  +P TC  C   F     L  H  + HS E+    C  C +SFT + +L+ HL    G     C    +    + K   N H+             RI+  DK Y CD C + F+    L  H R
Sbjct:  196 SFNQKKKCETHMTIHTGEKPFACQHCGRCLANKDLLNKHIKIHMEDK--PFTCPPCGKSFTQPQLLKFHMRTHTGEKPYTCSQ-CGKSFTQKNGLNYH------MRIHSGEKPFTCAQCGKSFIYNTALLRHRKT-HSGEK-PFTCGQCGKSFTKDYSLKYHLISHTGEKPFKCDLCGKRY--LRKDNLNQHM-------------RIHNNDKSYVCDQCGKGFTRKDYLSQHTR 404          
BLAST of SMED30010458 vs. Ensembl Zebrafish
Match: CU570689.2 (si:ch73-266f23.4 [Source:NCBI gene;Acc:571254])

HSP 1 Score: 61.6178 bits (148), Expect = 2.393e-9
Identity = 63/235 (26.81%), Postives = 93/235 (39.57%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            + N  +K   H      +K F C+ C +  +++  L+ H+K H   +  PFTC  C K F     L+ H R    +K     Q    S +  NG++          I+S  +P TC  C   F     L  H  + HS E+    C  C +SFT + +L+ HL    G     C    +    + K   N H+             RI+  DK Y CD C + F+    L  H R
Sbjct:  196 SFNQKKKCETHMTIHTGEKPFACQHCGRCLANKDLLNKHIKIHMEDK--PFTCPPCGKSFTQPQLLKFHMRTHTGEKPYTCSQ-CGKSFTQKNGLNYH------MRIHSGEKPFTCAQCGKSFIYNTALLRHRKT-HSGEK-PFTCGQCGKSFTKDYSLKYHLISHTGEKPFKCDLCGKRY--LRKDNLNQHM-------------RIHNNDKSYVCDQCGKGFTRKDYLSQHTR 404          
BLAST of SMED30010458 vs. Ensembl Zebrafish
Match: znf1008 (zinc finger protein 1008 [Source:ZFIN;Acc:ZDB-GENE-131121-84])

HSP 1 Score: 60.8474 bits (146), Expect = 2.765e-9
Identity = 65/249 (26.10%), Postives = 105/249 (42.17%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNY--HIGDDLPTKKKRKDK-----------RIYEFDKDYACDNCHRNFSTGQALGNHKRACLN-LPNECI 2170
            H      ++ + C  C KSF+ + SL +H + H   R  PFTC  C K F N   L+ H R    ++     Q       +F    ++        I+S ++P TC  C   +  +  L EH  + HS E+    C LC +SFT    L+VH+    G     CP   +       L+T+   H G+   + +K + K           RI+E ++ Y C  C ++F       +H++  +   P EC+
Sbjct:   72 HMVIHTGERPYTCPQCAKSFTCKGSLKDHFRIHTGER--PFTCPQCEKSFTNSGGLKRHLRIHTGERPFTCRQ----CAKSFPSSGELK---RHMRIHSRDRPYTCPQCGKSYKQKEVLREHTKT-HSGEK-PFTCTLCGKSFTQQSTLKVHMKVHSGEKLHQCPECGRRFAEACNLKTHLLSHTGERPFSCEKCEKKFFLAVHLKTHMRIHEDERRYVCSFCGKSFLWLNGFKDHQKTHIGEKPYECL 309          
BLAST of SMED30010458 vs. Ensembl Zebrafish
Match: si:ch211-161m3.4 (si:ch211-161m3.4 [Source:ZFIN;Acc:ZDB-GENE-110914-169])

HSP 1 Score: 60.4622 bits (145), Expect = 2.803e-9
Identity = 63/231 (27.27%), Postives = 95/231 (41.13%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNY-HIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQ 2119
            T N+ +    H     ++K + C+ C K F    SL  H+K H   +  P+TCR+C K F  + +LQ H R    +K    +Q  K    + N N   +V         ++ N P TC  C   F  +  L  H +  H+ E+    C  C +SFT    L VH+    G     C    Q+      L T+  +  D+ P    ++D + +E D D    N     ST Q
Sbjct:   84 TFNSKRSLEVHTKVHTEEKPYSCQQCGKRFVQERSLKPHMKVHNGEK--PYTCRECGKSFAQIQNLQTHMRIHTGEKPFSCQQCGKSFTQIQNLNVHMRV---------HTGNMPYTCAQCGQCFTHKGNLNAH-VRIHTGEKP-FTCPQCGKSFTQKRNLTVHMRTHTGEKPFTCSQCGQSFTHKASLVTHMRNHSDEKPLAGLQRDIKPFE-DSDQEEKNLSEGLSTEQ 300          
BLAST of SMED30010458 vs. Ensembl Xenopus
Match: timm22 (translocase of inner mitochondrial membrane 22 homolog [Source:Xenbase;Acc:XB-GENE-5754351])

HSP 1 Score: 62.003 bits (149), Expect = 1.879e-9
Identity = 63/239 (26.36%), Postives = 98/239 (41.00%), Query Frame = 2
Query: 1439 INANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSN----FNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRK-DKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
             +  + F  H     ++K F C  C K F+S S L NH K+H   R  PF+C +C K F N   L++H R    +K         YS S     F   S++ +  ++  +++  +P +C  C   F    EL  H    H+ E+    C  C R F T   L  H  ++H                  KL T    G    T  +R   +R +  +K ++C  C + F++   L  H+R
Sbjct:   52 FSQKRDFEKHQRTHKREKPFSCSECGKCFASSSRLKNHNKTHTGER--PFSCSECGKCFKNQCILRNHLRIHTGEKP--------YSCSECGKCFTCSSELTV--HLRRMHTGEKPFSCPECERCFIKSSELTLHRRRAHTGEK-PFSCSECGRCFATPSELYAHQRRTH---------------TGEKLFTCSECGKCFATSSERTVHRRTHTGEKPFSCSECGKCFASSSKLTVHRR 262          
BLAST of SMED30010458 vs. Ensembl Xenopus
Match: ENSXETT00000054824.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.473e-8
Identity = 44/152 (28.95%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVH 1921
            HN     +K F C  C +SF+ + +L NH K H   +  PFTC DC K F  ++SLQ+H        +  + +K           S+     + + I++  +P TC  C   F  R+ L+ H ++ H+ E+    C  C + FT  + L++H
Sbjct:  542 HNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEK--PFTCSDCGKSFAQIISLQNHV-------TIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCTDCGKSFIQRISLQIH-VNSHTGEK-PFTCTECGKCFTQKINLKIH 682          

HSP 2 Score: 53.5286 bits (127), Expect = 1.316e-6
Identity = 53/222 (23.87%), Postives = 90/222 (40.54%), Query Frame = 2
Query: 1496 FQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSN-------FNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKK--RKDKRIYEFDKDYACDNCHRNFSTGQALGNH 2134
            F C  C K F+ +  L  H++ H   +  PFTC +C K FI+ + LQ H+R              ++++ N         G   + I  N   I++  +P  C  C   F ++  L+ H    H+ E+   +C  C + FT   +L  H     G     C    ++                  T+KK  R   +I+  +K + C +C ++F+   +L NH
Sbjct:  412 FPCMECGKGFTDKGKLLRHMRVHTGEK--PFTCTECGKHFIDDIMLQKHKR--------------IHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHHN-KIHTGEK-PFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSF-----------------TEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          
BLAST of SMED30010458 vs. Ensembl Xenopus
Match: ENSXETT00000054823.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.473e-8
Identity = 44/152 (28.95%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVH 1921
            HN     +K F C  C +SF+ + +L NH K H   +  PFTC DC K F  ++SLQ+H        +  + +K           S+     + + I++  +P TC  C   F  R+ L+ H ++ H+ E+    C  C + FT  + L++H
Sbjct:  542 HNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEK--PFTCSDCGKSFAQIISLQNHV-------TIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCTDCGKSFIQRISLQIH-VNSHTGEK-PFTCTECGKCFTQKINLKIH 682          

HSP 2 Score: 53.5286 bits (127), Expect = 1.316e-6
Identity = 53/222 (23.87%), Postives = 90/222 (40.54%), Query Frame = 2
Query: 1496 FQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSN-------FNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKK--RKDKRIYEFDKDYACDNCHRNFSTGQALGNH 2134
            F C  C K F+ +  L  H++ H   +  PFTC +C K FI+ + LQ H+R              ++++ N         G   + I  N   I++  +P  C  C   F ++  L+ H    H+ E+   +C  C + FT   +L  H     G     C    ++                  T+KK  R   +I+  +K + C +C ++F+   +L NH
Sbjct:  412 FPCMECGKGFTDKGKLLRHMRVHTGEK--PFTCTECGKHFIDDIMLQKHKR--------------IHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHHN-KIHTGEK-PFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSF-----------------TEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          
BLAST of SMED30010458 vs. Ensembl Xenopus
Match: ENSXETT00000054822.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.473e-8
Identity = 44/152 (28.95%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVH 1921
            HN     +K F C  C +SF+ + +L NH K H   +  PFTC DC K F  ++SLQ+H        +  + +K           S+     + + I++  +P TC  C   F  R+ L+ H ++ H+ E+    C  C + FT  + L++H
Sbjct:  542 HNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEK--PFTCSDCGKSFAQIISLQNHV-------TIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCTDCGKSFIQRISLQIH-VNSHTGEK-PFTCTECGKCFTQKINLKIH 682          

HSP 2 Score: 53.5286 bits (127), Expect = 1.316e-6
Identity = 53/222 (23.87%), Postives = 90/222 (40.54%), Query Frame = 2
Query: 1496 FQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSN-------FNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKK--RKDKRIYEFDKDYACDNCHRNFSTGQALGNH 2134
            F C  C K F+ +  L  H++ H   +  PFTC +C K FI+ + LQ H+R              ++++ N         G   + I  N   I++  +P  C  C   F ++  L+ H    H+ E+   +C  C + FT   +L  H     G     C    ++                  T+KK  R   +I+  +K + C +C ++F+   +L NH
Sbjct:  412 FPCMECGKGFTDKGKLLRHMRVHTGEK--PFTCTECGKHFIDDIMLQKHKR--------------IHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHHN-KIHTGEK-PFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSF-----------------TEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          
BLAST of SMED30010458 vs. Ensembl Xenopus
Match: ecsit (ECSIT signalling integrator [Source:Xenbase;Acc:XB-GENE-853811])

HSP 1 Score: 58.151 bits (139), Expect = 5.246e-8
Identity = 96/416 (23.08%), Postives = 156/416 (37.50%), Query Frame = 2
Query: 1013 WNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQL-------RICHHFITENPKTYK----ATDNDKTNTESVDEP----------QKKL----QQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQD-SEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPT------KKKRKDK-------RIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            + C +CG R+S K+ L+QH     G R               C  C   F  +  L  HQL        +C    TE    YK       + +T+T     P          +K+L    Q    +K  + K C T  +++   E+     +   S    +  +     +  K  +H      +K F C  C KS+  +S+L  H++ H   +  P+ C +C K+F  L SL  H+     +K  + SE    YS        Q+         ++  +P  C  C   F DR +L  H L  H+ E+    C  C + F TN  L +H     G     C    ++      L T+  I  +          K+ ++K       RI+  +K Y C+ C + F+  + L  H++ 
Sbjct:  410 FECSECGRRFSHKKGLIQHQLIHTGER------------PFECVTCGRRFNRKFTLNKHQLVHTGEKPYVC----TECGMGYKDKGSLVAHLRTHTGEAGIPCTECGKTFLSEKRLKFHMQIHTGVKPFACKECGTSFTLNSYLENHMKKHAGIKSFECKECGKQFFKKSGLK--YHQLSHTGEKPFACTECGKSYRHKSTLVIHLRVHTGEK--PYACTECGKKFSELKSLNSHKLTHTGEKHFECSECGKQYSRREGLQTHQL--------THTGEKPHVCTECGTRFRDRGKLRTHLLI-HTGEE-PFKCEECGKCFVTNRNLHIHKQTHTGEKPFACGECGKHFSQKTSLYTHRLIHTEEKNFACNECGKRYREKVHLTVHQRIHTGEKPYTCNQCEKRFTCKERLKYHEQT 795          
BLAST of SMED30010458 vs. Ensembl Mouse
Match: 9130019O22Rik (RIKEN cDNA 9130019O22 gene [Source:MGI Symbol;Acc:MGI:1926171])

HSP 1 Score: 58.9214 bits (141), Expect = 1.933e-8
Identity = 65/225 (28.89%), Postives = 88/225 (39.11%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            H +    +K FQC  C K F   SSLS+H   H   R  P  C DC K F    +L DH      +KS +       S    + +S+         I+ + QP  C HC   F  R  L  H L  H+ E+    C  C R F+   A R H    H        GV+    P           D   +K  R+  RI+  +K Y+C +C R F     +  H+R
Sbjct:  282 HMYSHTGEKPFQCPDCNKRFGRYSSLSSHRAIHRGER--PHQCPDCGKGFTQRCTLVDHMYSHTGEKSFNCPD-CCKSFGRPSSLSR------HRAIHRMEQPHRCSHCGRTFTRRSSLTSH-LRVHTGEK-PYCCADCGRCFSQRSAFREHQRVVHS-------GVT----PFSCTHCGSAFAD---SKYLRRHMRIHTGEKPYSCPDCGRCFRQSSEIPAHRR 481          
BLAST of SMED30010458 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 57.7658 bits (138), Expect = 3.949e-8
Identity = 89/382 (23.30%), Postives = 142/382 (37.17%), Query Frame = 2
Query: 1019 CEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNT--------ESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            C++CG  + R  VL+QH     G R              +C  C M FT +  L+ HQ       I    K YK  +  K  +        + +   +K  + DD  K  S  S   +H            R          K      N +    +H      +K ++C  C K+F+  S+  NH ++H  S  +P+ C+DC K F N  +L  H+R    +K    E+       +FN  S +        I++  +P  C  C   F     L +H    H+ E+    C +C ++F+ +  L  H     G     C    +         TNY     L        +R++  +K Y C+ C + FS   +L  H+R
Sbjct:   50 CKECGKSFDRNSVLIQHQRIHTGER------------PYKCEECGMAFTGRCILSKHQR------IHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKHQ-----------RIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTH--SGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEE----CGKSFNYSSHLK---QHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRI-HTGEK-PYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAF-------TNY---SGLIV-----HRRVHTGEKPYKCEECGKAFSVHTSLSKHQR 376          
BLAST of SMED30010458 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 57.7658 bits (138), Expect = 4.607e-8
Identity = 89/382 (23.30%), Postives = 142/382 (37.17%), Query Frame = 2
Query: 1019 CEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNT--------ESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            C++CG  + R  VL+QH     G R              +C  C M FT +  L+ HQ       I    K YK  +  K  +        + +   +K  + DD  K  S  S   +H            R          K      N +    +H      +K ++C  C K+F+  S+  NH ++H  S  +P+ C+DC K F N  +L  H+R    +K    E+       +FN  S +        I++  +P  C  C   F     L +H    H+ E+    C +C ++F+ +  L  H     G     C    +         TNY     L        +R++  +K Y C+ C + FS   +L  H+R
Sbjct:   95 CKECGKSFDRNSVLIQHQRIHTGER------------PYKCEECGMAFTGRCILSKHQR------IHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKHQ-----------RIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTH--SGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEE----CGKSFNYSSHLK---QHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRI-HTGEK-PYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAF-------TNY---SGLIV-----HRRVHTGEKPYKCEECGKAFSVHTSLSKHQR 421          
BLAST of SMED30010458 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 57.7658 bits (138), Expect = 4.940e-8
Identity = 89/382 (23.30%), Postives = 142/382 (37.17%), Query Frame = 2
Query: 1019 CEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNT--------ESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            C++CG  + R  VL+QH     G R              +C  C M FT +  L+ HQ       I    K YK  +  K  +        + +   +K  + DD  K  S  S   +H            R          K      N +    +H      +K ++C  C K+F+  S+  NH ++H  S  +P+ C+DC K F N  +L  H+R    +K    E+       +FN  S +        I++  +P  C  C   F     L +H    H+ E+    C +C ++F+ +  L  H     G     C    +         TNY     L        +R++  +K Y C+ C + FS   +L  H+R
Sbjct:   83 CKECGKSFDRNSVLIQHQRIHTGER------------PYKCEECGMAFTGRCILSKHQR------IHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKHQ-----------RIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTH--SGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEE----CGKSFNYSSHLK---QHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRI-HTGEK-PYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAF-------TNY---SGLIV-----HRRVHTGEKPYKCEECGKAFSVHTSLSKHQR 409          
BLAST of SMED30010458 vs. Ensembl Mouse
Match: Zfp788 (zinc finger protein 788 [Source:MGI Symbol;Acc:MGI:1914857])

HSP 1 Score: 57.7658 bits (138), Expect = 6.337e-8
Identity = 66/253 (26.09%), Postives = 101/253 (39.92%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNI----NSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNL--PPMPKLETNYHIGDDLPTKKKRKDK------------RIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
                N  F  H      +K ++C+ C KSF   S L  H ++H  S  +P++C+ C K F +  SL+ H R    +K  + +Q             +  I+P +  I    +S  +P  C  C   F    +L  H  + H+ E+    C  C +SF     L++H     G     C   S+    P + KL    H G+  P   K+ DK            R +  +K YAC  C   F +  +L  HKR
Sbjct:  278 AFRVNSSFWRHKKVHTGEKPYECKQCGKSFIYPSLLQTHERTH--SAEKPYSCKQCGKAFKSHSSLRVHERNHTGKKPYECKQ-----------CGRSFIYPCLLQIHERTHSGVKPYGCKQCGKAFRRLSDLRVHERT-HTGEK-PYECKQCAKSFINRYLLKMHQKSHTGEKPYKCKICSKAFVYPSLLKLHERSHTGEK-PYPCKQCDKAFIFPSLLKLHERTHTGEKPYACKQCGEAFKSYNSLQRHKR 514          
BLAST of SMED30010458 vs. UniProt/SwissProt
Match: sp|Q05481|ZNF91_HUMAN (Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 1.642e-8
Identity = 115/509 (22.59%), Postives = 193/509 (37.92%), Query Frame = 2
Query:  659 RSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSF-IQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQII-HSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETN--YHIGDD-----------LPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +S +C+ CEK F  S+ L+ H+ ++     E+  +  + C      +++  +H  I     I K      +FL      R +   T       +   + F   + +  H + H  ++ +K  CE+CG  +SR   L +H     G +              +C  C   F++   L  H++                     T+TE  ++P K  + D   K LS+    T+H I    E                       N +     H F    +K ++CE C K+F+  SSL+ H + H  +R +PF C++C K FI   +L  H+R    +K    E+    +    + +++  I      I++  +P     C   F   L L +H +  HS E+    C  C ++F     L  H     G     C    +       L T+   H G+            L +   R+ KRI+  +K Y C+ C + FS   AL  HKR
Sbjct:  208 KSCKCKECEKTFHWSSTLTNHKEIH----TEDKPYKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYK--CEECGKAFSRSSTLAKHKRIHTGEK------------PYKCKECGKAFSNSSTLANHKI---------------------THTE--EKPYKCKECDKAFKRLST---LTKHKIIHAGEKLYKCEECGK-----------AFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH--TREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEE-CGKAFRQSSTLTKHKI------IHTGEKPYKFEECGKAFRQSLTLNKHKII-HSREK-PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKR 650          
BLAST of SMED30010458 vs. UniProt/SwissProt
Match: sp|P18715|ZG26_XENLA (Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis OX=8355 PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 8.004e-7
Identity = 44/150 (29.33%), Postives = 66/150 (44.00%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSH 1936
            +K F C  C K F+ + +L NH K H   +  PFTC DC K F    SLQ+H +         + +K           S+         I++  +P TC +C   F  R+ L+ H    H+ E+    C  C + FT    L+ HL ++H
Sbjct:  171 EKPFPCTECGKCFAEKKTLQNHNKIHTGVK--PFTCTDCGKSFTQRTSLQNHVK-------IHTGEKPFTCTECGKSFSEKKTLREHNKIHTGEKPFTCTYCGKSFSQRISLQNH-FKIHTGEK-PFSCTECGKCFTIKSTLQSHLKRTH 309          
BLAST of SMED30010458 vs. UniProt/SwissProt
Match: sp|P18749|ZO6_XENLA (Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis OX=8355 PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.854e-7
Identity = 56/248 (22.58%), Postives = 96/248 (38.71%), Query Frame = 2
Query: 1463 WHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRRE-------MCSQKSQDSEQKIVYSLSNFNGVSQVP--------------IWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +H+     +K F C  C KSF+ +S L  H ++H   +  PFTC +C K +  + +L+ HRR         C++  +   +K +    +     + P              I       ++  +P TC  C   F D+  L+ H  + H+ E+    C  C +SFT    LR H     G     C    ++   M  L               + D+R +  +K + C  C ++F+    L  H + 
Sbjct:  168 YHHKTHTGEKPFACTECGKSFTEKSILQKHQRTHTGEK--PFTCTECGKSYSAMSTLECHRRTHTGEKPFTCTECGKSFTEKSILRKHHKTHTGEKPFTCTECGKSCTEKSILRKHQITHTGEKPFTCTECGKCFSDKTALKYHHKT-HTGEK-PFACTECGKSFTDKSILRNHQRTHTGEKPFTCTECGKSYSAMSTL---------------KSDRRTHTGEKPFTCTECGKSFTEKSILRKHHKT 396          
BLAST of SMED30010458 vs. UniProt/SwissProt
Match: sp|Q9UJU3|ZN112_HUMAN (Zinc finger protein 112 OS=Homo sapiens OX=9606 GN=ZNF112 PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 2.863e-6
Identity = 55/219 (25.11%), Postives = 85/219 (38.81%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K ++CE C K FS  S L  H + H   +  PF C +C K F    +LQ H+R    +K    E+          G S+         +++  +P  C  C   F  R  L+ H  S HS E+  I C +C + F+    L+ H           C    +      +LE +               +R++   K Y C+ C + FS    L  H+R 
Sbjct:  606 EKPYKCEECGKGFSRSSHLQGHQRVHTGEK--PFKCEECGKGFSWSFNLQIHQRVHTGEKPYKCEE-------CGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQ-SVHSGERPYI-CEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAH---------------RRVHTGGKPYKCEVCTKGFSESSRLQAHQRV 798          
BLAST of SMED30010458 vs. UniProt/SwissProt
Match: sp|Q6IV72|ZN425_HUMAN (Zinc finger protein 425 OS=Homo sapiens OX=9606 GN=ZNF425 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.068e-6
Identity = 58/217 (26.73%), Postives = 96/217 (44.24%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKS-QDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNH 2134
            ++ FQC  C KSFS ++S+  H + H   +  PF C +C+K + +   L +H R    +K  Q  E +  + L   N  S +         +S  +P +C+ C   F  +  L EH +  HS E+    C  CD+S+    +L+VHL K  G     CP   +    + K     H+              ++  ++ ++CD C R+F+   AL  H
Sbjct:  551 EEPFQCPECDKSFSWKASMKFHQRMHRDEK--PFACGECDKTYTHQSQLTEHLRLHSGEKPYQCPECEKTFRLKG-NLKSHL-------LQHSGQKPFSCVMCGKSFTQQYRLTEH-IRVHSGEK-PFQCPECDKSYCIRGSLKVHLYKHSGERPFQCPECGKGF--LQKRSLKAHLC-------------LHSGERPFSCDECGRSFTYVGALKTH 740          
BLAST of SMED30010458 vs. TrEMBL
Match: A0A3Q4AR88 (Uncharacterized protein OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.742e-9
Identity = 65/224 (29.02%), Postives = 103/224 (45.98%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQ--DSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHL---TKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K F C+VC+K F  +++L NH++ H   +  PF C  C KRF N  +L  H +    +K    D   K  Y  SN  G  +V         ++  +P +C  C   F D+L L+ H +  H+ E+    C +C + FT N +L+ H+   T+   FA   C    +     P L+T+                R++  +K ++CD C + FST  +L NH R 
Sbjct:  136 EKPFSCDVCEKRFKDKATLRNHMRVHTGEK--PFGCGVCGKRFNNKPNLNTHMKVHTGEKPYGCDVCGKRYYRSSNLRGHMRV---------HTGEKPYSCDICEKRFNDKLNLKTH-MRVHTGEK-PFGCDVCGKRFTVNDSLKKHVRIHTEEKPFA---CDICGKRFNDKPNLKTHM---------------RVHTGEKPFSCDICGKRFSTNDSLKNHIRV 328          
BLAST of SMED30010458 vs. TrEMBL
Match: A0A5A9NB65 (Uncharacterized protein OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti020029 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.604e-9
Identity = 66/221 (29.86%), Postives = 93/221 (42.08%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K F C  C+KSFS   +L NH++SH   +  PFTC+ C K F    SLQ H R    +K     Q  K   S+ N  G  +V         ++  +P TC  C   F  +  L  H +S H+ E+    CLLC +SF T   LR H+    G     C    ++      L+ +                RI+  +K Y CD C ++F     L  H R 
Sbjct:  473 EKPFMCHHCEKSFSDTGALKNHLRSHTGEK--PFTCQQCGKSFSTSGSLQVHMRIHTGEKPYKCRQCEKSFRSIGNLEGHMRV---------HTGEKPFTCTQCGKSFRSKSHLSRH-MSIHTGEK-PFTCLLCGKSFITTSHLRRHMIVHTGEKLFTCQQCGKSYSDQSYLQVHM---------------RIHTGEKPYPCDQCGKSFICASQLKVHMRT 665          
BLAST of SMED30010458 vs. TrEMBL
Match: F6WSD4 (Uncharacterized protein OS=Equus caballus OX=9796 PE=4 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.385e-9
Identity = 75/314 (23.89%), Postives = 134/314 (42.68%), Query Frame = 2
Query: 1457 FHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNF---------------NGVSQVPIWPNITNINSVN----QPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCP--GVSQNLPPMPKLETNYHIGDDL-----------PTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA-CLNLPNEC-------ISSQTPKSNSKLHSIESLIFDNSNIRSTFTNDKNV 2272
            F  H      +K ++C+ C K+FS  ++L  H K+H      PF C++C+K FI+L + Q H R   S+K  + ++  K + S S+F                  S+   +P+   ++ +     +P  C  C   F D   L  H +S H+ ++    C  C+++F +  A RVH     G     C   G + +     ++    HIG+              T   R  +R++  +K Y C  C + F++  +L  H+R      P EC       ISS + + + ++H+ E   ++    R  F++ +N 
Sbjct:  369 FQIHERSHTGEKPYECKECGKAFSLYANLKKHQKTHTGR--TPFVCKECSKAFISLQAFQIHERNHTSEKFYECKKCNKALTSYSSFRRHERNHTREKPYECKKCSKTFAYPSSLRVHEITHTGEKPYECKECGKAFRDPSSLRSHMIS-HTGDR-PYKCKECEKAFISPSAFRVHKRSHTGEKPYECKECGKAFSCSSSLRVHERIHIGEKPYECKECCKSFSRTSSLRVHERVHTGEKPYECKECSKAFTSSSSLRGHERVHTGEKPYECEKCNKAFISSSSLRGHERVHTGEK-PYECKECRKAFSSHQNF 677          
BLAST of SMED30010458 vs. TrEMBL
Match: A0A5N4AIL4 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_08189 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.639e-8
Identity = 58/223 (26.01%), Postives = 105/223 (47.09%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNI--LCLLCDRSFTTNMALRVHLTKSH-GFANGGCPGVSQNL--PPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K F CE+C+K + S+S L+ H K H+++R + F C  C+K F    SL+D  +      S +   K   SL + +   +  +  +I  I++  +   C  C+  F  R EL EH + +H+ E+     +C++C++  ++   L+ HL   H G     C   +++       K+ T YH G                 ++ Y C+ C ++F T ++L  H+R
Sbjct:  187 EKPFGCEICRKFYPSKSYLNKHKKIHFATRDKLFICEICSKSF----SLKDGLKAHLITHSSERAHKC--SLCDRSFAMKASLVSHIKYIHTKEKDFMCQVCAKTFVTRCELNEH-IRRHTGEKKEPKHICMMCNKKLSSATHLKFHLRSEHTGERPYCCKFCTKSFITAQALKIHTRYHTG-----------------ERPYTCNFCSKSFVTNESLKVHER 385          
BLAST of SMED30010458 vs. TrEMBL
Match: A0A1Y1K9G2 (Uncharacterized protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.364e-8
Identity = 58/223 (26.01%), Postives = 105/223 (47.09%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNI--LCLLCDRSFTTNMALRVHLTKSH-GFANGGCPGVSQNL--PPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K F CE+C+K + S+S L+ H K H+++R + F C  C+K F    SL+D  +      S +   K   SL + +   +  +  +I  I++  +   C  C+  F  R EL EH + +H+ E+     +C++C++  ++   L+ HL   H G     C   +++       K+ T YH G                 ++ Y C+ C ++F T ++L  H+R
Sbjct:  212 EKPFGCEICRKFYPSKSYLNKHKKIHFATRDKLFICEICSKSF----SLKDGLKAHLITHSSERAHKC--SLCDRSFAMKASLVSHIKYIHTKEKDFMCQVCAKTFVTRCELNEH-IRRHTGEKKEPKHICMMCNKKLSSATHLKFHLRSEHTGERPYCCKFCTKSFITAQALKIHTRYHTG-----------------ERPYTCNFCSKSFVTNESLKVHER 410          
BLAST of SMED30010458 vs. Ensembl Cavefish
Match: znf668 (zinc finger protein 668 [Source:NCBI gene;Acc:103039553])

HSP 1 Score: 68.5514 bits (166), Expect = 1.730e-11
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNH-VKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETN--YHIGDD-----------LPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            Q  F+C  C+++F S SSL +H + +H   + QP+TC  C+K F N   L  H+R                                    +S  +P  C  C   +    EL  H+ S H+ E+   +C  C ++F   + LR+H+T+  G     CP  S++ P + KL+ +   H G+                  RK +R ++  + Y+CD C + ++  + L NH+R+
Sbjct:   46 QHTFKCSACQEAFFSPSSLRSHKLSAHSKEKQQPYTCNQCSKTFPNRAQLSKHQRS-----------------------------------HSAQRPFKCTQCHKAYKTPTELRNHSRS-HTGEK-PFVCTECGKAFMQAICLRIHMTQHSGERPHSCPHCSKSYPTLSKLKVHQRSHTGEKPYFCAECGKSFADPSVYRKHRRNHQGHRPYSCDQCGKTYTELKDLKNHERS 241          
BLAST of SMED30010458 vs. Ensembl Cavefish
Match: ENSAMXT00000035193.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:14635923:14637747:1 gene:ENSAMXG00000044096.1 transcript:ENSAMXT00000035193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.085e-9
Identity = 45/189 (23.81%), Postives = 81/189 (42.86%), Query Frame = 2
Query: 1439 INANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRR----------EMCSQKSQDSEQKIVYSLSNFNG-----------VSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGF 1942
            +  ++KF  H    + ++ F+C  C K+F   + L  H+++H   R  PF C +C KRF +  +L  HRR           +C ++  D+   + +   +               +   +      I+S  +P  C  C   F D+ EL  H +S H+ E+ N  C +C +S+    +L++H    H  
Sbjct:   46 LQWHKKFKAHVKTHSTERPFECNTCGKAFKKEAFLREHLRTHTGER--PFECPECGKRFSHGGNLATHRRIHTGEKPFQCTLCGRRFSDASHYVKHQRWHSGDKPKACEICGKCFADTALLNRHKRIHSGEKPFACTECEKTFLDKSELARH-MSTHTRER-NHRCEVCGKSYARGYSLKLHQKTHHAL 230          
BLAST of SMED30010458 vs. Ensembl Cavefish
Match: ENSAMXT00000042131.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001240.1:32472:51936:1 gene:ENSAMXG00000032457.1 transcript:ENSAMXT00000042131.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 2.250e-9
Identity = 76/297 (25.59%), Postives = 121/297 (40.74%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR--------ACLNLPNECISSQTPKSNSKLHSIES-----------LIFDNSNIRSTFTNDKNVFLA 2281
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R         C +      +    K++ ++H+ E            L   NS I S FT ++N   A
Sbjct:  748 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGRVLLHRVNSKITSAFTQERNRITA 1033          

HSP 2 Score: 60.8474 bits (146), Expect = 5.989e-9
Identity = 63/231 (27.27%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  300 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 519          

HSP 3 Score: 60.4622 bits (145), Expect = 6.521e-9
Identity = 63/231 (27.27%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  664 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 883          

HSP 4 Score: 59.3066 bits (142), Expect = 1.721e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  468 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 687          

HSP 5 Score: 58.9214 bits (141), Expect = 1.874e-8
Identity = 63/231 (27.27%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  496 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 715          

HSP 6 Score: 58.9214 bits (141), Expect = 2.040e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  692 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 911          

HSP 7 Score: 58.5362 bits (140), Expect = 2.567e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  524 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 743          

HSP 8 Score: 58.151 bits (139), Expect = 3.314e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  636 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYHCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 855          

HSP 9 Score: 58.151 bits (139), Expect = 3.342e-8
Identity = 63/248 (25.40%), Postives = 101/248 (40.73%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            + N       H      +K + C  C K F  +S+L  H + H   +  P+ C DC K F     L++H+R         + +K  Y        +Q   +     I++  +P  C  C   F  + +L++H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   59 SFNQGSHLQIHQRIHTGEKTYHCSDCGKRFIEQSTLKRHQRIHTGEK--PYYCSDCGKSFTTQSQLKNHQRIH-------TGEKPYYCSDCGKSFNQQSTFQIHQRIHTGEKPYYCSDCGKSFTTQSKLKKHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 295          

HSP 10 Score: 58.151 bits (139), Expect = 3.517e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  580 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYHCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 799          

HSP 11 Score: 57.7658 bits (138), Expect = 5.383e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  720 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 939          

HSP 12 Score: 57.3806 bits (137), Expect = 5.617e-8
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  608 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 827          

HSP 13 Score: 57.3806 bits (137), Expect = 5.713e-8
Identity = 61/231 (26.41%), Postives = 99/231 (42.86%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  356 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 575          

HSP 14 Score: 57.3806 bits (137), Expect = 6.659e-8
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  244 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 463          

HSP 15 Score: 56.6102 bits (135), Expect = 9.933e-8
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  384 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 603          

HSP 16 Score: 56.6102 bits (135), Expect = 1.148e-7
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  188 EKPYHCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 407          

HSP 17 Score: 56.6102 bits (135), Expect = 1.178e-7
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  412 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYHCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQR 631          

HSP 18 Score: 56.225 bits (134), Expect = 1.613e-7
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K + C  C KSF+++S L NH + H   +  P+ C DC K F     L++H+R    +K         Y  S+     +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  552 EKPYYCSDCGKSFTTQSKLKNHQRIHTGEK--PYYCSDCGKSFTTQSKLKNHQRIHTGEKP--------YHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRI-HTGEK-PYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 771          

HSP 19 Score: 55.4546 bits (132), Expect = 2.598e-7
Identity = 58/235 (24.68%), Postives = 95/235 (40.43%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            + N    F  H      +K + C  C KSF+++S L  H + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +               +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  143 SFNQQSTFQIHQRIHTGEKPYYCSDCGKSFTTQSKLKKHQRIHTGEK--PYHCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNH---------------QRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 351          

HSP 20 Score: 54.299 bits (129), Expect = 5.633e-7
Identity = 86/389 (22.11%), Postives = 147/389 (37.79%), Query Frame = 2
Query: 1013 WNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI------------GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            ++C  CG R++++  L +H     G +               C+ C   F    +L +HQ       I    KTY  +D  K     +++   K  Q  +  +          S +   + +++ R               + N    F  H      +K + C  C KSF+++S L  H + H   +  P+ C DC K F     L++H+R         + +K  Y        +      N   I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++     KL+ +  I            G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   23 YHCSDCGKRFTQQSNLKKHQRIHTGEK------------PYHCSDCGKSFNQGSHLQIHQR------IHTGEKTYHCSDCGK---RFIEQSTLKRHQRIHTGEKPYYCSDCGKSFTTQSQLKNHQRIHTGEKPYYCSDCGKSFNQQSTFQIHQRIHTGEKPYYCSDCGKSFTTQSKLKKHQRIHTGEK--PYHCSDCGKSFTTQSKLKNHQRIH-------TGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRI-HTGEK-PYYCSDCGKSFTTQSKLKNHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 379          

HSP 21 Score: 51.9878 bits (123), Expect = 3.113e-6
Identity = 58/234 (24.79%), Postives = 97/234 (41.45%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKS---QDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +K++ C  C K F+ +S+L  H + H   +  P+ C DC K F     LQ H+R    +K+    D  ++ +          +         I++  +P  C  C   F  + +L+ H    H+ E+    C  C +SF      ++H     G     C    ++     KL         E  YH    G    T+ K K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   20 EKLYHCSDCGKRFTQQSNLKKHQRIHTGEK--PYHCSDCGKSFNQGSHLQIHQRIHTGEKTYHCSDCGKRFI----------EQSTLKRHQRIHTGEKPYYCSDCGKSFTTQSQLKNHQRI-HTGEK-PYYCSDCGKSFNQQSTFQIHQRIHTGEKPYYCSDCGKSFTTQSKLKKHQRIHTGEKPYHCSDCGKSFTTQSKLKNHQRIHTGEKPYYCSDCGKSFTTQSKLKNHQR 239          
BLAST of SMED30010458 vs. Ensembl Cavefish
Match: ENSAMXT00000035399.1 (zinc finger protein OZF-like [Source:NCBI gene;Acc:103035809])

HSP 1 Score: 60.4622 bits (145), Expect = 5.286e-9
Identity = 60/236 (25.42%), Postives = 96/236 (40.68%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            + N +   H H      +K ++C  C +SF  + SL  H ++H   +  P+ C +C KRF  L  LQ H+R    +K     +       NFNG+S +        I++  +P  C  C   F ++  L  H    H+ E+    CL C   F  N   + H     G     C    ++   +  L+T+               +RI+  +K Y C  C +NF+   AL  H+R 
Sbjct:  172 SFNRHGHLHRHKLLHTGEKPYECSECGRSFRHKGSLQIHQRTHTGEK--PYHCSECGKRFAQLGYLQKHQRIHTGEKPYYCSE----CGKNFNGISNLQTH---QRIHTGEKPYECPECGKSFIEQSHLRRHQRV-HTGEK-PYECLECGTLFKDNSTFQKHQRIHTGEKPYYCSDCGKSFNGISNLQTH---------------QRIHTGEKPYYCAVCGKNFNEQSALKIHQRV 381          
BLAST of SMED30010458 vs. Ensembl Cavefish
Match: ENSAMXT00000018704.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001240.1:31030:34827:-1 gene:ENSAMXG00000018161.2 transcript:ENSAMXT00000018704.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.551e-8
Identity = 121/529 (22.87%), Postives = 205/529 (38.75%), Query Frame = 2
Query:  614 TIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQIIHSQNHQR--KQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKT-NTESVDEPQKKLQQDDNIKDLS--SKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            T +NL +++     ++   C +C K FT  +NL  H+R++      + S      T QSN+    +H  I+      K +H  D       +   +  Q  H  + P          T   + +NHQR       ++C  CG  ++ +  L  H     G +               C+ C   FT Q  L  HQ       I    K Y  +D  K+  T+S  +  +++   +     S   KS +T+ ++  +    +  +    S      +    +  +Q+ H        +K + C  C KSF+++S+L NH + H   +  P+ C DC K F    +L++H+R    +K        K   + SN           N   I++  +P  C  C   F  +  L++H    H+ E+    C  C +SFTT   L+ H     G     C    ++      L         E  YH    G    T+   K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:  174 TQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL---KNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK------------PYHCSDCGKSFTTQSNLKNHQR------IHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHT------GEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK--PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLK---------NHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRI-HTGEK-PYYCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTEEKPYHCSDCGKSFATQSQLKNHQR 659          

HSP 2 Score: 56.225 bits (134), Expect = 1.121e-7
Identity = 121/529 (22.87%), Postives = 203/529 (38.37%), Query Frame = 2
Query:  614 TIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQIIHSQNHQR--KQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKT-NTESVDEPQKKLQQDDNIKDLS--SKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYHI---GDDLPTKKK-RKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            T +NL  ++     ++   C +C K FT  +NL  H+R++      + S      T QSN+    +H  I+      K +H  D       +   +  Q  H  + P          T   + +NHQR       ++C  CG  ++ +  L  H     G +               C+ C   FT Q  L  HQ       I    K Y  +D  K+  T+S  +  +++   +     S   KS +T+ ++  +    +  +    S      +    +  +Q+ H        +K + C  C KSF+++S+L NH + H   +  P+ C DC K F    +L++H+R    +K        K   + SN           N   I++  +P  C  C   F  +  L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++      L         E  YH    G    T+   +K +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   90 TQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL---KNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK------------PYHCSDCGKSFTTQSNLKNHQR------IHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHT------GEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK--PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLK---------NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEK-PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYYCSDCGKSFTTQSNLKNHQR 575          

HSP 3 Score: 51.6026 bits (122), Expect = 2.951e-6
Identity = 117/509 (22.99%), Postives = 194/509 (38.11%), Query Frame = 2
Query:  674 QNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQIIHSQNHQR--KQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKT-NTESVDEPQKKLQQDDNIKDLS--SKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSE--QKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYH---IGDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            QNC K FT  +NL  H+R++      + S       +QS +    +H  I+      K +H  D       +   +  Q  H  + P          T   + +NHQR       ++C  CG  ++ +  L  H     G +               C+ C   FT Q  L  HQ       I    K Y  +D  K+  T+S  +  +++   +     S   KS +T+ ++  +    +  +    S      +    +  +Q+ H        +K + C  C KSF+++S+L NH + H   +  P+ C DC K F    +L++H+R    +K        K   + SN           N   I++  +P  C  C   F  +  L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++      L         E  YH    G    T+   K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   26 QNCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTL---KTHQRIH---TGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK------------PYHCSDCGKSFTTQSNLKNHQR------IHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHT------GEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK--PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLK---------NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEK-PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 491          

HSP 4 Score: 50.8322 bits (120), Expect = 5.372e-6
Identity = 119/529 (22.50%), Postives = 201/529 (38.00%), Query Frame = 2
Query:  614 TIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQIIHSQNHQR--KQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKT-NTESVDEPQKKLQQDDNIKDLS--SKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSE--QKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKL---------ETNYH---IGDDLPTKKKRKD-KRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            T +NL +++     ++   C +C K F   + L  H+R++      + S      T QSN+     H  I+      K +H  D       +   +  Q  H  + P          T   + +NHQR       ++C  CG  ++ +  L  H     G +               C+ C   FT Q  L  HQ       I    K Y  +D  K+  T+S  +  +++   +     S   KS +T+ ++  +    +  +    S      +    +  +Q+ H        +K + C  C KSF+++S+L NH + H   +  P+ C DC K F    +L++H+R    +K        K   + SN           N   I++  +P  C  C   F  +  L+ H    H+ E+    C  C +SFTT   L+ H     G     C    ++      L         E  YH    G    T+   K+ +RI+  +K Y C +C ++F+T   L NH+R
Sbjct:   34 TQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSNL---KKHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK------------PYHCSDCGKSFTTQSNLKNHQR------IHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHT------GEKPYHCSDCGKSFTTQSNLKNHQRIHTGEK--PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLK---------NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEK-PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 519          
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007569.1 (pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-1 gene:ENSPMAG00000006836.1 transcript:ENSPMAT00000007569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 4.785e-9
Identity = 57/232 (24.57%), Postives = 94/232 (40.52%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCS---QKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRAC-LNLPNECI 2170
            +K F CE C + F+  +SL+ H + H +   +PF C DC  RF N++S + H+R          +D  +K  +SLS+               I++  +P +C  C   F  +  L  H   K    +    C  C R F    +LR+H+    G     C    Q                 L +    + +RI+  ++ + C+ C + FS    L  H+R+C +  P  C 
Sbjct:   30 EKPFACEKCGRRFTWSNSLARHRRIH-TGESKPFQCGDCGHRFRNVISFRRHQRTHTGVNLYACEDCGKK--FSLSH--------DLTRHRRIHTGERPFSCRDCGMTFRLKQHLRRH--QKTHEGEAPFRCDHCGRLFMHKRSLRIHVRNHTGERPYACDFCDQRF---------------LRSDNLTRHRRIHTGERPFGCERCGKRFSCSHHLTQHRRSCTMTAPFTCT 233          
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Match: prdm5 (PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040708-1])

HSP 1 Score: 54.6842 bits (130), Expect = 4.097e-8
Identity = 58/238 (24.37%), Postives = 88/238 (36.97%), Query Frame = 2
Query: 1490 KIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSN-------FNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNY--HIGDDLPTKKKRKDK------------RIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            +IF C+ C K F S + L  H+ +H   R  PF+C  C K F  L  +  H              K+++S+           G +   ++ N    +S  +P  C  C  +F     L+ H             C LCD++F T   L+ H     G     CP   Q       L  +   H G+  P + +  DK            R +  +K Y C  C++ FS  + L  H R
Sbjct:  153 EIFDCQDCDKKFISANQLRRHMITHSEKR--PFSCEVCGKSFKRLDQVASH--------------KVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRH--------HKKYKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGER-PYQCQYCDKAFSKNDGLKMHIRTHTREKPYQCSECNKAFSQKRGLDEHMR 365          
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.235e-7
Identity = 61/244 (25.00%), Postives = 100/244 (40.98%), Query Frame = 2
Query: 1481 NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRG--QPFTCRDCNKRFINLLSLQDHRREM----------CSQKSQDSEQKIVYSLSNFNG-----------VSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            N +K++ CE C K+FSSR +L  H+K+H  +    +PF C+DC KRF    +L+ H              C +    +    V+ L++               SQ          ++  +P  C  C   F     L+EH    H+ E+   +C  C +SF+ + A+ VH     G     C    +     P L+T+               +RI+  +K YAC+ C ++FS    L  H++ 
Sbjct:    9 NAEKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHH-KIHTGER-PYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTH---------------QRIHTGEKPYACNICGKSFSLNYNLKAHQKT 235          

HSP 2 Score: 49.2914 bits (116), Expect = 3.153e-6
Identity = 61/227 (26.87%), Postives = 93/227 (40.97%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQD-SEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKR-KDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            H      ++ + C+ C + FS  SSL  H  +H   R  PF C DC KRF+   +L++H +    ++     E    +S S+   V Q          ++  +P  C  C   F  +  L+ H    H+ E+    C +C +SF+ N  L+ H  K+H           +  P M +L      G     K+      R +   K Y C +C   FS GQ L  HKR
Sbjct:   92 HRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGER--PFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQ--------KTHTGEKPFICKDCGRGFAQKPHLKTHQRI-HTGEK-PYACNICGKSFSLNYNLKAH-QKTH----------LKERPYMCEL-----CGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKR 290          

HSP 3 Score: 48.1358 bits (113), Expect = 7.785e-6
Identity = 57/226 (25.22%), Postives = 93/226 (41.15%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            H F  + +K F C+ C K +S +S+L NH   H  S  +PF C++C K F    SL++H+       + D EQ  +         SQ         +++  +   C  C   F     L++H    HS+E+   +C  C +SF+    L+VH     G     C    +     P L+++               +R +  +K Y C +C + FS    L  HK+ 
Sbjct:  316 HEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVH--SGEKPFLCKECGKGFSQGSSLKNHKL------THDGEQPFICQECG-RRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQ-QMHSSER-PFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSH---------------QRTHTGEKPYECQDCGKYFSLNCNLKVHKKT 515          
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 53.1434 bits (126), Expect = 1.350e-7
Identity = 58/232 (25.00%), Postives = 83/232 (35.78%), Query Frame = 2
Query: 1448 NQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETN--YHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHK 2137
            NQ    H      ++ F CE+C K+FS  S+L  H  +H   R  P  C  C K F +  +L+ H       K    E+    +   F+    V            N+P  C  C   F    EL +HA + H+ E+ ++ C  C R+F     LR H     G     CP   +       L  +   H G   P                +AC  C   F+   AL  H+
Sbjct:  134 NQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDR--PHVCELCGKAFPHATNLKQH------LKRHTGERSAAAACCLFSACCNVIKHLRADTAKDKNKPHACSECGRRFLSVRELAQHART-HTGERPHV-CAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHARAHAGQRRP---------------QHACTQCGCRFARAGALRKHQ 340          
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007433.1 (pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gene:ENSPMAG00000006708.1 transcript:ENSPMAT00000007433.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 3.558e-6
Identity = 36/152 (23.68%), Postives = 66/152 (43.42%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVH 1921
            H    N +K F+C+ C K+F+    L +H + H   + + + C+ C + +  L +L+ H       +    EQK +  L   +  +++         +   +P+ C  C   F +   L  H  +    EQ  +LC  C ++FT   +LR H
Sbjct:   35 HRAVHNGKKPFECDACGKAFTHAKDLRSHQRVHLRKK-KGYKCKRCERSYTRLGALRTH------HERSHEEQKPLLCLECGDAFTELDSLRRHERTHKEQKPLLCSECGEAFTELDSLRRHERT--HKEQKPLLCSECGKAFTELDSLRQH 177          
BLAST of SMED30010458 vs. Ensembl Nematostella
Match: EDO48254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJF5])

HSP 1 Score: 59.6918 bits (143), Expect = 5.576e-10
Identity = 59/228 (25.88%), Postives = 90/228 (39.47%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRR----------EMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
            QKIF+C+ C+K FS  S L  H+  H  +R  PF C  C +RF   + L+ H            + C ++    ++  V+ LS+  G         + N   V +P  C  CS  F D  EL  H   ++  +     C  C  +FT + +L+ HL K  G     C    +       L+ +                R++  D+ + C  C R FS       HKR
Sbjct:   12 QKIFKCKKCEKEFSFSSRLKRHLLVHTGAR--PFECPICFRRFTQAVDLKRHMLRHSGQKPHVCQYCGKQYTRGDRLKVHLLSHTEGGP-------LANHALVPKPYNCSRCSMTFEDAEELYVHTC-RYEGKAKAYRCDECHSTFTKSTSLKSHLLKHTGEKKFKCAHCPKTFFSSSSLKIHV---------------RVHTGDRPFKCKECPRKFSDPSNFNKHKR 214          
BLAST of SMED30010458 vs. Ensembl Nematostella
Match: EDO33340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSH6])

HSP 1 Score: 50.447 bits (119), Expect = 2.130e-6
Identity = 58/250 (23.20%), Postives = 101/250 (40.40%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHI-GDDLPTKKKR------------KDKRIYEFDKDYACDNCHRNFSTGQALGNHKR--------ACLN 2152
            H      +K + C  C K+F+  S+L+ H +SH + +  P+ CR C+K+F +  S + H  +   +K   S +      +N   V+      +    +S  +   C+ C   F     L+ H       E+  + C  CD+SF    ALRVH+ +  G     CP  +Q       L  +  +  ++ P K +             +  +I+  +K + C++C   F     L  H R        AC+N
Sbjct:    7 HERTHTGEKPYICHYCGKAFAQTSNLARHTRSHTNEK--PYECRYCDKQFADFSSRKRHEWQHTGEKPY-SCKICGKGFTNPGNVT------SHMKQHSDEKGYKCVECGRAFKLSTTLKTHMWV--HKEKKPLECTECDKSFVQESALRVHMMRHDGVKPFSCPLCTQRFVNQSALNVHQKVHSEERPYKCEVCMKAFKCSTHLIRHGKIHVGNKPFKCNDCDAAFFAAHELKKHSRRHTGEKPYACVN 245          

HSP 2 Score: 48.1358 bits (113), Expect = 8.990e-6
Identity = 53/236 (22.46%), Postives = 94/236 (39.83%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFN-GVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKR 2140
             +N +QK H      ++++ ++CEVC K+F   + L  H K H  ++  PF C DC+  F     L+ H R    +K         Y+  N N   S           ++ + P  C  C   F ++  L+ H +  H++++ +  C LC + F  + +L VH+    G     C    +       L               ++  RI+  ++ Y C  C R F    +   H++
Sbjct:  171 ALNVHQKVH------SEERPYKCEVCMKAFKCSTHLIRHGKIHVGNK--PFKCNDCDAAFFAAHELKKHSRRHTGEKP--------YACVNCNKAFSSSSSLSLHMKRHAGDTPHKCDICGKGFVNKGALKLHIVGVHTDKKPH-QCQLCGKPFLHSCSLEVHMRSHTGEKEFICKICGKASTTRDAL---------------KRHLRIHTGERPYKCKICKRAFGDASSRNKHEK 374          
BLAST of SMED30010458 vs. Ensembl Nematostella
Match: EDO36537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI98])

HSP 1 Score: 48.9062 bits (115), Expect = 3.754e-6
Identity = 32/131 (24.43%), Postives = 61/131 (46.56%), Query Frame = 2
Query: 1766 NQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANG-GCPGVSQNLPPMPKLETNYHIGDDL-PTKKK-RKDKRIYEF-----DKDYACDNCHRNFSTGQALGNH 2134
            ++ + C HC  VF+    L++H ++ H + Q    C +CDR ++    L VH+  +H   N   C   S++    P L  +    + + P+K++ R++++            Y C+NC + F    +L  H
Sbjct:   38 DRRLVCKHCKKVFFAMSSLKKHVITAH-DSQAPFWCPVCDRDYSRKDNLAVHMMNAHSTTNSKKCQLCSRSFLTQPDLSRHMRCHEKMTPSKQETREEQKTTAVPTTMDSSAYQCNNCSKAFDNSASLSRH 167          
BLAST of SMED30010458 vs. Ensembl Nematostella
Match: EDO36958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH48])

HSP 1 Score: 48.9062 bits (115), Expect = 5.155e-6
Identity = 51/219 (23.29%), Postives = 85/219 (38.81%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ--KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGN-ILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNH 2134
            +K+F+C++C+K  +  ++L  H+ +HY  +   F C  C + F +   L+ H +    +K    +Q  K  Y+  +               I+S  +P  C  C   F     L+ H  +    E G    C  C +SF     LR HL    G          Q      K   ++    DL     RK  RI+  ++ Y CD   + F+   ++  H
Sbjct:  143 EKLFKCDICEKRVTRMTTLKAHLSTHYFKKPANFKCELCKRSFGSASGLRQHIKYHAEKKPHKCKQCFKEFYTRGDLT---------KHLRIHSGEKPYNCDRCGRRFTQISSLKAHLATHKDPEDGTQSKCDHCGKSFADPAYLRQHLKYHFG----------QKTHRCSKCGFSFFTKGDL-----RKHTRIHNGERPYKCDFGGKQFTQNSSMNEH 337          
BLAST of SMED30010458 vs. Ensembl Nematostella
Match: EDO41358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4P8])

HSP 1 Score: 48.9062 bits (115), Expect = 5.877e-6
Identity = 63/251 (25.10%), Postives = 101/251 (40.24%), Query Frame = 2
Query: 1481 NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRR----------EMCSQK-SQDSEQKIVYSLSNFNGVSQVPIWPNI--------TNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLE--TNYHIGD--------DLPTKKK---RKDKRIYEFDKDYACDNCHRNFSTGQALGNHK 2137
              QK ++C VC K FS  SS + H++ H  S  +P+ C  C KRF     L+DH R          ++C +   Q S+ K        +   + P   +          +INS ++P  C  C   F     L++H++    N++    C +CD+ F T   LR H+    G     C   S+       L+   N H G         +L  ++    RK +  +  +  + C+ C R F    AL  H+
Sbjct:   27 GDQKYYKCNVCGKLFSHPSSRNIHLRLH--SGEKPYECTTCGKRFRVSSHLKDHIRVHTGERPYVCDICQKGFKQSSDLKKHRRTHTLDKPFKCPFCASAFTRSHHCRGHINSADKPHRCPVCKKCFSRASLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVRIHTGERPFKCHICSRAFKQSSDLKKHINLHTGANQFKCEECNLEFRRADALRKHRLGHSDESTFGCEQCGRVFQHISALRQHR 275          
BLAST of SMED30010458 vs. Ensembl Medaka
Match: ENSORLT00000028476.1 (pep primary_assembly:ASM223467v1:17:10987274:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000028476.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.905e-9
Identity = 55/226 (24.34%), Postives = 92/226 (40.71%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            H      +K F CE+C KS    SSL +H+++H   R  PF+C  C K F+   SL+DH R         + +K     +     +Q     +    ++  +P +C  C   F+    L  H + KH+ E+    C +C +SF  N +L+ H+    G     C    +       LE +                R +  ++ ++CD C ++F+    L  H R 
Sbjct:  130 HTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGER--PFSCEICAKGFVKNSSLRDHMR-------IHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNH-MRKHTGER-PFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKMCGKGFKRNASLEAHV---------------RTHTGERPFSCDMCGKSFTQSGNLTAHMRT 329          

HSP 2 Score: 52.373 bits (124), Expect = 1.370e-6
Identity = 43/159 (27.04%), Postives = 65/159 (40.88%), Query Frame = 2
Query: 1448 NQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHL 1924
            N     H      +K F C++C K+F     L+NH++ H   R  PF+C  C K FI   SL+DH       KS   E+     +    G  +          ++  +P +C  C   F     L  H +  H+ E     C LC +SF  + +L  H+
Sbjct:  208 NSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMRKHTGER--PFSCEICGKSFIRNSSLKDH------MKSHTGERPFTCKMCG-KGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAH-MRTHTGET-PYSCQLCGKSFGRSFSLSAHM 355          
BLAST of SMED30010458 vs. Ensembl Medaka
Match: ENSORLT00000035502.1 (pep primary_assembly:ASM223467v1:2:5523992:5689233:-1 gene:ENSORLG00000029027.1 transcript:ENSORLT00000035502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 4.240e-9
Identity = 62/239 (25.94%), Postives = 102/239 (42.68%), Query Frame = 2
Query: 1469 NFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNY--HIGDDLPTKKKRKDK------------RIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            N     +K F C  C KSFS  S L +H++SH      PF+C +C+KRF ++ +L+ H R         + +K+   +      S V         ++  +P +C+ C   F D   L++ +L  H+ E+    C  C++SF+    L+ H+    G     C    ++     KL+ +   H G+  P   K  DK            R +  +K ++C  C + FS    L NH R 
Sbjct:   71 NMRHTGEKPFSCIECDKSFSQTSHLKSHMRSHTGE--NPFSCVECDKRFSHVFTLKKHMR-------THTGEKLFSCIECDKRFSHVFTLKKHMRTHTGEKPFSCVECDKRFSDSSSLQK-SLRTHTGEK-PFSCKKCNKSFSFVFNLKTHMRTHTGEKPFSCKECDKSFSEKSKLKIHMRTHTGEK-PFSCKECDKSFSEKSKLKIHMRTHTGEKPFSCTECDKRFSQLSNLKNHIRT 297          
BLAST of SMED30010458 vs. Ensembl Medaka
Match: ENSORLT00000038605.1 (pep primary_assembly:ASM223467v1:2:11816293:11870522:1 gene:ENSORLG00000027982.1 transcript:ENSORLT00000038605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 5.351e-9
Identity = 70/270 (25.93%), Postives = 117/270 (43.33%), Query Frame = 2
Query: 1454 KFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNY---HIGDDLPTKKKRKDK------------RIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLP----NECISSQTPKSNSKLH 2206
            KF  H      +K F C+ C+ SF ++SSL  H+K+H   +  PF+C++C+K F     L+ H R    +K    ++      + F+ +S +        I++  +P +C  C+  F ++  L+ H +  H+ E+    C  CD SF+    L  H+    G     C    ++   +  L+ +    H G+  P   K  D+            R +  ++ ++C  C + FS    L NH R          NEC SS + KSN K H
Sbjct:  102 KFRLHMRSHTGEKPFSCQECETSFKTKSSLKVHMKTHTGEK--PFSCKECDKCFCEKSHLKRHMRIHTGEKPFSCQE----CDTRFSRISSLKTH---IIIHTGEKPFSCKECNKSFREKSHLKRH-MRTHTGEKP-FCCQECDTSFSLKSHLETHMRTHTGEKPFSCQACDKSFSQISHLKRHLRTTHTGEK-PFSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGEKPFSCNECDSSFSQKSNLKTH 359          

HSP 2 Score: 49.6766 bits (117), Expect = 8.386e-6
Identity = 54/220 (24.55%), Postives = 89/220 (40.45%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQ-KIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K F C+ C   FS  SSL  H+  H   +  PF+C++CNK F     L+ H R    +K    ++    +SL +                ++  +P +C  C   F     L+ H  + H+ E+    C  CDRSF+   +L++H+    G     C    +    +  L+   HI             R +  +K ++C+ C  +FS    L  H R 
Sbjct:  169 EKPFSCQECDTRFSRISSLKTHIIIHTGEK--PFSCKECNKSFREKSHLKRHMRTHTGEKPFCCQECDTSFSLKSH--------LETHMRTHTGEKPFSCQACDKSFSQISHLKRHLRTTHTGEKP-FSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKN--HI-------------RTHTGEKPFSCNECDSSFSQKSNLKTHMRT 362          
BLAST of SMED30010458 vs. Ensembl Medaka
Match: ENSORLT00000040261.1 (pep primary_assembly:ASM223467v1:17:10987144:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000040261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 7.211e-9
Identity = 61/248 (24.60%), Postives = 100/248 (40.32%), Query Frame = 2
Query: 1466 HNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRR----------EMCSQ------------KSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            H      +K + C +C KSFS   SL++HVK+H S R  PF+C  C KRFI   SL+ H +          E+C +            KS   E+            +   +  ++   ++  +P +C  C   F     L+ H +  H+ E+    C++CDRSFT +  L+ H+    G     C    +       LE +                R +  ++ ++CD C ++F+    L  H R 
Sbjct:  109 HTRTHTGEKPYSCTLCGKSFSRNDSLTSHVKTHTSER--PFSCEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSFNRNASLNIHRKSHTGEKLYFCKTCGKRFFTSSSLTVHM-KTHTGERPFSCETCGKSFNLSWSLKAH-MRTHTGER-PFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAHV---------------RTHTGERPFSCDMCGKSFTQSGNLTAHMRT 336          

HSP 2 Score: 50.447 bits (119), Expect = 5.236e-6
Identity = 55/234 (23.50%), Postives = 97/234 (41.45%), Query Frame = 2
Query: 1457 FHWHNFDE-----NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            F  HNF        ++K + CE+C K F+  S L+ H+++H   R  PF C+ C K F +  SL+ H R      +   E+    +L      S+     +    ++  +P +C  C   F     L+ H +  H++E+    C +C +SF  N +L +H  KSH           + L         +     L    K      +  ++ ++C+ C ++F+   +L  H R 
Sbjct:   45 FVIHNFSTQMKKHTEEKNYSCEICGKDFTVSSRLTVHMRTHTGER--PFLCKLCGKTFKHSGSLKAHTR------THTGEKPYSCTLCG-KSFSRNDSLTSHVKTHTSERPFSCEQCGKRFIKSGSLKVH-MKSHTDER-PFFCEICGKSFNRNASLNIHR-KSH---------TGEKLYFCKTCGKRFFTSSSLTVHMK-----THTGERPFSCETCGKSFNLSWSLKAHMRT 252          
BLAST of SMED30010458 vs. Ensembl Medaka
Match: ENSORLT00000024113.2 (pep primary_assembly:ASM223467v1:2:8030021:8051781:-1 gene:ENSORLG00000024399.1 transcript:ENSORLT00000024113.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 8.210e-9
Identity = 67/295 (22.71%), Postives = 118/295 (40.00%), Query Frame = 2
Query: 1436 TINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQK----------------------SQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDK------------RIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLP----NECISSQTPKSNSKLH 2206
            + N       H      +K F C  C+KSFS+ + L  H+++H   +  PF+C++C+K F  + +L+ H R    +K                      S   E+    +  N    +Q+  +      ++  +P +C +C   F     L  H ++ H+ E+    C+ C++SF+T   LR H+    G     C    ++   +  L+ +     ++P   K  DK            R +  +K + C  C+ +FST   L  H R           EC +S + +SN K H
Sbjct:   85 SFNQTSNLKRHKRTHTGKKAFPCIECEKSFSTAAHLKTHMRTHTGEK--PFSCKECDKSFNQISNLKTHMRTHTGEKPFFCKECNKSFRQLSNLKTHMTSHTGEKAFTCTECN-TSFNQISNFKTHLRTHTGEKPFSCKNCDKSFRQMSHLRAHMIT-HTGEKA-FSCIECEKSFSTASHLRTHMRTHTGERPFSCKACEKSFSQISHLKIHITHTGEMPFLCKECDKGFGHISNLKTHMRTHTGEKPFPCKECNSSFSTVSNLIRHIRTHTGEKPFSCKECDASFSQRSNLKTH 374          

HSP 2 Score: 51.9878 bits (123), Expect = 2.328e-6
Identity = 57/259 (22.01%), Postives = 100/259 (38.61%), Query Frame = 2
Query: 1487 QKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDK----------------------------------------RIYEFDKDYACDNCHRNFSTGQALGNHKRA 2143
            +K F C+ C KSF+  S+L  H+++H   +  PF C++CNK F  L +L+ H        S   E+    +  N    +Q+  +      ++  +P +C +C   F     L  H ++ H+ E+    C+ C++SF+T   LR H+    G     C    ++   +  L+ +     ++P   K  DK                                        R +  +K ++C  C  +FS    L  H R 
Sbjct:  130 EKPFSCKECDKSFNQISNLKTHMRTHTGEK--PFFCKECNKSFRQLSNLKTH------MTSHTGEKAFTCTECN-TSFNQISNFKTHLRTHTGEKPFSCKNCDKSFRQMSHLRAHMIT-HTGEKA-FSCIECEKSFSTASHLRTHMRTHTGERPFSCKACEKSFSQISHLKIHITHTGEMPFLCKECDKGFGHISNLKTHMRTHTGEKPFPCKECNSSFSTVSNLIRHIRTHTGEKPFSCKECDASFSQRSNLKTHMRT 377          
BLAST of SMED30010458 vs. Planmine SMEST
Match: SMESG000026243.1 (SMESG000026243.1)

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 700/702 (99.72%), Postives = 701/702 (99.86%), Query Frame = 2
Query:  182 MDVSCDPEIICVFCGLEFTSVENVELHINHNHQSSSTDHIENKKTCGIDDYADQTQFDGDFFMAKENKETNLDEVQIKSKSDNSSNDPIKVIQLENREKSDLAXXXXXXXXXXXXXRDPNQVKESIYSDNTRNHRESTILSISETIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFXXXXXXXXXXXDQTFHNXXXXXXXXXXXXXVTQIIHSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSIXXXXXXXXXXXXXXXXXXXXXXXXXLTINANQKFHWHNFDENQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLPNECISSQTPKSNSKLHSIESLIFDNSNIRSTFTNDKNVFLAFN 2287
            MDVSCDPEIICVFCGLEFTSVENVELHINHNHQSSSTDHIENKKTCGIDDYADQTQFDGDFFMAKENKETNLDEVQIKSKSDNSSNDPIKVIQLENREKSDLANP+KSNKPNHSKHRDPNQVKESIYSDNTRNHRESTILSISETIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFLLKKVKLRKRLDQTFHNRKCPKCFKRFFFKVTQIIHSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSISENFESESNPRSPENSSSKNDKSENLTINANQKFHWHNFDENQ KIFQCEVCKKSFSSRSSLSNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLPNECISSQTPKSNSKLHSIESLIFDNSNIRSTFTNDKNVFLAFN
Sbjct:    1 MDVSCDPEIICVFCGLEFTSVENVELHINHNHQSSSTDHIENKKTCGIDDYADQTQFDGDFFMAKENKETNLDEVQIKSKSDNSSNDPIKVIQLENREKSDLANPRKSNKPNHSKHRDPNQVKESIYSDNTRNHRESTILSISETIANLVDNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVTEQSNITSSNSHMYINKPGDISKVHHERDSFLLKKVKLRKRLDQTFHNRKCPKCFKRFFFKVTQIIHSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERMCGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPKTYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSISENFESESNPRSPENSSSKNDKSENLTINANQKFHWHNFDENQLKIFQCEVCKKSFSSRSSLSNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLPNECISSQTPKSNSKLHSIESLIFDNSNIRSTFTNDKNVFLAFN 702          
BLAST of SMED30010458 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 162.155 bits (409), Expect = 4.397e-41
Identity = 99/259 (38.22%), Postives = 150/259 (57.92%), Query Frame = 2
Query: 1481 NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQ--KSQDSEQKIVYS-----------LSNFNGVSQVP----------------IWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYE-------FDKDYACDNCHRNFSTGQALGNHKRACL 2149
            N   +F+C+ C K+F+ RSSLSNHVKSH++ + +PF+C  CN+ F++ L+LQ HR+++C    + ++SEQ++  S            S+F+GVSQVP                ++ + TN N   +  +C+HC+ +F DR  LE+HA  +HSN  G ++C++C RSFTT MA RVH+TKSHG  NG       N   + K  T++ +  +L +   ++             F   +AC NC ++FST QALGNHKRAC+
Sbjct:  492 NADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTN-NLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACM 749          
BLAST of SMED30010458 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 161.77 bits (408), Expect = 5.507e-41
Identity = 99/259 (38.22%), Postives = 150/259 (57.92%), Query Frame = 2
Query: 1481 NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQ--KSQDSEQKIVYS-----------LSNFNGVSQVP----------------IWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYE-------FDKDYACDNCHRNFSTGQALGNHKRACL 2149
            N   +F+C+ C K+F+ RSSLSNHVKSH++ + +PF+C  CN+ F++ L+LQ HR+++C    + ++SEQ++  S            S+F+GVSQVP                ++ + TN N   +  +C+HC+ +F DR  LE+HA  +HSN  G ++C++C RSFTT MA RVH+TKSHG  NG       N   + K  T++ +  +L +   ++             F   +AC NC ++FST QALGNHKRAC+
Sbjct:  479 NADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTN-NLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACM 736          
BLAST of SMED30010458 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 161.77 bits (408), Expect = 5.616e-41
Identity = 99/259 (38.22%), Postives = 150/259 (57.92%), Query Frame = 2
Query: 1481 NQQKIFQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQ--KSQDSEQKIVYS-----------LSNFNGVSQVP----------------IWPNITNINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLPPMPKLETNYHIGDDLPTKKKRKDKRIYE-------FDKDYACDNCHRNFSTGQALGNHKRACL 2149
            N   +F+C+ C K+F+ RSSLSNHVKSH++ + +PF+C  CN+ F++ L+LQ HR+++C    + ++SEQ++  S            S+F+GVSQVP                ++ + TN N   +  +C+HC+ +F DR  LE+HA  +HSN  G ++C++C RSFTT MA RVH+TKSHG  NG       N   + K  T++ +  +L +   ++             F   +AC NC ++FST QALGNHKRAC+
Sbjct:  482 NADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTN-NLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACM 739          
BLAST of SMED30010458 vs. Planmine SMEST
Match: SMESG000040789.1 (SMESG000040789.1)

HSP 1 Score: 131.724 bits (330), Expect = 3.944e-31
Identity = 92/254 (36.22%), Postives = 132/254 (51.97%), Query Frame = 2
Query: 1496 FQCEVCKKXXXXXXXXXNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSEQKIVYSLSNF--NGVSQVPIWPNIT-------NINSVNQPVTCLHCSGVFYDRLELEEHALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQ--NLPPMPKLE-------TNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGNHKRACLNLPNECISSQTPKSNSKL 2203
            F+C  C K+F  RSSLSNH+KSH++ R +PF C DC + F++ +S Q+HR+  C +         +Y  + F  NGV+     P ++         ++ ++  +C+HC+  F DR  LE+HA  +HSNE G I+C+ C RSFTT MA RVH TK+HG  NG     SQ    PP   +        + +H+               +     + C  C ++F T QALGNHKR C  LP   I S+T  S  +L
Sbjct:  675 FECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPK---------LYGTNAFESNGVTSFS-SPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLS-------------TFSSLTRHTCQTCKKDFGTAQALGNHKRVC-ELP---IFSETSVSKDQL 901          
The following BLAST results are available for this feature:
BLAST of SMED30010458 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF913.419e-922.59zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF914.852e-922.59zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF1125.236e-725.11zinc finger protein 112 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1125.382e-725.11zinc finger protein 112 [Source:HGNC Symbol;Acc:HG... [more]
CTCFL6.188e-726.71CCCTC-binding factor like [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010458 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
D19B1.731e-724.60gene:FBgn0022699 transcript:FBtr0077017[more]
CG83193.071e-724.78gene:FBgn0037722 transcript:FBtr0082077[more]
D19A4.852e-625.21gene:FBgn0022935 transcript:FBtr0077016[more]
CG304316.023e-623.17gene:FBgn0050431 transcript:FBtr0085991[more]
back to top
BLAST of SMED30010458 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01066719.12.142e-926.19zinc finger protein 501-like [Source:NCBI gene;Acc... [more]
CU570689.22.393e-926.81si:ch73-266f23.4 [Source:NCBI gene;Acc:571254][more]
CU570689.22.393e-926.81si:ch73-266f23.4 [Source:NCBI gene;Acc:571254][more]
znf10082.765e-926.10zinc finger protein 1008 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch211-161m3.42.803e-927.27si:ch211-161m3.4 [Source:ZFIN;Acc:ZDB-GENE-110914-... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
timm221.879e-926.36translocase of inner mitochondrial membrane 22 hom... [more]
ENSXETT00000054824.11.473e-828.95pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ENSXETT00000054823.11.473e-828.95pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ENSXETT00000054822.11.473e-828.95pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ecsit5.246e-823.08ECSIT signalling integrator [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
9130019O22Rik1.933e-828.89RIKEN cDNA 9130019O22 gene [Source:MGI Symbol;Acc:... [more]
Zfp7083.949e-823.30zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7084.607e-823.30zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7084.940e-823.30zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7886.337e-826.09zinc finger protein 788 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30010458 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05481|ZNF91_HUMAN1.642e-822.59Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=... [more]
sp|P18715|ZG26_XENLA8.004e-729.33Gastrula zinc finger protein XlCGF26.1 (Fragment) ... [more]
sp|P18749|ZO6_XENLA9.854e-722.58Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xe... [more]
sp|Q9UJU3|ZN112_HUMAN2.863e-625.11Zinc finger protein 112 OS=Homo sapiens OX=9606 GN... [more]
sp|Q6IV72|ZN425_HUMAN3.068e-626.73Zinc finger protein 425 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30010458 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q4AR883.742e-929.02Uncharacterized protein OS=Mola mola OX=94237 PE=4... [more]
A0A5A9NB654.604e-929.86Uncharacterized protein OS=Triplophysa tibetana OX... [more]
F6WSD46.385e-923.89Uncharacterized protein OS=Equus caballus OX=9796 ... [more]
A0A5N4AIL42.639e-826.01Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1Y1K9G23.364e-826.01Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf6681.730e-1125.32zinc finger protein 668 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000035193.12.085e-923.81pep primary_assembly:Astyanax_mexicanus-2.0:16:146... [more]
ENSAMXT00000042131.12.250e-925.59pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035399.15.286e-925.42zinc finger protein OZF-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000018704.25.551e-822.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007569.14.785e-924.57pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-... [more]
prdm54.097e-824.37PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000002487.11.235e-725.00pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
ZNF4361.350e-725.00zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000007433.13.558e-623.68pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gen... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010458 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482545.576e-1025.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333402.130e-623.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365373.754e-624.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369585.155e-623.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413585.877e-625.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010458 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028476.11.905e-924.34pep primary_assembly:ASM223467v1:17:10987274:10993... [more]
ENSORLT00000035502.14.240e-925.94pep primary_assembly:ASM223467v1:2:5523992:5689233... [more]
ENSORLT00000038605.15.351e-925.93pep primary_assembly:ASM223467v1:2:11816293:118705... [more]
ENSORLT00000040261.17.211e-924.60pep primary_assembly:ASM223467v1:17:10987144:10993... [more]
ENSORLT00000024113.28.210e-922.71pep primary_assembly:ASM223467v1:2:8030021:8051781... [more]
back to top
BLAST of SMED30010458 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026243.10.000e+099.72SMESG000026243.1[more]
SMESG000065210.14.397e-4138.22SMESG000065210.1[more]
SMESG000065210.15.507e-4138.22SMESG000065210.1[more]
SMESG000065210.15.616e-4138.22SMESG000065210.1[more]
SMESG000040789.13.944e-3136.22SMESG000040789.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010458 ID=SMED30010458|Name=SMED30010458|organism=Schmidtea mediterranea sexual|type=transcript|length=2461bp
ATCGACTACAAACACAATTGAACACCAATAGGATTTGATGTTTTATCATT
CATTCTCCTGCTAACTTCTCATGCAGTTTGGGATTTTATTTTTTGATTAC
AATTAACAATTTACTTTGAATTTTCTCCAAAAATATGCCATAGCTCAAGG
ATATCTTAGAAAAAAACAAATTACCCACAAAATGGATGTATCCTGTGATC
CAGAAATAATTTGCGTATTTTGTGGTCTCGAATTTACGTCTGTAGAAAAT
GTCGAACTGCATATCAATCACAATCATCAATCGAGTAGCACTGATCACAT
TGAAAACAAAAAGACATGTGGTATTGATGATTATGCAGATCAGACACAAT
TTGATGGGGATTTCTTTATGGCGAAAGAAAATAAAGAAACCAATCTAGAT
GAGGTTCAGATCAAATCAAAATCAGATAATTCATCAAATGATCCTATCAA
AGTCATTCAATTGGAAAATCGAGAGAAATCAGATTTGGCAAATCCAAAAA
AGAGTAATAAACCGAATCATTCAAAGCACAGAGATCCCAACCAAGTAAAG
GAGTCCATATATTCAGACAACACGAGAAATCACCGAGAATCTACAATACT
CAGCATATCGGAAACGATTGCCAATCTTGTTGACAACAAGGTTGACAAAG
GAATGAAGAGAAGTCTGCAGTGCCAAAATTGTGAGAAACAATTTACATTG
TCAAATAATTTATCAAGACATCGACGGCTTTACTGTTCGTCCCTGCGAGA
AAATAGTTCCTTCATCCAAAACTGTGTCACTGAACAGAGTAATATCACTT
CATCAAACAGTCATATGTACATCAATAAACCTGGCGACATATCCAAAGTA
CATCATGAGCGAGATTCTTTTCTATTGAAAAAAGTAAAATTACGAAAGAG
GCTGGATCAAACCTTTCATAATCGAAAATGTCCAAAATGTTTTAAGAGAT
TTTTCTTTAAAGTTACTCAAATTATCCATTCTCAAAATCACCAGAGAAAA
CAGAGACACAAATGGAATTGTGAGAAATGTGGATTCAGATATTCCAGAAA
ACGAGTTCTCCTTCAGCATTACGAACGAATGTGTGGAACAAGACATTCTT
CGAATTCCAAACAAAAATCGCTTTTGGAATCTCTACGATGCAATTTCTGT
CAAATGATATTCACAGACCAAATTTACTTAACAATGCATCAGTTGAGAAT
TTGTCATCACTTTATCACCGAAAATCCAAAAACCTACAAAGCTACTGATA
ACGACAAAACAAACACTGAATCCGTTGATGAACCCCAAAAGAAATTGCAG
CAAGATGACAATATTAAAGACCTATCATCCAAATCTTGTTCCACCGAGCA
TTCTATTTCGGAAAACTTCGAAAGTGAATCCAATCCCAGATCACCTGAAA
ATTCATCTAGTAAAAATGACAAATCCGAAAATCTTACAATTAATGCCAAT
CAAAAGTTTCATTGGCATAATTTTGACGAAAATCAGCAAAAGATTTTCCA
ATGCGAAGTATGTAAAAAGAGCTTCTCTAGTCGCAGCTCGCTAAGTAATC
ATGTTAAGTCTCACTACAGCAGTCGTGGTCAACCTTTTACATGTAGGGAT
TGTAATAAAAGGTTTATCAATCTTTTGTCTTTGCAAGACCATCGACGAGA
AATGTGTTCTCAGAAATCTCAAGATTCTGAACAGAAAATTGTTTACAGTT
TGTCTAACTTCAATGGAGTATCTCAAGTACCTATTTGGCCAAATATCACA
AATATCAACTCGGTAAATCAACCAGTCACTTGTTTGCATTGCAGTGGTGT
GTTCTATGATAGATTAGAATTGGAGGAACATGCTTTATCGAAGCATTCCA
ATGAGCAGGGAAATATACTCTGTTTGCTATGTGATAGATCCTTTACGACC
AATATGGCTTTGAGAGTTCATTTAACGAAGTCTCATGGATTTGCAAATGG
CGGTTGCCCTGGTGTTTCCCAAAATTTACCCCCGATGCCGAAGCTGGAAA
CAAATTATCATATTGGAGATGATTTACCAACAAAGAAGAAACGAAAGGAT
AAGCGCATATATGAATTCGACAAGGATTACGCTTGTGATAATTGTCACAG
AAATTTTAGTACTGGGCAAGCTTTGGGAAATCACAAAAGAGCTTGTTTAA
ATTTGCCAAATGAATGTATATCAAGCCAAACTCCCAAATCCAACTCGAAA
CTTCATTCAATCGAATCGCTGATTTTCGACAACTCGAATATACGTTCGAC
CTTTACCAACGACAAAAATGTATTTTTGGCCTTTAATTGACTTGTAAATT
AATTTCAAATAGTGGTGTTGTTTTTTTTATATACTTTGGTTTCAATGTTC
AATGTTGTCCATTTGTCTCTTTCCTATTTATAGTTGGTTCATGTTTCGAC
CAATAAACCTTTATTTGCTATTCAACTTCCTTCCTACTCACGACTTCTAT
TTCAAACCGGA
back to top

protein sequence of SMED30010458-orf-1

>SMED30010458-orf-1 ID=SMED30010458-orf-1|Name=SMED30010458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=703bp
MDVSCDPEIICVFCGLEFTSVENVELHINHNHQSSSTDHIENKKTCGIDD
YADQTQFDGDFFMAKENKETNLDEVQIKSKSDNSSNDPIKVIQLENREKS
DLANPKKSNKPNHSKHRDPNQVKESIYSDNTRNHRESTILSISETIANLV
DNKVDKGMKRSLQCQNCEKQFTLSNNLSRHRRLYCSSLRENSSFIQNCVT
EQSNITSSNSHMYINKPGDISKVHHERDSFLLKKVKLRKRLDQTFHNRKC
PKCFKRFFFKVTQIIHSQNHQRKQRHKWNCEKCGFRYSRKRVLLQHYERM
CGTRHSSNSKQKSLLESLRCNFCQMIFTDQIYLTMHQLRICHHFITENPK
TYKATDNDKTNTESVDEPQKKLQQDDNIKDLSSKSCSTEHSISENFESES
NPRSPENSSSKNDKSENLTINANQKFHWHNFDENQQKIFQCEVCKKSFSS
RSSLSNHVKSHYSSRGQPFTCRDCNKRFINLLSLQDHRREMCSQKSQDSE
QKIVYSLSNFNGVSQVPIWPNITNINSVNQPVTCLHCSGVFYDRLELEEH
ALSKHSNEQGNILCLLCDRSFTTNMALRVHLTKSHGFANGGCPGVSQNLP
PMPKLETNYHIGDDLPTKKKRKDKRIYEFDKDYACDNCHRNFSTGQALGN
HKRACLNLPNECISSQTPKSNSKLHSIESLIFDNSNIRSTFTNDKNVFLA
FN*
back to top
Aliases
The feature 'SMED30010458' has the following synonyms
Synonym
Znf91
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 278..305
e-value: 32.0
score: 8.8
coord: 532..555
e-value: 1.3
score: 18.0
coord: 248..270
e-value: 30.0
score: 9.0
coord: 162..182
e-value: 46.0
score: 7.4
coord: 469..489
e-value: 15.0
score: 11.7
coord: 562..585
e-value: 0.33
score: 20.0
coord: 318..342
e-value: 1.9
score: 17.5
coord: 439..461
e-value: 9.5E-5
score: 31.8
coord: 633..653
e-value: 100.0
score: 4.3
coord: 9..32
e-value: 2.7
score: 17.0
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 320..342
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 441..461
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 11..32
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 534..555
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 250..270
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 564..585
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 439..466
score: 12.882
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 633..653
score: 8.746
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 162..190
score: 9.743
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 469..496
score: 9.91
NoneNo IPR availablePFAMPF13912zf-C2H2_6coord: 633..653
e-value: 3.8E-5
score: 23.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 428..506
e-value: 4.2E-12
score: 48.0
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 439..461
e-value: 7.5E-5
score: 23.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 527..589
e-value: 3.1E-7
score: 32.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 75..132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..91
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 379..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..378
NoneNo IPR availablePANTHERPTHR24388FAMILY NOT NAMEDcoord: 358..675
coord: 10..338
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 437..489