cell division cycle and apoptosis regulator protein 1

Overview
Namecell division cycle and apoptosis regulator protein 1 (AKG62100.1)
Smed IDSMED30010457
Length (bp)2679
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cell division cycle and apoptosis regulator protein 1 (SMED30010457) t-SNE clustered cells

Violin plots show distribution of expression levels for cell division cycle and apoptosis regulator protein 1 (SMED30010457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cell division cycle and apoptosis regulator protein 1 (SMED30010457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cell division cycle and apoptosis regulator protein 1 (SMED30010457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010457SMESG000052430.1 SmedASXL_012808SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010457SMESG000052430.1 SmedASXL_012808SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010457SMESG000052430.1 dd_Smed_v4_1608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010457SMESG000052430.1 Contig39071newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010457SMESG000052430.1 Contig39071uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010457SMESG000052430.1 SMESG000052429.1 SMESG000028489.1 Contig11107newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010457SMESG000052430.1 SMESG000052429.1 SMESG000028489.1 Contig11107uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30010457SMESG000052430.1 dd_Smed_v6_1608_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 236.884 bits (603), Expect = 9.775e-67
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  167 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 475          

HSP 2 Score: 95.1301 bits (235), Expect = 2.159e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  526 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 599          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 235.343 bits (599), Expect = 3.686e-65
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  336 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 644          

HSP 2 Score: 95.9005 bits (237), Expect = 1.467e-19
Identity = 44/75 (58.67%), Postives = 56/75 (74.67%), Query Frame = -1
Query:  973 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPD 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P+
Sbjct:  695 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLPE 769          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 238.424 bits (607), Expect = 7.579e-65
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  347 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 655          

HSP 2 Score: 95.1301 bits (235), Expect = 3.308e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  706 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 779          

HSP 3 Score: 60.8474 bits (146), Expect = 1.231e-8
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = -1
Query:  658 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKE 939
            +P  + EK   K++MI  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    E + ++   L+E
Sbjct:  891 RPSKDKEK--EKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDEENHEESESLQE 982          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 238.424 bits (607), Expect = 9.073e-65
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  362 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 670          

HSP 2 Score: 95.1301 bits (235), Expect = 3.165e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  721 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 794          

HSP 3 Score: 60.8474 bits (146), Expect = 1.174e-8
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = -1
Query:  658 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKE 939
            +P  + EK   K++MI  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    E + ++   L+E
Sbjct:  906 RPSKDKEK--EKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDEENHEESESLQE 997          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 237.269 bits (604), Expect = 1.147e-64
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  347 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 655          

HSP 2 Score: 95.1301 bits (235), Expect = 3.069e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  706 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 779          

HSP 3 Score: 60.8474 bits (146), Expect = 1.275e-8
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = -1
Query:  658 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKE 939
            +P  + EK   K++MI  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    E + ++   L+E
Sbjct:  891 RPSKDKEK--EKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDEENHEESESLQE 982          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 139.813 bits (351), Expect = 1.667e-33
Identity = 75/200 (37.50%), Postives = 121/200 (60.50%), Query Frame = -1
Query: 1771 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQE-EVLEPSDVNYTHSAKVMLMTMPNLADLY-KATCNLSGASTN----TKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGI 2352
            YE +A +       +S S L+ RY K+Y+PSD+      W   F L  ++ L N  +F + +KDV+    +E + L+P D ++ H  KV+L++    +++  KA C ++  +T+     +SL KN+ FLVG++GK E + IGG WSPS DG +P+  ++ ++ TA+R  K+LTGIDLS   +W+  ++I YYR AD+Q I
Sbjct:  320 YECRAQKPALLSPIVSGSVLRHRYSKLYLPSDYVDLSFDWVRSFQLDLSLDLSNPIQFHVFNKDVDFIGEEEIQDLDPEDADHRHQVKVLLLSHAGKSEVVKKAFCLMADGTTDDHQEPQSLLKNLHFLVGARGK-ETMGIGGSWSPSQDGADPNS-ATTMIRTAVRTTKSLTGIDLSSVSQWFSMVQIRYYR-ADKQRI 516          

HSP 2 Score: 114.005 bits (284), Expect = 1.723e-25
Identity = 70/206 (33.98%), Postives = 107/206 (51.94%), Query Frame = -1
Query:  706 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTAD----------SVEPS-SKKPKLETEKV-------------------------------IRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITD 1197
            Y+L     ILV P+K+ K GKF+C +L+L +L++YR DD KE+ FEVSLF E F EM++R+AAF I+++L+   D  A+           VEP   K+P   TEK                                I    ++A+  +  +F +FD + CGYL + D+E+I++      SR Q++KL  K+ + R  + YR +TD
Sbjct:  772 YQLPKDKKILVFPSKSFKSGKFDCKVLSLSSLLDYRHDDNKENQFEVSLFAEAFKEMIERNAAFTIYETLANCGDRDAEKKRRDEAREKPVEPKEPKEPAETTEKAAEGEEKKDEKEEKRDEKKDEKREEKREKVERIDLKSVVANRTVYEAFSLFDSNLCGYLTEKDIEEILYNGEFGISRGQIQKLAKKL-SVRDKINYRHLTD 976          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 137.117 bits (344), Expect = 3.641e-33
Identity = 75/200 (37.50%), Postives = 121/200 (60.50%), Query Frame = -1
Query: 1771 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQE-EVLEPSDVNYTHSAKVMLMTMPNLADLY-KATCNLSGASTN----TKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGI 2352
            YE +A +       +S S L+ RY K+Y+PSD+      W   F L  ++ L N  +F + +KDV+    +E + L+P D ++ H  KV+L++    +++  KA C ++  +T+     +SL KN+ FLVG++GK E + IGG WSPS DG +P+  ++ ++ TA+R  K+LTGIDLS   +W+  ++I YYR AD+Q I
Sbjct:  320 YECRAQKPALLSPIVSGSVLRHRYSKLYLPSDYVDLSFDWVRSFQLDLSLDLSNPIQFHVFNKDVDFIGEEEIQDLDPEDADHRHQVKVLLLSHAGKSEVVKKAFCLMADGTTDDHQEPQSLLKNLHFLVGARGK-ETMGIGGSWSPSQDGADPNS-ATTMIRTAVRTTKSLTGIDLSSVSQWFSMVQIRYYR-ADKQRI 516          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 123.25 bits (308), Expect = 3.009e-29
Identity = 68/185 (36.76%), Postives = 110/185 (59.46%), Query Frame = -1
Query: 1816 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQE-EVLEPSDVNYTHSAKVMLMTMPNLADLY-KATCNLSGASTN----TKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYK 2352
            YE +A +       +S S L+ RY K+Y+PSD+      W   F L  ++ L N  +F + +KDV+    +E + L+P D ++ H  KV+L++    +++  KA C ++  +T+     +SL KN+ FLVG++GK E + IGG WSPS DG +P+  ++ ++ TA+R  K+LTGIDLS   +W K
Sbjct:  320 YECRAQKPALLSPIVSGSVLRHRYSKLYLPSDYVDLSFDWVRSFQLDLSLDLSNPIQFHVFNKDVDFIGEEEIQDLDPEDADHRHQVKVLLLSHAGKSEVVKKAFCLMADGTTDDHQEPQSLLKNLHFLVGARGK-ETMGIGGSWSPSQDGADPNS-ATTMIRTAVRTTKSLTGIDLSSVSQWRK 502          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 123.25 bits (308), Expect = 3.009e-29
Identity = 68/185 (36.76%), Postives = 110/185 (59.46%), Query Frame = -1
Query: 1816 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQE-EVLEPSDVNYTHSAKVMLMTMPNLADLY-KATCNLSGASTN----TKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYK 2352
            YE +A +       +S S L+ RY K+Y+PSD+      W   F L  ++ L N  +F + +KDV+    +E + L+P D ++ H  KV+L++    +++  KA C ++  +T+     +SL KN+ FLVG++GK E + IGG WSPS DG +P+  ++ ++ TA+R  K+LTGIDLS   +W K
Sbjct:  320 YECRAQKPALLSPIVSGSVLRHRYSKLYLPSDYVDLSFDWVRSFQLDLSLDLSNPIQFHVFNKDVDFIGEEEIQDLDPEDADHRHQVKVLLLSHAGKSEVVKKAFCLMADGTTDDHQEPQSLLKNLHFLVGARGK-ETMGIGGSWSPSQDGADPNS-ATTMIRTAVRTTKSLTGIDLSSVSQWRK 502          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 115.546 bits (288), Expect = 1.932e-26
Identity = 70/206 (33.98%), Postives = 107/206 (51.94%), Query Frame = -1
Query:  706 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADS----------VEPSS-KKPKLETEKV-------------------------------IRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITD 1197
            Y+L     ILV P+K+ K GKF+C +L+L +L++YR DD KE+ FEVSLF E F EM++R+AAF I+++L+   D  A+           VEP   K+P   TEK                                I    ++A+  +  +F +FD + CGYL + D+E+I++      SR Q++KL  K+ + R  + YR +TD
Sbjct:  148 YQLPKDKKILVFPSKSFKSGKFDCKVLSLSSLLDYRHDDNKENQFEVSLFAEAFKEMIERNAAFTIYETLANCGDRDAEKKRRDEAREKPVEPKEPKEPAETTEKAAEGEEKKDEKEEKRDEKKDEKREEKREKVERIDLKSVVANRTVYEAFSLFDSNLCGYLTEKDIEEILYNGEFGISRGQIQKLAKKL-SVRDKINYRHLTD 352          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 237.269 bits (604), Expect = 1.351e-64
Identity = 131/333 (39.34%), Postives = 192/333 (57.66%), Query Frame = -1
Query: 1366 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEK 2352
            Y V+  + + D        L+ RY  +YIPSDFF+    W + FPL R    GN+  F I+HK+V+       VL+P D N+T+SAKVML+  P+L +LY  +C LS      +      ++ I+FLVG +GK+E +AIGG WSPSLDG +P+ D+SVL+ TA+R CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F+P++W C+P   EW E+    +++L+  +  +  E   E+  + K  ++ K         +   +S     +KV +L+ EL SR L +KG+KSQLI RL + L  E+
Sbjct:  366 YTVQFSKFSLDGYNCDMMELRRRYQSLYIPSDFFNAVFTWVDAFPLSRPFTFGNYCNFHIMHKEVDSLVKNTAVLDPPDANHTYSAKVMLLANPSLDELYHKSCALSEDPAELRDSFQHPARLIKFLVGMRGKDEAMAIGGHWSPSLDGADPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFLPDVWHCLPTRSEWEELSRGLKEQLAEKLLAERKEADGEQEEEDKDEDDSKEVTTPTHWSKLDPKS-----MKVSDLRKELESRSLSSKGLKSQLIARLTKQLKVEE 678          

HSP 2 Score: 97.4413 bits (241), Expect = 3.660e-20
Identity = 43/74 (58.11%), Postives = 57/74 (77.03%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD  + I+K+L+ +P
Sbjct:  726 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLP 799          

HSP 3 Score: 61.6178 bits (148), Expect = 4.056e-9
Identity = 48/154 (31.17%), Postives = 83/154 (53.90%), Query Frame = -1
Query:  493 RKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF----------EECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLV 909
            +K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K P  + +  YR++TD+   E      A++ E    ID L+    GN+             E  ++  +I+ +G L     +M KL  +E  + D E +L+
Sbjct:  922 KKRQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNK-PLVKESCHYRKLTDRPKDEPCP---ALISEAH--IDNLL----GNQILLTSQKIKREPDESGESGSLIVYKGALVDVGSMMQKLEKSEKTREDIEQKLM 1065          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 237.269 bits (604), Expect = 1.520e-64
Identity = 131/333 (39.34%), Postives = 192/333 (57.66%), Query Frame = -1
Query: 1366 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEK 2352
            Y V+  + + D        L+ RY  +YIPSDFF+    W + FPL R    GN+  F I+HK+V+       VL+P D N+T+SAKVML+  P+L +LY  +C LS      +      ++ I+FLVG +GK+E +AIGG WSPSLDG +P+ D+SVL+ TA+R CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F+P++W C+P   EW E+    +++L+  +  +  E   E+  + K  ++ K         +   +S     +KV +L+ EL SR L +KG+KSQLI RL + L  E+
Sbjct:  402 YTVQFSKFSLDGYNCDMMELRRRYQSLYIPSDFFNAVFTWVDAFPLSRPFTFGNYCNFHIMHKEVDSLVKNTAVLDPPDANHTYSAKVMLLANPSLDELYHKSCALSEDPAELRDSFQHPARLIKFLVGMRGKDEAMAIGGHWSPSLDGADPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFLPDVWHCLPTRSEWEELSRGLKEQLAEKLLAERKEADGEQEEEDKDEDDSKEVTTPTHWSKLDPKS-----MKVSDLRKELESRSLSSKGLKSQLIARLTKQLKVEE 714          

HSP 2 Score: 97.8265 bits (242), Expect = 3.475e-20
Identity = 43/74 (58.11%), Postives = 57/74 (77.03%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD  + I+K+L+ +P
Sbjct:  762 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLP 835          

HSP 3 Score: 62.003 bits (149), Expect = 2.936e-9
Identity = 48/154 (31.17%), Postives = 83/154 (53.90%), Query Frame = -1
Query:  493 RKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF----------EECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLV 909
            +K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K P  + +  YR++TD+   E      A++ E    ID L+    GN+             E  ++  +I+ +G L     +M KL  +E  + D E +L+
Sbjct:  958 KKRQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNK-PLVKESCHYRKLTDRPKDEPCP---ALISE--AHIDNLL----GNQILLTSQKIKREPDESGESGSLIVYKGALVDVGSMMQKLEKSEKTREDIEQKLM 1101          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 236.113 bits (601), Expect = 3.128e-64
Identity = 132/333 (39.64%), Postives = 186/333 (55.86%), Query Frame = -1
Query: 1366 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEK 2352
            Y V+  + + D        L+ RY  +YIPSDFF+    W + FPL R    GN+  F I+HK+V+       VL+P D N+T+SAKVML+  P+L +LY  +C LS      +      ++ I+FLVG +GK+E +AIGG WSPSLDG +P+ D+SVL+ TA+R CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F+P++W C+P   EW E+    +++L     T A     EE  D    +E                  +   +KV +L+ EL SR L +KG+KSQLI RL + L  E+
Sbjct:  366 YTVQFSKFSLDGYNCDMMELRRRYQSLYIPSDFFNAVFTWVDAFPLSRPFTFGNYCNFHIMHKEVDSLVKNTAVLDPPDANHTYSAKVMLLANPSLDELYHKSCALSEDPAELRDSFQHPARLIKFLVGMRGKDEAMAIGGHWSPSLDGADPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFLPDVWHCLPTRSEWEELSRGLKEQLLLFQKTSASRSCEEEDKDEDDSKEVTTPTHWSKL--------DPKSMKVSDLRKELESRSLSSKGLKSQLIARLTKQLKVEE 675          

HSP 2 Score: 97.4413 bits (241), Expect = 3.782e-20
Identity = 43/74 (58.11%), Postives = 57/74 (77.03%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD  + I+K+L+ +P
Sbjct:  723 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLP 796          

HSP 3 Score: 61.6178 bits (148), Expect = 4.123e-9
Identity = 48/154 (31.17%), Postives = 83/154 (53.90%), Query Frame = -1
Query:  493 RKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF----------EECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLV 909
            +K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K P  + +  YR++TD+   E      A++ E    ID L+    GN+             E  ++  +I+ +G L     +M KL  +E  + D E +L+
Sbjct:  919 KKRQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNK-PLVKESCHYRKLTDRPKDEPCP---ALISEAH--IDNLL----GNQILLTSQKIKREPDESGESGSLIVYKGALVDVGSMMQKLEKSEKTREDIEQKLM 1062          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar2 (cell cycle and apoptosis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-091204-207])

HSP 1 Score: 140.969 bits (354), Expect = 7.392e-34
Identity = 81/224 (36.16%), Postives = 115/224 (51.34%), Query Frame = -1
Query: 1633 LKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL---SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIR 2295
            L+ RYP ++IPS  FH  L W E FPL + + L     F I     E ++   +V E +D  +  + +V+L +MP L D+Y   CNLS      K     S  ++FL+   G  + L  GG WSP  DG NP +DS  LVNTA+R  K   G+DLS C +WYK  E+ Y           SGD               +VE VV+ +P++W+ +P+E EWA ++
Sbjct:  214 LQRRYPHLHIPSSLFHLQLSWTESFPLDQPLPLRGPCLFHIGPNQPETEA---DVCESTDDAF--AVRVLLFSMPCLEDVYSQCCNLSNDGQTQKEAVHPSTLLKFLIVDSGGEQRLP-GGHWSPEADGANPAKDSLTLVNTAVRCLKEQAGLDLSACTQWYKMAELRYL----------SGD---------------KVETVVVLMPDVWNLVPSEEEWASLQ 406          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar2 (cell cycle and apoptosis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-091204-207])

HSP 1 Score: 132.109 bits (331), Expect = 4.499e-31
Identity = 80/224 (35.71%), Postives = 114/224 (50.89%), Query Frame = -1
Query: 1633 LKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL---SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIR 2295
            L+ RYP ++IPS  FH  L W E FPL + + L     F I     E ++   +V E +D  +  + +V+L +MP L D+Y   CNLS      K     S  ++FL+   G  + L  GG WSP  DG NP +DS  LVNTA+R  K   G+DLS C + YK  E+ Y           SGD               +VE VV+ +P++W+ +P+E EWA ++
Sbjct:  214 LQRRYPHLHIPSSLFHLQLSWTESFPLDQPLPLRGPCLFHIGPNQPETEA---DVCESTDDAF--AVRVLLFSMPCLEDVYSQCCNLSNDGQTQKEAVHPSTLLKFLIVDSGGEQRLP-GGHWSPEADGANPAKDSLTLVNTAVRCLKEQAGLDLSACTQ-YKMAELRYL----------SGD---------------KVETVVVLMPDVWNLVPSEEEWASLQ 405          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000015244.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 243.817 bits (621), Expect = 1.041e-66
Identity = 130/329 (39.51%), Postives = 193/329 (58.66%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+  S   +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  336 YTVQFSKFSLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDSVEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCRGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 644          

HSP 2 Score: 91.6633 bits (226), Expect = 3.348e-18
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  695 YVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 768          

HSP 3 Score: 67.781 bits (164), Expect = 7.892e-11
Identity = 53/212 (25.00%), Postives = 100/212 (47.17%), Query Frame = -1
Query:  286 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTI 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++             L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ L   K+S     D   +Y   L +   N+  +++ I
Sbjct:  892 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDTFHYDILGNCSLLPSKTARTGLSATEDKGGLIVYKGAMVDIGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNKNLSEELKQTKDDLGHLKDSLKAAEDKSSLYEDQLTNTIKNLSAAMEEI 1102          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030629.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 243.817 bits (621), Expect = 1.198e-66
Identity = 130/329 (39.51%), Postives = 193/329 (58.66%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+  S   +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  321 YTVQFSKFSLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDSVEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCRGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 629          

HSP 2 Score: 91.6633 bits (226), Expect = 3.440e-18
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  680 YVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 753          

HSP 3 Score: 67.781 bits (164), Expect = 7.155e-11
Identity = 53/212 (25.00%), Postives = 100/212 (47.17%), Query Frame = -1
Query:  286 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTI 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++             L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ L   K+S     D   +Y   L +   N+  +++ I
Sbjct:  877 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDTFHYDILGNCSLLPSKTARTGLSATEDKGGLIVYKGAMVDIGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNKNLSEELKQTKDDLGHLKDSLKAAEDKSSLYEDQLTNTIKNLSAAMEEI 1087          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030635.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 243.817 bits (621), Expect = 1.321e-66
Identity = 130/329 (39.51%), Postives = 193/329 (58.66%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+  S   +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  341 YTVQFSKFSLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDSVEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCRGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 649          

HSP 2 Score: 91.6633 bits (226), Expect = 3.152e-18
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  700 YVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 773          

HSP 3 Score: 67.781 bits (164), Expect = 6.944e-11
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = -1
Query:  283 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTIN 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++             L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ L   K+S     D   +Y   L +   N+  +++ I 
Sbjct:  891 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDTFHYDILGNCSLLPSKTARTGLSATEDKGGLIVYKGAMVDIGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNKNLSEELKQTKDDLGHLKDSLKAAEDKSSLYEDQLTNTIKNLSAAMEEIQ 1102          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030679.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 243.432 bits (620), Expect = 1.635e-66
Identity = 130/329 (39.51%), Postives = 193/329 (58.66%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+  S   +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  367 YTVQFSKFSLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDSVEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCRGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 675          

HSP 2 Score: 92.0485 bits (227), Expect = 3.043e-18
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  726 YVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 799          

HSP 3 Score: 68.5514 bits (166), Expect = 4.421e-11
Identity = 56/223 (25.11%), Postives = 103/223 (46.19%), Query Frame = -1
Query:  253 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVI 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++             L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ L   K+S     D   +Y   L +   N+  +++ I     K  L I
Sbjct:  888 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDTFHYDILGNCSLLPSKTARTGLSATEDKGGLIVYKGAMVDIGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNKNLSEELKQTKDDLGHLKDSLKAAEDKSSLYEDQLTNTIKNLSAAMEEIQVVLNKVSLSI 1109          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030665.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 243.432 bits (620), Expect = 1.640e-66
Identity = 130/329 (39.51%), Postives = 193/329 (58.66%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+  S   +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  367 YTVQFSKFSLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDSVEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCRGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 675          

HSP 2 Score: 91.6633 bits (226), Expect = 3.376e-18
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  726 YVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 799          

HSP 3 Score: 67.781 bits (164), Expect = 7.800e-11
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = -1
Query:  283 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTIN 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++             L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ L   K+S     D   +Y   L +   N+  +++ I 
Sbjct:  917 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDTFHYDILGNCSLLPSKTARTGLSATEDKGGLIVYKGAMVDIGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNKNLSEELKQTKDDLGHLKDSLKAAEDKSSLYEDQLTNTIKNLSAAMEEIQ 1128          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 241.121 bits (614), Expect = 7.982e-66
Identity = 132/332 (39.76%), Postives = 188/332 (56.63%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTD---APEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       VL+P D ++ +SAKVMLM  P++ DLY  +C L+    + +      ++ ++FLVG KGK+E +AIGG WSPSLDGPNP++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +   A  E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  359 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKD--------DGEVKEIATPTHWSKLDPKAMKVNDLRKELESRALSSKGLKSQLIARLTKQL 667          

HSP 2 Score: 95.1301 bits (235), Expect = 2.263e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  718 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 3 Score: 60.077 bits (144), Expect = 1.352e-8
Identity = 62/241 (25.73%), Postives = 120/241 (49.79%), Query Frame = -1
Query:  283 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF-------EECDTQE---MILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTK----IKSIQNDAGVVEANLKE---SIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTIN 939
            +P  + EK   K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    + + ++   L+E     D L     GN+          E  D +E   +I+  G +     L+ KL  +E  + + E +L  ++++  +    I +++N    +   L+E    + ++QE LE  +  +L+  + +      L +  D++   +K  N
Sbjct:  902 RPAKDKEK--EKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDDENHEESEALQE-----DML-----GNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKDN 1129          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 241.121 bits (614), Expect = 7.982e-66
Identity = 132/332 (39.76%), Postives = 188/332 (56.63%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTD---APEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       VL+P D ++ +SAKVMLM  P++ DLY  +C L+    + +      ++ ++FLVG KGK+E +AIGG WSPSLDGPNP++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +   A  E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  359 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKD--------DGEVKEIATPTHWSKLDPKAMKVNDLRKELESRALSSKGLKSQLIARLTKQL 667          

HSP 2 Score: 95.1301 bits (235), Expect = 2.263e-19
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  718 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 3 Score: 60.077 bits (144), Expect = 1.352e-8
Identity = 62/241 (25.73%), Postives = 120/241 (49.79%), Query Frame = -1
Query:  283 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF-------EECDTQE---MILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTK----IKSIQNDAGVVEANLKE---SIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTIN 939
            +P  + EK   K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    + + ++   L+E     D L     GN+          E  D +E   +I+  G +     L+ KL  +E  + + E +L  ++++  +    I +++N    +   L+E    + ++QE LE  +  +L+  + +      L +  D++   +K  N
Sbjct:  902 RPAKDKEK--EKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDDENHEESEALQE-----DML-----GNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKDN 1129          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Match: Ccar2 (cell cycle activator and apoptosis regulator 2 [Source:MGI Symbol;Acc:MGI:2444228])

HSP 1 Score: 138.658 bits (348), Expect = 5.010e-33
Identity = 81/241 (33.61%), Postives = 119/241 (49.38%), Query Frame = -1
Query: 1645 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQIL-HKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATC----NLSGASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEW 2352
            Y V     T D        L+ RY  + +PSDF   HL W   FPL +   L + S  Q+   K+   D+  E    P D + T+S+KV+L++ P L + Y+       +++      +   K ++FL+G K + E + +GG WSPSLDG +P  D  VLV TAIR  +A TGIDLS C KW++F E  Y +P           G   + H            VV+++P++W+ MP   EW
Sbjct:  224 YRVHLTPYTVDSPTCDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLGQPFSLHHPSRIQVSSEKEAAPDTGAEP--SPEDSDPTYSSKVLLLSSPGLEEFYRCCMLFVDDMAEPRETPEHPLKQLKFLLGRK-EEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSTCTKWWRFAEFQYLQP-----------GPPRQLH-----------TVVVYLPDVWTIMPTLEEW 439          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q8CH18|CCAR1_MOUSE (Cell division cycle and apoptosis regulator protein 1 OS=Mus musculus OX=10090 GN=Ccar1 PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.583e-65
Identity = 132/332 (39.76%), Postives = 188/332 (56.63%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTD---APEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       VL+P D ++ +SAKVMLM  P++ DLY  +C L+    + +      ++ ++FLVG KGK+E +AIGG WSPSLDGPNP++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +   A  E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  359 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKD--------DGEVKEIATPTHWSKLDPKAMKVNDLRKELESRALSSKGLKSQLIARLTKQL 667          

HSP 2 Score: 95.1301 bits (235), Expect = 1.583e-18
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  718 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 3 Score: 60.077 bits (144), Expect = 9.455e-8
Identity = 62/241 (25.73%), Postives = 120/241 (49.79%), Query Frame = -1
Query:  283 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF-------EECDTQE---MILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTK----IKSIQNDAGVVEANLKE---SIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTIN 939
            +P  + EK   K +M+  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    + + ++   L+E     D L     GN+          E  D +E   +I+  G +     L+ KL  +E  + + E +L  ++++  +    I +++N    +   L+E    + ++QE LE  +  +L+  + +      L +  D++   +K  N
Sbjct:  902 RPAKDKEK--EKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDDENHEESEALQE-----DML-----GNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKDN 1129          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q641G3|CCAR1_XENLA (Cell division cycle and apoptosis regulator protein 1 OS=Xenopus laevis OX=8355 GN=ccar1 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.712e-65
Identity = 129/329 (39.21%), Postives = 191/329 (58.05%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  +   D     T  L+ RY  +YIPSDFF     W + FP+ R  +LGN+S F I+HK+V+       +++P D ++T+SAKVML+  P+L +LY  +C L+      +      ++ I+FLVG KGK+E +AIGG WSPSLDGPNPD+D SVL+ TA+R CKALTGI+LS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  D      +E +  +  E+ +  + K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  369 YTVQISKFCLDCPGCDTMELRRRYQNLYIPSDFFDAQFTWVDAFPISRPFQLGNYSNFYIMHKEVDPLEKNTAIVDPPDADHTYSAKVMLLASPSLEELYHKSCALAEDPIEVREGFQHPARLIKFLVGMKGKDEAMAIGGHWSPSLDGPNPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWENLCHGYKQQLVDKLQGDR-----KEADGEQEEEDKEDGDAKEISTPTHWSKLDPKIMKVNDLRKELESRTLSSKGLKSQLIARLTKQL 677          

HSP 2 Score: 92.8189 bits (229), Expect = 9.319e-18
Identity = 41/74 (55.41%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN +AK GKF+C+I++L  L++YR++D KEH FEVSLF E FNEMLQRD    I++ L  +P
Sbjct:  728 YMLPDEPAIIVHPNWSAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLALP 801          

HSP 3 Score: 66.2402 bits (160), Expect = 1.141e-9
Identity = 53/212 (25.00%), Postives = 100/212 (47.17%), Query Frame = -1
Query:  286 RKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNL----ELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTI 909
            +K  +  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL +KI  K  +L YR++TD    +GS ++   L         L+             D   +I+ +G +     L+ KL  +E  + + E +L  ++ +  + +   +       NL E + + ++ +   K+S     D   +Y   L +   N+  ++  I
Sbjct:  925 KKQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDPLHNDILGNCSLLPSKAVRTGLSTVEDKGGLIVYKGAMVDVGSLLQKLEKSEKTRTELEHRLQTLESKTEEDEKTISQLEASNRNLSEELKQTKDDVGHLKDSLKAAEDTRSLYEDQLTNTIKNLSAAMGEI 1135          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q8IX12|CCAR1_HUMAN (Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 4.357e-64
Identity = 130/332 (39.16%), Postives = 187/332 (56.33%), Query Frame = -1
Query: 1378 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPE---EVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEAL 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +LGN+  F ++H++VE       +L+P D ++ +SAKVMLM  P++ DLY  +C L+      +      ++ ++FLVG KGK+E +AIGG WSPSLDGP+P++D SVL+ TAIR CKALTGIDLS C +WY+F EI Y+RP              EE+H+  +   A VE VV+F P++W C+P   EW  +   ++++L   +  +  E   E  EE  D          E K +         +   +KV +L+ EL SR L +KG+KSQLI RL + L
Sbjct:  362 YTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKD--------DGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQL 670          

HSP 2 Score: 95.1301 bits (235), Expect = 1.520e-18
Identity = 44/74 (59.46%), Postives = 55/74 (74.32%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD    I+KSL  +P
Sbjct:  721 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 794          

HSP 3 Score: 60.8474 bits (146), Expect = 5.636e-8
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = -1
Query:  658 KPKLETEKVIRKSKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKE 939
            +P  + EK   K++MI  +  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL++K+   R +  YR++TD    E + ++   L+E
Sbjct:  906 RPSKDKEK--EKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKV-VLRESCFYRKLTDTSKDEENHEESESLQE 997          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q5R8S0|CCAR2_PONAB (Cell cycle and apoptosis regulator protein 2 OS=Pongo abelii OX=9601 GN=CCAR2 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.455e-34
Identity = 77/222 (34.68%), Postives = 118/222 (53.15%), Query Frame = -1
Query: 1645 LKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQIL-HKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATC----NLSGASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEW 2295
            L+ RY  + +PSDF   HL W   FPL +   L + S  Q+   K+   D+  E +  P+D +  +S+KV+L++ P L +LY+       +++      +   K I+FL+G K + E + +GG WSPSLDG +P  D  VLV TAIR  +A TGIDLS C KW++F E  Y +P   +                      R++ VV+++P++W+ MP   EW
Sbjct:  243 LQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPI--PADSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRK-EEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPR----------------------RLQTVVVYLPDVWTIMPTLEEW 439          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q8N163|CCAR2_HUMAN (Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 3.468e-33
Identity = 78/222 (35.14%), Postives = 116/222 (52.25%), Query Frame = -1
Query: 1645 LKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQIL-HKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATC----NLSGASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEW 2295
            L+ RY  + +PSDF   HL W   FPL +   L + S  Q+   K+   D+  E +   SD  Y  S+KV+L++ P L +LY+       +++      +   K I+FL+G K + E + +GG WSPSLDG +P  D  VLV TAIR  +A TGIDLS C KW++F E  Y +P   +                      R++ VV+++P++W+ MP   EW
Sbjct:  243 LQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPITADSDPAY--SSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRK-EEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPR----------------------RLQTVVVYLPDVWTIMPTLEEW 439          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A0F7GWU0 (Cell division cycle and apoptosis regulator protein 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 514/514 (100.00%), Postives = 514/514 (100.00%), Query Frame = -1
Query:  148 FIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIXXXXXXXXXXXXXXXXXXXXXXXXXXKSWQVVDQV 1689
            FIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIKIVEEPKLEEEKVVEEQASEESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTIEPENAEVIEEEKEAVAEHPTPVVEEPKKTEESKELSEKERKRIEKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIEEAKAKEEAEKKMEVEEVKEPEVNEDKSWQVVDQV
Sbjct:    5 FIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIKIVEEPKLEEEKVVEEQASEESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTIEPENAEVIEEEKEAVAEHPTPVVEEPKKTEESKELSEKERKRIEKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIEEAKAKEEAEKKMEVEEVKEPEVNEDKSWQVVDQV 518          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A0X3P415 (SAP domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR124013 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 8.261e-136
Identity = 283/792 (35.73%), Postives = 437/792 (55.18%), Query Frame = -1
Query:  274 VGYRDENYKRERKDFQGGXXXXXXXXXXXXPYQRSHDSHGDF--RRDTK-----KSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVD-SYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLS--GASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQ----------NLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPD-------------STADSVEPSSKKPKLETEKV---------IRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFF----EECDTQEMILREG-NLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQF 2508
             GYRD+ Y+R R D++GG+R +          +R H  H  F  R+D +     +S G YEVK PR+  +IK  +    KL +P + IP DF      WQ+ FP++  MKLG  ++  I+H+DVE   ++     +  D +Y++S +VMLM  P LA+LYK TC  +    S +  + +KNI FLVG + K E + IGGPWSPSLDG NPD +   L+NT++R  KA TGIDLS   +W +F+EI YYR A+ +        E EE   ++   E + E VV  IP I   MP + EW + +  +   L  L+++  PE+  +   +    E  +  +  + E Q    S           +++ +KV +L+AEL++R LD KGVK+ L+ RLQ AL++EK   V E    E                   P     +  EE KE+SEK+R+R+E+LY+L D P+ILV PN+ A+GG+F+C+ ++L +L+ Y+  +QKEH FEVSLF EQF+EMLQRD AF IFK++   P+             S   S EP +K+ + E+E           +R+ +   D  LLFSF  +D  N G++RD+DL DI+H + L +S++Q++KL++K+  +R ++QYR +TDK+++EG  +DV  LK  +   + L +L+ GN   F     +  ++ +++  G + +L+ ++  AE  K   E Q   IKDEL K +   N     E  L+     +Q +L+ E++S      ++  YN +LK + D M  ++  I+ QF
Sbjct:   55 AGYRDDPYRRPRDDYRGGKRPKGKSPMGD---KRPH--HDTFVPRKDNRPVKRPQSSGHYEVKVPRMPLNIKSATFLEAKLLHPHLSIPGDFSKACFSWQDAFPMHEPMKLGTKTDIYIVHRDVESHVTHPPNPFDAPDADYSYSVRVMLMASPELAELYKNTCRFADESNSVDKTAATKNIYFLVGGRTKTETMGIGGPWSPSLDGENPDTNPQTLINTSVRTFKAFTGIDLSSVTEWTRFMEIRYYRCANSKAPTLV---EDEEERDIL---EDKQEVVVFMIPNISHLMPPDSEWEKTKQLYADSLQKLLASPEPEKTDDPTKEEPEAEVSQTVDTTLDESQEVTVSADGEPTHYSKLDVNTMKVTDLRAELAARNLDIKGVKANLLARLQTALEEEKKADVGEPRPEETPKTAEDTPT--------KPAAPSGQPKEELKEISEKDRRRLERLYRLGDKPAILVFPNRAARGGRFDCHRVSLHSLLNYQSGEQKEHNFEVSLFAEQFHEMLQRDCAFNIFKAIYSAPEKDPKEAKPEQNGVSRDGSDEPEAKRKRNESESSQTNEDEAGKVRRLRRTVDPKLLFSFVYYDSGNSGFIRDYDLVDILHLLNLAYSKAQMKKLVAKVTTRRDHVQYRNLTDKDIVEGDVNDVVSLKLEENDPEFLRDLAAGNDLLFGGEKPQVPSKAVVVGSGDDAQLLQRVQTAEEIKRSTEFQFFQIKDELEKTRIKLNSCKDTEEKLRSENRDLQNRLKEEQKSSRDNKVLVSTYNHLLKHSRDMMSNAVGEIDKQF 827          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A074ZMB5 (SAP domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_07827 PE=4 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 1.107e-133
Identity = 285/805 (35.40%), Postives = 446/805 (55.40%), Query Frame = -1
Query:  265 YGGRVGYRDENYKR-----------ERKDFQGGXXXXXXXXXXXXPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVD-SYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL--SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEV----IEEVNDIXXXXXXXXXXXXXXXXXXXXESQ------NLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADS---------------VEPSSKKPKLET---------EKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVE-LSKGNKAFFEECDTQ---EMILREGNLE-LMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKE 2520
            YGG   YR+ENY R           +R   +G       P       +R H S G  +R T    G+YEVK P+  F+IK    S L+  YP++ + +DF+     W + FP++   KLGN +++ + H+DV+        +L P D +Y++SA+VMLM  P LA+LYK TC+++   + T  +   KNI FLVG + K+E +AIGGPWSPS+DG +P  D   L+NTAIR  K  TG+DLS C +W +F+EI YYR AD +    +GD   +E   V +E   R E VV FIP     +P++ EWA+++  +   L +L+S +   EV      +V D++        ++       S+         + + LKV EL+ EL++R LDTKG+K  L+ RLQ ALD+EK   + EEN    +               P       +  +ESK+LSEKER+R+E+LY+LND P+I++ PNK+A+GG+F+C+ ++L +L++YR ++QKE  FEVSLF EQF+EMLQRD AF IFK++++ P+    S                EP  K+ + E          E  +R+ +      LLF+F  +D  + GY+R+HDL +I+H +GL +S++Q+R+L++K+  +R ++QY ++TD ++ EG + DV  +K  +    ++V+ L+ GN+A F+    Q   ++IL  G+   +  +L  AE  +   E Q   IKDEL K ++  N     E  L+     +  +L+ E++   +   +   Y+ +L++A D +   +  IN QFEKE
Sbjct:   49 YGG---YREENYGRRSDRRDDFRGGKRGPPKGRSPVEKRPFHDAPAPRRDHRSFG--KRQT--PFGKYEVKIPKALFNIKTRGFSELRHNYPRLNVATDFYECESTWCDSFPMHSPFKLGNATDYHVFHRDVDPPVPADTNLLNPPDADYSYSARVMLMACPQLAELYKNTCHMADDVSGTDKVPPGKNIHFLVGGRAKSETMAIGGPWSPSMDGADPCGDPRTLINTAIRTFKGYTGLDLSSCTEWIRFMEIRYYRFADTKAPAFTGD---DEERLVTTE---RPEVVVFFIPNASHLIPSDEEWAKVKEHYSSVLQALLSPEQKPEVEATPGADVPDVETSVVDASMDDGDEAGTRSDMEPTHYSKLDANSLKVNELRNELAARNLDTKGLKVNLVARLQAALDEEKKADIPEENKTAEDTKAEET---------PAKATTPTQSKDESKDLSEKERRRLERLYRLNDKPAIIIHPNKSARGGRFDCHRVSLFSLLDYRTEEQKEQNFEVSLFAEQFHEMLQRDCAFTIFKAINDAPEKEHKSEQDGKLENGIEDEEEKEPDVKRRRNEGPGSIEHEGDEPKVRRLRRTTQPDLLFAFSYYDLGHSGYIREHDLAEILHLLGLRYSKAQMRRLVTKVVTRRDHVQYHQLTDSDITEGDDKDVVTIKAAEAEDIEVVKMLALGNRALFDAEQPQVPAKIILGGGDSRAITQRLEKAEELRRAMEYQFFRIKDELEKTRTQLNSFKDTEDELRAENRDLNSRLKTEQKQLHEHRSLSGTYHHLLRNARDQLDRVLFDINKQFEKE 831          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A3R7ERD5 (Cell division cycle and apoptosis regulator protein 1 OS=Clonorchis sinensis OX=79923 GN=ccar1 PE=4 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 3.698e-132
Identity = 284/805 (35.28%), Postives = 446/805 (55.40%), Query Frame = -1
Query:  265 YGGRVGYRDENYKR-----------ERKDFQGGXXXXXXXXXXXXPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVD-SYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL--SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIE---------EVNDIXXXXXXXXXXXXXXXXXXXXESQ-NLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADS---------------VEPSSKKPKLET---------EKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVE-LSKGNKAFFEECDTQ---EMILREGNLE-LMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKE 2520
            YGG   YR+ENY R           +R   +G       P       +R H S G  +R T    G+YEVK P+  F+IK    S L+  YP++ + +DF+     W + FP++   KLGN +++ + H+DV+        +L P D +Y++SA+VMLM  P LA+LYK TC+++   + T  +   KNI FLVG + K+E +AIGGPWSPS+DG +P  D   L+NTAIR  K  TG+DLS C +W +F+EI YYR AD +    +GD   +E   V +E   R E VV FIP     +P++ EWA+++  +   L +L+S +   EV           E + +    +   E     + + +  S+ + + LKV EL+ EL++R LDTKG+K  L+ RLQ ALD+EK     EE     ++              P       +  +ESK+LSEKER+R+E+LY+LND P+I++ PNK+A+GG+F+C+ ++L +L++YR ++QKE  FEVSLF EQF+EMLQRD AF IFK++++ P+    S                EP  K+ + E          E  +R+ +      LLF+F  +D  + GY+R+HDL +I+H +GL +S++Q+R+L++K+  +R ++QY ++TD ++ EG + DV  +K  +    ++V+ L+ GN+A F+    Q   ++IL  G+   +  +L  AE  +   E Q   IKDEL K ++  N     E  L+     +  +L+ E++   +   +   Y+ +L++A D +   +  IN QFEKE
Sbjct:   22 YGG---YREENYGRRSDRRDDFRGGKRGPPKGRSPVEKRPFHDAPAPRRDHRSFG--KRQT--PFGKYEVKIPKALFNIKTRGFSELRHNYPRLNVATDFYECESTWCDSFPMHSPFKLGNATDYHVFHRDVDPPVPADTNLLNPPDADYSYSARVMLMACPQLAELYKNTCHMADDVSGTDKVPPGKNIHFLVGGRAKSETMAIGGPWSPSMDGADPCGDPRTLINTAIRTFKGYTGLDLSSCTEWIRFMEIRYYRFADTKAPAFTGD---DEERLVTTE---RPEVVVFFIPNASHLIPSDEEWAKVKEHYTSVLQALLSPEQKPEVEATPGADATEVETSVVDASMDDGDEAGTRSDMEPTHYSKLDANSLKVNELRNELAARNLDTKGLKVNLVARLQAALDEEKKADTPEETKAAEDSKAEET---------PAKATTPTQSKDESKDLSEKERRRLERLYRLNDKPAIIIHPNKSARGGRFDCHRVSLFSLLDYRTEEQKEQNFEVSLFAEQFHEMLQRDCAFTIFKAINDAPEKEHKSEQDGKLENGIEDEEEKEPDVKRRRNEGSGSLEHEGDEPKVRRLRRTTQPDLLFAFSYYDLGHSGYIREHDLAEILHLLGLRYSKAQMRRLVTKVVTRRDHVQYHQLTDSDITEGDDKDVVTIKAAETEDIEVVKMLALGNRALFDAEQPQVPAKIILGGGDSRAITQRLEKAEELRRAMEYQFFRIKDELEKTRTQLNSFKDTEDELRAENRDLNSRLKTEQKQLHEHRSLSGTYHHLLRNARDQLDRVLFDINKQFEKE 804          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: H2KVI9 (Cell division cycle and apoptosis regulator protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_112465 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 6.806e-132
Identity = 284/805 (35.28%), Postives = 446/805 (55.40%), Query Frame = -1
Query:  265 YGGRVGYRDENYKR-----------ERKDFQGGXXXXXXXXXXXXPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVD-SYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL--SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIE---------EVNDIXXXXXXXXXXXXXXXXXXXXESQ-NLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADS---------------VEPSSKKPKLET---------EKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVE-LSKGNKAFFEECDTQ---EMILREGNLE-LMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKE 2520
            YGG   YR+ENY R           +R   +G       P       +R H S G  +R T    G+YEVK P+  F+IK    S L+  YP++ + +DF+     W + FP++   KLGN +++ + H+DV+        +L P D +Y++SA+VMLM  P LA+LYK TC+++   + T  +   KNI FLVG + K+E +AIGGPWSPS+DG +P  D   L+NTAIR  K  TG+DLS C +W +F+EI YYR AD +    +GD   +E   V +E   R E VV FIP     +P++ EWA+++  +   L +L+S +   EV           E + +    +   E     + + +  S+ + + LKV EL+ EL++R LDTKG+K  L+ RLQ ALD+EK     EE     ++              P       +  +ESK+LSEKER+R+E+LY+LND P+I++ PNK+A+GG+F+C+ ++L +L++YR ++QKE  FEVSLF EQF+EMLQRD AF IFK++++ P+    S                EP  K+ + E          E  +R+ +      LLF+F  +D  + GY+R+HDL +I+H +GL +S++Q+R+L++K+  +R ++QY ++TD ++ EG + DV  +K  +    ++V+ L+ GN+A F+    Q   ++IL  G+   +  +L  AE  +   E Q   IKDEL K ++  N     E  L+     +  +L+ E++   +   +   Y+ +L++A D +   +  IN QFEKE
Sbjct:   40 YGG---YREENYGRRSDRRDDFRGGKRGPPKGRSPVEKRPFHDAPAPRRDHRSFG--KRQT--PFGKYEVKIPKALFNIKTRGFSELRHNYPRLNVATDFYECESTWCDSFPMHSPFKLGNATDYHVFHRDVDPPVPADTNLLNPPDADYSYSARVMLMACPQLAELYKNTCHMADDVSGTDKVPPGKNIHFLVGGRAKSETMAIGGPWSPSMDGADPCGDPRTLINTAIRTFKGYTGLDLSSCTEWIRFMEIRYYRFADTKAPAFTGD---DEERLVTTE---RPEVVVFFIPNASHLIPSDEEWAKVKEHYTSVLQALLSPEQKPEVEATPGADATEVETSVVDASMDDGDEAGTRSDMEPTHYSKLDANSLKVNELRNELAARNLDTKGLKVNLVARLQAALDEEKKADTPEETKAAEDSKAEET---------PAKATTPTQSKDESKDLSEKERRRLERLYRLNDKPAIIIHPNKSARGGRFDCHRVSLFSLLDYRTEEQKEQNFEVSLFAEQFHEMLQRDCAFTIFKAINDAPEKEHKSEQDGKLENGIEDEEEKEPDVKRRRNEGSGSLEHEGDEPKVRRLRRTTQPDLLFAFSYYDLGHSGYIREHDLAEILHLLGLRYSKAQMRRLVTKVVTRRDHVQYHQLTDSDITEGDDKDVVTIKAAETEDIEVVKMLALGNRALFDAEQPQVPAKIILGGGDSRAITQRLEKAEELRRAMEYQFFRIKDELEKTRTQLNSFKDTEDELRAENRDLNSRLKTEQKQLHEHRSLSGTYHHLLRNARDQLDRVLFDINKQFEKE 822          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Cavefish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 327.02 bits (837), Expect = 5.098e-96
Identity = 230/630 (36.51%), Postives = 335/630 (53.17%), Query Frame = -1
Query:  703 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSL----SKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP----------------------------DSTADSVEPSSKKP-----KLETEKVIRK------------------------------------------SKMIA-DMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDK 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R    GN+  F I+HK+V+       VL+P D N+T+SAKVML+  P+L +LY  +C L+      +      ++ I+FLVG +GK+E +AIGG WSPSLDG +P+ D+SVL+ TAIR CKALTGIDLS C + Y+F EI Y+RP              EE+H+  +   A VE VV+F+P++W C+P   EW  +    +++L+  +  +  E   E+  + K  ++ K         +   +S     +KV +L+ EL SR L +KG+KSQLI RL + L  E+    VEE+    +      EE+E       P  EE ++ EE K   E+ER+R E+ Y L D P+I+V PN  AK GKF+C+I++L  L++YRL+D KEH FEVSLF E FNEMLQRD  F I+K+L+ +P                            D   D+ EPS+KK      K   E+V++K                                           +M+  D  LL +F  FD  +CGYL + DLE+I++ +GL+ SR+QV+KL+++ P  R +  YR++TD+
Sbjct:  350 YTVQFSKFSLDGYSCDMMELRRRYQSLYIPSDFFDAVFTWVDAFPLSRPFTFGNYCNFHIMHKEVDSLVKNTAVLDPPDANHTYSAKVMLLATPSLEELYHKSCALAEDPQELRDTFQHPARLIKFLVGMRGKDEAMAIGGHWSPSLDGADPENDASVLIKTAIRCCKALTGIDLSLCTQ-YRFAEIRYHRP--------------EETHKGRT-VPAHVETVVLFLPDVWHCLPTRSEWEGLSRGLKEQLAEKLLAERKEADGEQEEEEKDDDDSKEVTTPTHWSKLDPKS-----MKVNDLRKELESRTLSSKGLKSQLIARLTKQLKVEEQ---VEESKEPEKTESAGVEEEE------PPRAEEDREEEERKRQEEQERQRRERRYVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGFRIYKALASLPSKDERKEKKEKAKKEAERKEVERRDAKKDREEDNGEPSTKKQREDEDKRRKERVLKKEESKDEDDNEDESSNNNADEYDPMEVEDADDYDDDDGTDEKKKQMVTFDKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNR-PVVRESCYYRKLTDR 948          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Cavefish
Match: ccar2 (cell cycle and apoptosis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-091204-207])

HSP 1 Score: 94.7449 bits (234), Expect = 1.565e-19
Identity = 64/230 (27.83%), Postives = 100/230 (43.48%), Query Frame = -1
Query: 1645 KELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLS------GASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEW 2316
            + L +  L+ RYP ++ P   FH  L W E FP  + + L     F +     E      E  + +D  ++    VML++MP + + Y   C  S      GA+ +  +L +    L  +     P   GG WSP LDG NP  + S L+ TA+R  K  T +DL+ C + +K  E+             +GD               + E VVI +P++W+ +P   EW
Sbjct:  196 QALDSLELQRRYPHLHAPPSLFHVQLCWPEGFPPSQPLPLAGPCIFHVGTSQPETTMDTSESTDSADSGFS----VMLLSMPGIKEFYSQCCGCSEDGQARGAAVHPITLLRLFLLLEKAGELQLP---GGQWSPKLDGANPSNNVSSLIRTAVRCVKEQTALDLTACTQ-HKIAELRLL----------NGD---------------KTETVVILLPDVWNLVPTAEEW 392          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 242.662 bits (618), Expect = 4.107e-68
Identity = 133/327 (40.67%), Postives = 188/327 (57.49%), Query Frame = -1
Query: 1390 RYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVE-VDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSG----ASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERL 2355
            RY V+  R + D        L+ RY  +YIPSDFF T   W E FP+ R   LG    F ++HK+VE + +     LEPSDVN+ +SAK  L+  P+L ++Y+ +C L+     A    +  ++ I+FLVG KGK+E +AIGGPWSPSLDGPNPD D SVL+ TA+R  +ALTGIDLS C +WY+F EI Y+RP              EE H+   +  ARVE VVIF+P++W C P  +EW  +   ++++L+   S  A +EV  E +D       + +E   +         +   +KV  L+ EL  R ++ KG+KSQL+ RL
Sbjct:  361 RYTVEFSRFSLDCAGCDLMELRRRYQNLYIPSDFFDTQFTWVEAFPMARPFALGQTCSFHVMHKEVEPLHAGDSASLEPSDVNHLYSAKFYLIASPSLDEIYQKSCVLAEVLDEAKETFQHPARLIKFLVGQKGKDEAMAIGGPWSPSLDGPNPDMDPSVLIKTAVRCTRALTGIDLSTCTQWYRFAEIRYHRP--------------EELHKG-RKVAARVETVVIFLPDVWHCTPTRLEWEALSRGYKQQLTG-KSQAANKEVDGEQDD------EEKDENGKLTTPTHHSKLDPKTMKVSSLRKELEVRSMNAKGLKSQLVARL 665          

HSP 2 Score: 98.2117 bits (243), Expect = 3.217e-21
Identity = 42/74 (56.76%), Postives = 57/74 (77.03%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L + PSI+V PN+TAK GKF+C++++L  L++YR++D KEH FEVSLF E FNEMLQRD  F I+++L   P
Sbjct:  719 YTLPEMPSIIVHPNRTAKSGKFDCSVMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGFRIYRALMAAP 792          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 243.047 bits (619), Expect = 4.279e-68
Identity = 133/327 (40.67%), Postives = 188/327 (57.49%), Query Frame = -1
Query: 1390 RYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVE-VDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSG----ASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERL 2355
            RY V+  R + D        L+ RY  +YIPSDFF T   W E FP+ R   LG    F ++HK+VE + +     LEPSDVN+ +SAK  L+  P+L ++Y+ +C L+     A    +  ++ I+FLVG KGK+E +AIGGPWSPSLDGPNPD D SVL+ TA+R  +ALTGIDLS C +WY+F EI Y+RP              EE H+   +  ARVE VVIF+P++W C P  +EW  +   ++++L+   S  A +EV  E +D       + +E   +         +   +KV  L+ EL  R ++ KG+KSQL+ RL
Sbjct:  373 RYTVEFSRFSLDCAGCDLMELRRRYQNLYIPSDFFDTQFTWVEAFPMARPFALGQTCSFHVMHKEVEPLHAGDSASLEPSDVNHLYSAKFYLIASPSLDEIYQKSCVLAEVLDEAKETFQHPARLIKFLVGQKGKDEAMAIGGPWSPSLDGPNPDMDPSVLIKTAVRCTRALTGIDLSTCTQWYRFAEIRYHRP--------------EELHKG-RKVAARVETVVIFLPDVWHCTPTRLEWEALSRGYKQQLTG-KSQAANKEVDGEQDD------EEKDENGKLTTPTHHSKLDPKTMKVSSLRKELEVRSMNAKGLKSQLVARL 677          

HSP 2 Score: 98.2117 bits (243), Expect = 3.221e-21
Identity = 42/74 (56.76%), Postives = 57/74 (77.03%), Query Frame = -1
Query:  976 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMP 1197
            Y L + PSI+V PN+TAK GKF+C++++L  L++YR++D KEH FEVSLF E FNEMLQRD  F I+++L   P
Sbjct:  731 YTLPEMPSIIVHPNRTAKSGKFDCSVMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGFRIYRALMAAP 804          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Medaka
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:101158378])

HSP 1 Score: 171.4 bits (433), Expect = 5.706e-45
Identity = 84/181 (46.41%), Postives = 114/181 (62.98%), Query Frame = -1
Query: 1822 YEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKS----LSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKW 2352
            Y V+  + + D        L+ RY  +YIPSDFF     W + FPL R  +L N   F ILHK+V+       VL+P DVN+T+SAKVML+  P+L +LY  +C L+      +      ++ I+FLVG +GK+E +AIGG WSPSLDG +P++D +VL+ TAIR CKALTGIDLS C +W
Sbjct:  362 YTVQFSKFSLDGTSCDLMELRRRYQSLYIPSDFFDAVFTWVDAFPLTRPFQLSNSCNFHILHKEVDSFVKNTAVLDPPDVNHTYSAKVMLLANPSLEELYHKSCALAEDPQELRESFQHPARLIKFLVGMRGKDEAMAIGGHWSPSLDGADPEQDPAVLIKTAIRCCKALTGIDLSLCTQW 542          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Match: SMESG000052430.1 (SMESG000052430.1)

HSP 1 Score: 1421.76 bits (3679), Expect = 0.000e+0
Identity = 825/827 (99.76%), Postives = 827/827 (100.00%), Query Frame = -1
Query:  148 MANRNWRSGGNYQSFNQLLXXXXXXXXXXYSNERKNYGGRVGYRDENYKRERKDFQGGXXXXXXXXXXXXPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIXXXXXXXXXXXXXXXXXXXXESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTXXXXXXXXXXXXXXXXXEHPXXXXXXXXXXXXXXXXXXXXXXXXXXLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIXXXXXXXXXXXXXXXXXXXXXXXXXXKSWQVVDQV 2628
            MANRNWRSGGNYQSFNQLLNPMPYYPPMNYSNERKNYGGRVGYRDENYKRERKDFQGGRRDRISPNRRRSPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSG+STNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIKIVEEPKLEEEKVVEEQASEESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTIEPENAEVIEEEKEAVAEHPTPVVEEPKKTEESKELSEKERKR+EKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIEEAKAKEEAEKKMEVEEVKEPEVNEDKSWQVVDQV
Sbjct:    1 MANRNWRSGGNYQSFNQLLNPMPYYPPMNYSNERKNYGGRVGYRDENYKRERKDFQGGRRDRISPNRRRSPYQRSHDSHGDFRRDTKKSHGRYEVKAPRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGSSTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEEVIEEVNDIKIVEEPKLEEEKVVEEQASEESQNLSQLKVVELKAELSSRGLDTKGVKSQLIERLQEALDKEKGKTVVEENTIEPENAEVIEEEKEAVAEHPTPVVEEPKKTEESKELSEKERKRLEKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIEEAKAKEEAEKKMEVEEVKEPEVNEDKSWQVVDQV 827          
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Match: SMESG000034433.1 (SMESG000034433.1)

HSP 1 Score: 219.164 bits (557), Expect = 8.903e-59
Identity = 112/263 (42.59%), Postives = 163/263 (61.98%), Query Frame = -1
Query: 1600 PRLTFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEFQILHKDVE-VDSYQEEVL----EPSDVNYTHSAKVMLMTMPNLADLYKATCNLSGA--STNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKE----------ESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLI 2337
            P  +F ++EL  ++LK R   +  P+ FFH  L++Q+ FPL   MKLGN   F++L + V+ +D++  + L    +P D + T SAKVML++   LA+ YK T  L+    S N   ++K I+FLVG+ G N+  A GG WSPSLDG +PD +  VL+NTAIR CK LTGIDLS C  W KFLEIHYYRP   Q I +  DG ++          ES +     E R+E VV ++P+IW+C+P++  W +I   ++++L+SL+
Sbjct:  279 PMESFALRELDCAALKFRCKNLQPPNQFFHVSLKYQQTFPLNHPMKLGNACHFKVLDRKVKSIDNFINDQLNRDIDPEDADTTFSAKVMLLSTAELAEFYKQTLILAEEFDSNNKIPITKAIKFLVGNTGPNKEFAFGGAWSPSLDGADPDTNPRVLINTAIRTCKNLTGIDLSGCSSWPKFLEIHYYRPL--QKIQRKTDGGQDMAKCDNKMETESEERFEYIEPRMETVVYYVPDIWNCVPSQESWNDIVRMYKEQLTSLM 539          

HSP 2 Score: 106.301 bits (264), Expect = 5.225e-23
Identity = 76/221 (34.39%), Postives = 117/221 (52.94%), Query Frame = -1
Query:  538 YKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTADSVEP-SSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKL 1197
            Y L D P I+V  N   + GK     ++L +L+ Y      E  FEV+LF  QF EML+RDA F ++KSL   P+S   S E  S+KKPKL    ++  SK   +  LLFS  + D +    +   DL+ +I  +G+  S  Q+  LI+K+      L YR +TDKE+ + +   + ++ ++   +D + EL+ GNKA F   D    I    ++E +D+L
Sbjct:  692 YSLPDDPHIIVHHNNKHQDGKIRIKTMSLHSLLSYYDMKFDEATFEVALFARQFLEMLRRDAVFNVYKSLVITPESDFVSKEENSAKKPKL----MVTTSKRTINRPLLFSCTILDKERTNKISLDDLKGLIEGLGICLSSDQLSALINKVKESSKCLNYRLLTDKEIDDNNMSKMLII-DQTDDLDYIRELAMGNKALF---DDGIAIDSSADMEEIDRL 904          
The following BLAST results are available for this feature:
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCAR19.775e-6739.16cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR13.686e-6539.16cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR17.579e-6539.16cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR19.073e-6539.16cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR11.147e-6439.16cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccar-11.667e-3337.50CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
ccar-13.641e-3337.50CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
ccar-13.009e-2936.76CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
ccar-13.009e-2936.76CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
ccar-11.932e-2633.98CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccar11.351e-6439.34cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar11.520e-6439.34cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar13.128e-6439.64cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar27.392e-3436.16cell cycle and apoptosis regulator 2 [Source:ZFIN;... [more]
ccar24.499e-3135.71cell cycle and apoptosis regulator 2 [Source:ZFIN;... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000015244.11.041e-6639.51cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030629.11.198e-6639.51cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030635.11.321e-6639.51cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030679.11.635e-6639.51cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030665.11.640e-6639.51cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccar17.982e-6639.76cell division cycle and apoptosis regulator 1 [Sou... [more]
Ccar17.982e-6639.76cell division cycle and apoptosis regulator 1 [Sou... [more]
Ccar25.010e-3333.61cell cycle activator and apoptosis regulator 2 [So... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CH18|CCAR1_MOUSE5.583e-6539.76Cell division cycle and apoptosis regulator protei... [more]
sp|Q641G3|CCAR1_XENLA5.712e-6539.21Cell division cycle and apoptosis regulator protei... [more]
sp|Q8IX12|CCAR1_HUMAN4.357e-6439.16Cell division cycle and apoptosis regulator protei... [more]
sp|Q5R8S0|CCAR2_PONAB9.455e-3434.68Cell cycle and apoptosis regulator protein 2 OS=Po... [more]
sp|Q8N163|CCAR2_HUMAN3.468e-3335.14Cell cycle and apoptosis regulator protein 2 OS=Ho... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWU00.000e+0100.00Cell division cycle and apoptosis regulator protei... [more]
A0A0X3P4158.261e-13635.73SAP domain-containing protein OS=Schistocephalus s... [more]
A0A074ZMB51.107e-13335.40SAP domain protein OS=Opisthorchis viverrini OX=61... [more]
A0A3R7ERD53.698e-13235.28Cell division cycle and apoptosis regulator protei... [more]
H2KVI96.806e-13235.28Cell division cycle and apoptosis regulator protei... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccar15.098e-9636.51cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar21.565e-1927.83cell cycle and apoptosis regulator 2 [Source:ZFIN;... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccar14.107e-6840.67cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar14.279e-6840.67cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccar15.706e-4546.41cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000052430.10.000e+099.76SMESG000052430.1[more]
SMESG000034433.18.903e-5942.59SMESG000034433.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010457
GenBankAKG62100.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010457 ID=SMED30010457|Name=cell division cycle and apoptosis regulator protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2679bp
TGGAAACATTTATTTATTAAAATTCAATGTACAGAAACATACGTAAAACT
ACTACGTGTATGGGTTGACCTCAAATTCAATAACAACGAACTGTAAGAGC
CGAATATATTATTAAATATAAAACGATACACCAAAACAATCACATTAAAC
TTGGTCAACGACTTGCCAGCTTTTATCTTCATTCACTTCCGGTTCTTTAA
CTTCTTCAACCTCCATTTTTTTCTCTGCTTCTTCTTTAGCTTTGGCCTCT
TCGATAACCAACCTTTCCTTCTCGAACTGATCATTGATAGTTTTTATTGA
AAGTCCCATATTGTCTGTTGCAGATTTCAGGATGGAATTGTAGACCTTTA
TAACGTCGGATAATTTCAAATGGGATTCTTTTTCTGCTTCCAATTTCTCT
TGAACTTTGTGAATGCTTTCTTTTAAATTAGCTTCAACAACTCCGGCATC
ATTTTGAATAGATTTTATTTTTGTCAATTCATCCTTAATGAACACCAATT
GTGATTCGTAATCAACTTTCTTGTTTTCTGCAGCGCACAATTTATCCATA
AGTTCTAAATTGCCCTCTCTCAAAATCATTTCTTGGGTATCGCATTCTTC
GAAAAACGCTTTATTGCCTTTTGATAATTCAACAAGTTTATCTATAACAC
ATTTTCTCTCTTTCAAAACTGCAACATCATCTTCACTTCCTTCAATAACT
TCTTTGTCGGTTATTTCACGATATTGCAAATTTCCCCTTTTATTGGGAAT
CTTGGATATTAATTTCCTTACTTGAGACCTTGAAAAATTCAATCCAATGC
AGTGAATAATATCTTCCAAATCGTGATCCCTCAGATAACCACAATTATCA
AAGTCGAATACACAGAAAGAAAACAACAAATGCATATCAGCGATCATTTT
GGATTTTCTAATCACTTTTTCGGTTTCTAACTTGGGTTTTTTCGAGGATG
GTTCTACGGAATCAGCAGTAGAATCAGGCATTTCAGACAAGCTTTTGAAT
ATATAAAAAGCCGCATCTCTCTGCAACATTTCGTTAAACTGTTCAACAAA
TAAAGATACCTCAAAAATGTGTTCTTTCTGATCATCAAGTCTATATTCCA
TTAAATTTTCAAGTGTCAATATATTGCATTCAAACTTCCCGCCTTTTGCA
GTTTTATTTGGTAAAACCAAAATGGATGGAGTATCATTTAACTTATAAAG
TTTTTCTATTCGTTTTCGTTCTTTTTCTGATAATTCCTTCGATTCTTCAG
TCTTTTTTGGCTCTTCAACAACGGGTGTAGGATGTTCAGCTACGGCTTCT
TTCTCTTCTTCGATAACCTCGGCATTTTCTGGTTCAATTGTGTTTTCTTC
GACAACTGTCTTGCCTTTTTCCTTATCAAGCGCTTCTTGTAATCTTTCAA
TTAGTTGGCTTTTTACTCCTTTCGTATCAAGACCTCTTGAACTCAATTCA
GCTTTTAATTCAACAACTTTCAATTGAGATAAATTTTGACTTTCCTCACT
TGCTTGTTCTTCAACAACCTTTTCCTCTTCAAGCTTCGGTTCTTCTACTA
TCTTAATGTCATTAACTTCTTCAATTACTTCTTCTGGAGCATCAGTTGAT
ATTAAACTTGATAGTTTCTTTTCAAAAGTTGCTCTAATTTCTGCCCATTC
AATTTCATTTGGCATACAAGACCAAATTTCAGGAATAAAAATAACCACCT
TTTCAACTCTAGCTTCCGTTTCACTTATAACTTGATGTGATTCCTCCTTT
TCGCCATCTCCTGATTGCACAATTCCTTGGCGATCAGCTGGTCGATAGTA
ATGAATTTCCAGAAATTTATACCATTTCTTGCATTTAGACAAGTCTATTC
CTGTCAATGCTTTACAATTACGAATTGCAGTGTTTACTAAAACCGAAGAA
TCTTCATCTGGATTTGGACCATCCAAACTTGGTGACCAAGGACCCCCAAT
GGCTAATGGTTCATTTTTACCCTTTGAACCGACTAGAAACTGGATATTTT
TGCTCAGAGATTTTGTATTTGTTGAAGCTCCTGATAAATTACACGTAGCT
TTGTACAAATCAGCCAAATTAGGCATGGTCATTAGCATAACTTTTGCCGA
ATGAGTGTAATTTACATCAGAAGGTTCCAGAACTTCTTCTTGGTAACTAT
CGACTTCCACATCTTTGTGAAGAATCTGAAACTCAGAATGATTACCCAAT
TTCATTGTTCGATAAAGTGGAAAGACTTCTTGCCATCTCAAATGAGTGTG
AAAGAAGTCAGATGGTATATACATTTTCGGATAACGAAGCTTAAGGGAAG
ATGTCGATAGTTCTTTGATATCGAAAGTTAAGCGAGGGGCTTTAACTTCA
TAGCGCCCATGAGATTTCTTAGTATCTCTACGAAAATCCCCGTGAGAATC
ATGTGACCTTTGATAAGGTGATCTTCGTCTATTAGGACTGATACGGTCTC
GACGACCACCTTGAAAGTCTTTTCTTTCACGTTTATAATTTTCATCCCGA
TACCCAACTCTTCCACCATAATTTTTTCTTTCATTCGAATAATTCATTGG
TGGGTAATAAGGCATAGGGTTTAAAAGTTGGTTGAACGATTGGTAATTAC
CTCCAGAACGCCAATTTCGATTCGCCATATTTAATTTAAGAGAAACTAAG
TGATATTATTAATATAAATTAAATAAAAT
back to top

protein sequence of SMED30010457-orf-1

>SMED30010457-orf-1 ID=SMED30010457-orf-1|Name=SMED30010457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=828bp
MANRNWRSGGNYQSFNQLLNPMPYYPPMNYSNERKNYGGRVGYRDENYKR
ERKDFQGGRRDRISPNRRRSPYQRSHDSHGDFRRDTKKSHGRYEVKAPRL
TFDIKELSTSSLKLRYPKMYIPSDFFHTHLRWQEVFPLYRTMKLGNHSEF
QILHKDVEVDSYQEEVLEPSDVNYTHSAKVMLMTMPNLADLYKATCNLSG
ASTNTKSLSKNIQFLVGSKGKNEPLAIGGPWSPSLDGPNPDEDSSVLVNT
AIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQGIVQSGDGEKEESHQV
ISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKLSSLISTDAPEE
VIEEVNDIKIVEEPKLEEEKVVEEQASEESQNLSQLKVVELKAELSSRGL
DTKGVKSQLIERLQEALDKEKGKTVVEENTIEPENAEVIEEEKEAVAEHP
TPVVEEPKKTEESKELSEKERKRIEKLYKLNDTPSILVLPNKTAKGGKFE
CNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEM
PDSTADSVEPSSKKPKLETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLR
DHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSED
DVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAA
ENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEK
ESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKERLVIEEAKAKEE
AEKKMEVEEVKEPEVNEDKSWQVVDQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036361SAP_dom_sf
IPR025224CCAR1/CCAR2
IPR003034SAP_dom
IPR025954DBC1/CARP1_inactive_NUDIX_dom
IPR011992EF-hand-dom_pair
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 732..752
NoneNo IPR availableCOILSCoilCoilcoord: 778..802
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 581..641
e-value: 9.1E-6
score: 27.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 799..819
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 799..827
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 41..91
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 443..468
NoneNo IPR availablePANTHERPTHR14304:SF14CELL DIVISION CYCLE AND APOPTOSIS REGULATOR PROTEIN 1coord: 26..568
NoneNo IPR availablePANTHERPTHR14304:SF14CELL DIVISION CYCLE AND APOPTOSIS REGULATOR PROTEIN 1coord: 570..790
IPR003034SAP domainSMARTSM00513sap_9coord: 383..417
e-value: 7.0E-12
score: 55.5
IPR003034SAP domainPFAMPF02037SAPcoord: 383..417
e-value: 7.0E-13
score: 48.0
IPR003034SAP domainPROSITEPS50800SAPcoord: 383..417
score: 11.864
IPR025954DBC1/CARP1 catalytically inactive NUDIX hydrolase domainSMARTSM01122DBC1_2coord: 205..348
e-value: 1.9E-51
score: 186.9
IPR025954DBC1/CARP1 catalytically inactive NUDIX hydrolase domainPFAMPF14443DBC1coord: 207..340
e-value: 2.3E-43
score: 147.1
IPR036361SAP domain superfamilyGENE3DG3DSA:1.10.720.30coord: 363..428
e-value: 3.2E-14
score: 54.2
IPR036361SAP domain superfamilySUPERFAMILYSSF68906SAP domaincoord: 382..420
IPR025224Cell cycle and apoptosis regulator proteinPANTHERPTHR14304P30 DBC PROTEINcoord: 26..568
coord: 570..790
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 581..639