Copper homeostasis protein CutC

Overview
NameCopper homeostasis protein CutC
Smed IDSMED30010437
Length (bp)3769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Copper homeostasis protein CutC (SMED30010437) t-SNE clustered cells

Violin plots show distribution of expression levels for Copper homeostasis protein CutC (SMED30010437) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Copper homeostasis protein CutC (SMED30010437) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Copper homeostasis protein CutC (SMED30010437) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010437

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010437SMESG000016228.1 SmedASXL_018458SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010437SMESG000016228.1 dd_Smed_v6_7302_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010437SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Match: CUTC (cutC copper transporter [Source:HGNC Symbol;Acc:HGNC:24271])

HSP 1 Score: 132.109 bits (331), Expect = 2.657e-34
Identity = 74/172 (43.02%), Postives = 103/172 (59.88%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGADR+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I++L+ Q
Sbjct:   28 MEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKRLIEQ 191          
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Match: CUTC (cutC copper transporter [Source:HGNC Symbol;Acc:HGNC:24271])

HSP 1 Score: 132.109 bits (331), Expect = 2.072e-33
Identity = 74/172 (43.02%), Postives = 103/172 (59.88%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGADR+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I++L+ Q
Sbjct:   28 MEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKRLIEQ 191          
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 132.88 bits (333), Expect = 2.977e-30
Identity = 70/173 (40.46%), Postives = 100/173 (57.80%), Query Frame = -2
Query: 2770 KLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 3270
            K  NY +         D T FH +K I  AP      EA +EV FEP+ LGE+KG+L +S+   GE+I PL G+A PPKPQGPF I+ G S+ I F+NVF     F   +D+  F I +  E+++  K + + ++F+G+  G   P+  KL V+CP  E     ++WVYYL+G
Sbjct: 4947 KFINYTRQRTEYYCRTDCTDFHAEKLINAAPGGQGGTEASVEVLFEPSHLGETKGILILSSLAGGEYIIPLFGMALPPKPQGPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTI-RAGESVRPKKINNITVSFEGNPSGSKTPITTKLTVSCPPGEGSETGVKWVYYLKG 5118          

HSP 2 Score: 53.5286 bits (127), Expect = 3.222e-6
Identity = 21/68 (30.88%), Postives = 40/68 (58.82%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L+  E+  +L + + D     Y+L L  TP+ PE+P+ F T +GS Q +L  F N+ + ++++ C+ +
Sbjct: 4896 LKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQRTEYYCRTD 4963          
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 132.88 bits (333), Expect = 2.977e-30
Identity = 70/173 (40.46%), Postives = 100/173 (57.80%), Query Frame = -2
Query: 2770 KLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 3270
            K  NY +         D T FH +K I  AP      EA +EV FEP+ LGE+KG+L +S+   GE+I PL G+A PPKPQGPF I+ G S+ I F+NVF     F   +D+  F I +  E+++  K + + ++F+G+  G   P+  KL V+CP  E     ++WVYYL+G
Sbjct: 4947 KFINYTRQRTEYYCRTDCTDFHAEKLINAAPGGQGGTEASVEVLFEPSHLGETKGILILSSLAGGEYIIPLFGMALPPKPQGPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTI-RAGESVRPKKINNITVSFEGNPSGSKTPITTKLTVSCPPGEGSETGVKWVYYLKG 5118          

HSP 2 Score: 53.5286 bits (127), Expect = 3.222e-6
Identity = 21/68 (30.88%), Postives = 40/68 (58.82%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L+  E+  +L + + D     Y+L L  TP+ PE+P+ F T +GS Q +L  F N+ + ++++ C+ +
Sbjct: 4896 LKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQRTEYYCRTD 4963          
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Match: CUTC (cutC copper transporter [Source:HGNC Symbol;Acc:HGNC:24271])

HSP 1 Score: 89.3521 bits (220), Expect = 4.794e-20
Identity = 51/136 (37.50%), Postives = 76/136 (55.88%), Query Frame = 1
Query:  187 IGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I++L+ Q
Sbjct:    1 MGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKRLIEQ 128          
BLAST of Copper homeostasis protein CutC vs. Ensembl Celegans
Match: cutc-1 (Copper homeostasis protein cutC homolog [Source:UniProtKB/Swiss-Prot;Acc:P34630])

HSP 1 Score: 127.102 bits (318), Expect = 2.203e-32
Identity = 68/176 (38.64%), Postives = 107/176 (60.80%), Query Frame = 1
Query:   61 SKFEMELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIK-EFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQL 582
            S+ +++LE+C+D+L SA+ A+ GGADRLE+C+ L   GLTPS+GF   +  ++  IP Y +IR R GDF+Y+ +E+   + D++ LK+  A GFV G L  +G +       +IE    +P+TFHRAID + +    +   I +  +         VLTSG  P+AL+G  +IR++
Sbjct:    6 SQKQIKLEICIDNLESAENAVAGGADRLEVCSALQLGGLTPSVGFVSILSYKYPDIPLYCMIRQRAGDFVYNEDEMAANMEDVEWLKKAGATGFVFGALTSAGSLDRTSCQSIIETARPHPVTFHRAIDVAYDWKTCLEDAIDVGFK--------AVLTSGQEPSALDGVYIIREM 173          
BLAST of Copper homeostasis protein CutC vs. Ensembl Fly
Match: CG6136 (gene:FBgn0038332 transcript:FBtr0303235)

HSP 1 Score: 132.494 bits (332), Expect = 6.412e-34
Identity = 79/185 (42.70%), Postives = 112/185 (60.54%), Query Frame = 1
Query:   58 LSKFEMELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPG-DFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLI--TINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGR 600
            +S  +++LEVCVDS+ SA AA  GGA R+ELC+ L   GLTPSIG  + IKE  ++P Y ++RPR G DF+Y +EE+  +L D+D L+E  ADGFV G L     I+VDQ   V+   G  P+TFHRA D +    +   ++ L +L  +        R+L+SG  P A +G D + QL+ +  R
Sbjct:    5 MSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTMPIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGGLPVTFHRAFDLTDQKSMDENVDMLRELGFR--------RLLSSGFRPTAADGVDCLAQLIAKHQR 181          
BLAST of Copper homeostasis protein CutC vs. Ensembl Fly
Match: CG6136 (gene:FBgn0038332 transcript:FBtr0332540)

HSP 1 Score: 132.494 bits (332), Expect = 6.412e-34
Identity = 79/185 (42.70%), Postives = 112/185 (60.54%), Query Frame = 1
Query:   58 LSKFEMELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPG-DFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLI--TINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGR 600
            +S  +++LEVCVDS+ SA AA  GGA R+ELC+ L   GLTPSIG  + IKE  ++P Y ++RPR G DF+Y +EE+  +L D+D L+E  ADGFV G L     I+VDQ   V+   G  P+TFHRA D +    +   ++ L +L  +        R+L+SG  P A +G D + QL+ +  R
Sbjct:    5 MSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTMPIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGGLPVTFHRAFDLTDQKSMDENVDMLRELGFR--------RLLSSGFRPTAADGVDCLAQLIAKHQR 181          
BLAST of Copper homeostasis protein CutC vs. Ensembl Fly
Match: CG6136 (gene:FBgn0038332 transcript:FBtr0303236)

HSP 1 Score: 132.494 bits (332), Expect = 6.412e-34
Identity = 79/185 (42.70%), Postives = 112/185 (60.54%), Query Frame = 1
Query:   58 LSKFEMELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPG-DFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLI--TINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGR 600
            +S  +++LEVCVDS+ SA AA  GGA R+ELC+ L   GLTPSIG  + IKE  ++P Y ++RPR G DF+Y +EE+  +L D+D L+E  ADGFV G L     I+VDQ   V+   G  P+TFHRA D +    +   ++ L +L  +        R+L+SG  P A +G D + QL+ +  R
Sbjct:    5 MSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTMPIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGGLPVTFHRAFDLTDQKSMDENVDMLRELGFR--------RLLSSGFRPTAADGVDCLAQLIAKHQR 181          
BLAST of Copper homeostasis protein CutC vs. Ensembl Zebrafish
Match: cutc (cutC copper transporter homolog (E. coli) [Source:ZFIN;Acc:ZDB-GENE-041010-144])

HSP 1 Score: 131.339 bits (329), Expect = 1.560e-33
Identity = 76/175 (43.43%), Postives = 104/175 (59.43%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLK-EYADGFVIGCLRESGDISVDQTGLVIERIGS---YPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA R+ELC+ L   G TPS G  + +KE   IP + +IRPR GDF+Y   E++VM  +I  +K + ADG V G L E G +    T + +E + +    P+TFHRA D   +PL+ + +LI L  +        RVLTSG   +ALEG  VI++LV Q
Sbjct:    7 MEVCVDSVESAINAERGGAARIELCSNLLEGGTTPSTGLLQVVKENVEIPVFVMIRPRGGDFLYSEWEVEVMKREIQQMKSQQADGLVFGALTEDGRV---HTQICMELLAASRPLPVTFHRAFDMVHDPLVALETLISLGFE--------RVLTSGCDSSALEGLPVIKRLVEQ 170          
BLAST of Copper homeostasis protein CutC vs. Ensembl Zebrafish
Match: cutc (cutC copper transporter homolog (E. coli) [Source:ZFIN;Acc:ZDB-GENE-041010-144])

HSP 1 Score: 130.954 bits (328), Expect = 2.230e-33
Identity = 76/175 (43.43%), Postives = 104/175 (59.43%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLK-EYADGFVIGCLRESGDISVDQTGLVIERIGS---YPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA R+ELC+ L   G TPS G  + +KE   IP + +IRPR GDF+Y   E++VM  +I  +K + ADG V G L E G +    T + +E + +    P+TFHRA D   +PL+ + +LI L  +        RVLTSG   +ALEG  VI++LV Q
Sbjct:    7 MEVCVDSVESAINAERGGAARIELCSNLLEGGTTPSTGLLQVVKENVEIPVFVMIRPRGGDFLYSEWEVEVMKREIQQMKSQQADGLVFGALTEDGRV---HTHICMELLAASRPLPVTFHRAFDMVHDPLVALETLISLGFE--------RVLTSGCDSSALEGLPVIKRLVEQ 170          
BLAST of Copper homeostasis protein CutC vs. Ensembl Zebrafish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 132.88 bits (333), Expect = 1.756e-30
Identity = 82/226 (36.28%), Postives = 114/226 (50.44%), Query Frame = -2
Query: 2770 ARL**YVL*PGTIWYSFKARATSDFQHRYWELSDIVGSF*KLGEK*IRFFMQSKLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 3429
            ARL  Y    G  +Y  K +A S    +    +  +GS         +    +K  N+ ++    I   D+  F  +KSI  A       E  + V FEP  +G+ +  LTIS+   GEF+FPL G  TPPK QGP  I  GSSVSI+F+NVF +   F +Q+D+  F + K +E I + K   + + FDG   G  GP  GKL +TCP  E     + WVYYL+G
Sbjct: 4589 ARLVLYAAELGHFFYDLKMKALSAPNEKPLYFTAPLGS---------KHSGIAKFTNFSRVKTEYICKTDSPSFTVEKSIKAAAGNQTGTEISMAVHFEPCLVGDIQSRLTISSDSGGEFVFPLYGTCTPPKAQGPLSISLGSSVSIAFKNVFQQTTTFSYQVDNPAFTV-KGAETISAQKTQHIQVIFDGPPTGSKGPYRGKLTITCPRMEGHGQCIFWVYYLKG 4804          
BLAST of Copper homeostasis protein CutC vs. Ensembl Xenopus
Match: gtf2e1 (general transcription factor IIE subunit 1 [Source:Xenbase;Acc:XB-GENE-959290])

HSP 1 Score: 133.265 bits (334), Expect = 6.857e-34
Identity = 90/242 (37.19%), Postives = 126/242 (52.07%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAGQYIKGTERATGRVMARIHLSGDCLSYWIWGGRGSTPSLSRYRS 801
            +EVCVDS+ SA  A  GGA R+ELCA L   G+TPS+G  + +K++  IP + +IRPR GDF+Y + E++VM  DI   K + ADG V G L E G I  +    ++      P+TFHRA D   +PL+ + +LI L  +        RVLTSG   +ALEG  +I++LV Q                 A   I +M G  I  TER   R+     L G  +  +    R +  S  +YR+
Sbjct:   27 MEVCVDSVESAINAERGGAGRIELCASLLEGGITPSVGLLQVVKQYLQIPIFVMIRPRGGDFLYSDREVEVMKADIRLAKIHGADGLVFGALTEDGRIDAELCMELLAVSRPLPVTFHRAFDMVYDPLLAMETLISLGFE--------RVLTSGCDTSALEGLPLIKRLVEQ-----------------AKGRIIVMPGGGI--TERNLQRI-----LEGAAVQEFHCSARSTKDSTMKYRN 236          
BLAST of Copper homeostasis protein CutC vs. Ensembl Xenopus
Match: gtf2e1 (general transcription factor IIE subunit 1 [Source:Xenbase;Acc:XB-GENE-959290])

HSP 1 Score: 132.88 bits (333), Expect = 1.139e-33
Identity = 90/242 (37.19%), Postives = 126/242 (52.07%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAGQYIKGTERATGRVMARIHLSGDCLSYWIWGGRGSTPSLSRYRS 801
            +EVCVDS+ SA  A  GGA R+ELCA L   G+TPS+G  + +K++  IP + +IRPR GDF+Y + E++VM  DI   K + ADG V G L E G I  +    ++      P+TFHRA D   +PL+ + +LI L  +        RVLTSG   +ALEG  +I++LV Q                 A   I +M G  I  TER   R+     L G  +  +    R +  S  +YR+
Sbjct:   35 MEVCVDSVESAINAERGGAGRIELCASLLEGGITPSVGLLQVVKQYLQIPIFVMIRPRGGDFLYSDREVEVMKADIRLAKIHGADGLVFGALTEDGRIDAELCMELLAVSRPLPVTFHRAFDMVYDPLLAMETLISLGFE--------RVLTSGCDTSALEGLPLIKRLVEQ-----------------AKGRIIVMPGGGI--TERNLQRI-----LEGAAVQEFHCSARSTKDSTMKYRN 244          
BLAST of Copper homeostasis protein CutC vs. Ensembl Xenopus
Match: maob (monoamine oxidase B [Source:Xenbase;Acc:XB-GENE-949917])

HSP 1 Score: 134.42 bits (337), Expect = 8.011e-31
Identity = 68/176 (38.64%), Postives = 102/176 (57.95%), Query Frame = -2
Query: 2770 MQSKLKNYQKIYFHEII*IDNTKFHCDKSITVAPNV----EAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 3279
            + +K  NY +        +DN+ FH +K +T AP      E  ++V +EP +LGES+ +L IS+ V GE+  PL G +  PKPQGP  I+ GSS++I F+NVF++   F FQ D   F + K  E ++  K H + ++++    G   PV GKLV++CP A      + WVYYL+G
Sbjct: 4700 ISAKFTNYTRQKAEYTCKVDNSDFHVEKLVTAAPGSQGGSEVSVDVTYEPVQLGESRAVLLISSPVGGEYTIPLFGSSLSPKPQGPIQIRSGSSITIPFKNVFLQTTAFTFQADPPAFTV-KPCEPVRPKKTHYISVSYEAPNPGSKVPVTGKLVISCPRATGIAQGIYWVYYLKG 4874          

HSP 2 Score: 59.3066 bits (142), Expect = 5.586e-8
Identity = 27/68 (39.71%), Postives = 42/68 (61.76%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L+  ES  +L + S D     Y+L L  TP+  E+PL F T +GS QT+ A F N+ + K++++CKV+
Sbjct: 4652 LKSGESTGRLALQSTDLGLFQYELLLKATPALSEKPLYFRTTLGSSQTISAKFTNYTRQKAEYTCKVD 4719          
BLAST of Copper homeostasis protein CutC vs. Ensembl Xenopus
Match: gtf2e1 (general transcription factor IIE subunit 1 [Source:Xenbase;Acc:XB-GENE-959290])

HSP 1 Score: 117.087 bits (292), Expect = 1.189e-28
Identity = 80/226 (35.40%), Postives = 114/226 (50.44%), Query Frame = 1
Query:  127 GGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAGQYIKGTERATGRVMARIHLSGDCLSYWIWGGRGSTPSLSRYRS 801
             GA R+ELCA L   G+TPS+G  + +K++  IP + +IRPR GDF+Y + E++VM  DI   K + ADG V G L E G I  +    ++      P+TFHRA D   +PL+ + +LI L  +        RVLTSG   +ALEG  +I++LV Q                 A   I +M G  I  TER   R+     L G  +  +    R +  S  +YR+
Sbjct:    3 AGAGRIELCASLLEGGITPSVGLLQVVKQYLQIPIFVMIRPRGGDFLYSDREVEVMKADIRLAKIHGADGLVFGALTEDGRIDAELCMELLAVSRPLPVTFHRAFDMVYDPLLAMETLISLGFE--------RVLTSGCDTSALEGLPLIKRLVEQ-----------------AKGRIIVMPGGGI--TERNLQRI-----LEGAAVQEFHCSARSTKDSTMKYRN 196          
BLAST of Copper homeostasis protein CutC vs. Ensembl Mouse
Match: Hydin (HYDIN, axonemal central pair apparatus protein [Source:MGI Symbol;Acc:MGI:2389007])

HSP 1 Score: 142.51 bits (358), Expect = 2.291e-33
Identity = 69/174 (39.66%), Postives = 108/174 (62.07%), Query Frame = -2
Query: 2770 SKLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 3273
            +K  NY ++        D + FH +K I  AP      E  +EV FEP+ LGE+KG+L +S+ + GE+I PL G+A PPKPQGPF+I+ G ++ I F+NVF+ A  F F +++  F I + +E ++  K + + + F+G+  G   P+  KL+VTCP+ E   + ++WVYYL+G
Sbjct: 4979 AKFTNYTRLKTEYYCKTDCSDFHTEKVINAAPGAQGGTEVSVEVFFEPSHLGETKGILCLSSLIGGEYIIPLFGIALPPKPQGPFLIRAGYNIIIPFKNVFLHATSFSFIVENPAFSI-RAAETVRPKKINNITVYFEGNPSGSKTPITSKLIVTCPQCEGTESGIKWVYYLKG 5151          

HSP 2 Score: 52.7582 bits (125), Expect = 4.055e-6
Identity = 23/68 (33.82%), Postives = 40/68 (58.82%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L+  E   +L + + D     Y+L L   P+ PE+P+ F T +GS Q++LA F N+ + K+++ CK +
Sbjct: 4929 LKAGELCGRLTLHNSDLGYYQYELALKALPAPPEKPVHFQTVLGSSQSILAKFTNYTRLKTEYYCKTD 4996          
BLAST of Copper homeostasis protein CutC vs. Ensembl Mouse
Match: Cutc (cutC copper transporter [Source:MGI Symbol;Acc:MGI:1913638])

HSP 1 Score: 130.954 bits (328), Expect = 2.529e-33
Identity = 74/172 (43.02%), Postives = 102/172 (59.30%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA R+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I+QL+ Q
Sbjct:   25 MEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCLSLVALCRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKQLIDQ 188          
BLAST of Copper homeostasis protein CutC vs. Ensembl Mouse
Match: Cutc (cutC copper transporter [Source:MGI Symbol;Acc:MGI:1913638])

HSP 1 Score: 130.954 bits (328), Expect = 3.609e-33
Identity = 74/172 (43.02%), Postives = 102/172 (59.30%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA R+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I+QL+ Q
Sbjct:   27 MEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCLSLVALCRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKQLIDQ 190          
BLAST of Copper homeostasis protein CutC vs. Ensembl Mouse
Match: Cutc (cutC copper transporter [Source:MGI Symbol;Acc:MGI:1913638])

HSP 1 Score: 118.627 bits (296), Expect = 5.856e-29
Identity = 72/172 (41.86%), Postives = 99/172 (57.56%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA R+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA++          +L+ L  +        RVLTSG   +ALEG  +I+QL+ Q
Sbjct:   27 MEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCLSLVALCRPLPVTFHRALE----------TLLTLGFE--------RVLTSGCDSSALEGLPLIKQLIDQ 180          
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Match: sp|Q9CNA6|CUTC_PASMU (Copper homeostasis protein CutC OS=Pasteurella multocida (strain Pm70) OX=272843 GN=cutC PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 5.762e-37
Identity = 89/227 (39.21%), Postives = 124/227 (54.63%), Query Frame = 1
Query:   73 MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAGQYIKGTERA-----TGRVMARIHLSG 735
            M++EVC+D++ S   A N GADRLELCA L   G+TPS    +   +F +IP Y +IRPR GDF++  +E+++ML DI   K+  A G VIG L +  DI +     +I+      +TFHRA D  R+P+ ++  LIQL  +        RVLTSG   +A+EG  +I+QLV Q                 AS+ I+IMAG  I     A     TG  +  +HLSG
Sbjct:    1 MKIEVCIDNIESVHIAQNAGADRLELCACLSVGGVTPSYSLIKSAVDFANIPCYVMIRPRAGDFLFSTQEVNMMLDDIHLAKQLGAQGIVIGALTKHADIDLSVCETLIQAAEGLGVTFHRAFDLCRDPVTSLEQLIQLGCE--------RVLTSGQKASAVEGQPLIKQLVSQ-----------------ASNRIRIMAGAGINAQNAALLVKNTG--ITELHLSG 200          
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Match: sp|Q9VF71|CUTC_DROME (Copper homeostasis protein cutC homolog OS=Drosophila melanogaster OX=7227 GN=CG6136 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 6.427e-33
Identity = 79/185 (42.70%), Postives = 112/185 (60.54%), Query Frame = 1
Query:   58 LSKFEMELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPG-DFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLI--TINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGR 600
            +S  +++LEVCVDS+ SA AA  GGA R+ELC+ L   GLTPSIG  + IKE  ++P Y ++RPR G DF+Y +EE+  +L D+D L+E  ADGFV G L     I+VDQ   V+   G  P+TFHRA D +    +   ++ L +L  +        R+L+SG  P A +G D + QL+ +  R
Sbjct:    5 MSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTMPIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGGLPVTFHRAFDLTDQKSMDENVDMLRELGFR--------RLLSSGFRPTAADGVDCLAQLIAKHQR 181          
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Match: sp|Q9NTM9|CUTC_HUMAN (Copper homeostasis protein cutC homolog OS=Homo sapiens OX=9606 GN=CUTC PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 9.948e-33
Identity = 74/172 (43.02%), Postives = 103/172 (59.88%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEY-ADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGADR+ELC+GL   G TPS+G  + +K+   IP + +IRPR GDF+Y + E++VM  DI   K Y ADG V G L E G I  +    ++      P+TFHRA D   +P+  + +L+ L  +        RVLTSG   +ALEG  +I++L+ Q
Sbjct:   28 MEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFE--------RVLTSGCDSSALEGLPLIKRLIEQ 191          
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Match: sp|Q80W93|HYDIN_MOUSE (Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 1.603e-32
Identity = 69/174 (39.66%), Postives = 108/174 (62.07%), Query Frame = -2
Query: 2770 SKLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 3273
            +K  NY ++        D + FH +K I  AP      E  +EV FEP+ LGE+KG+L +S+ + GE+I PL G+A PPKPQGPF+I+ G ++ I F+NVF+ A  F F +++  F I + +E ++  K + + + F+G+  G   P+  KL+VTCP+ E   + ++WVYYL+G
Sbjct: 4979 AKFTNYTRLKTEYYCKTDCSDFHTEKVINAAPGAQGGTEVSVEVFFEPSHLGETKGILCLSSLIGGEYIIPLFGIALPPKPQGPFLIRAGYNIIIPFKNVFLHATSFSFIVENPAFSI-RAAETVRPKKINNITVYFEGNPSGSKTPITSKLIVTCPQCEGTESGIKWVYYLKG 5151          
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Match: sp|Q87DU4|CUTC_XYLFT (Copper homeostasis protein CutC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=cutC PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 2.061e-32
Identity = 75/172 (43.60%), Postives = 103/172 (59.88%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDID-HLKEYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            LEV   S+ SA AA  GGA R+ELC GL   GLTPS G    ++E   IP Y +IRPR GDF++  EE++VM  D++  ++   DG V+G L  +G++ +    ++I   GS  +TFHRAID S +P  T+  +I L  +        RVLTSGG  +ALEG++ I  LV Q
Sbjct:   28 LEVAAGSVASALAAQEGGAMRVELCHGLEGGGLTPSYGMLAVVRERLHIPLYVLIRPRGGDFVFSEEEMEVMCGDVECCVRLGCDGVVLGALDPAGEVDMGMMRVLIAAAGSLGVTFHRAIDVSADPGRTLEDVIALGCE--------RVLTSGGRSSALEGAETIAALVAQ 191          
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Match: K1QL99 (Hydrocephalus-inducing-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10023182 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.572e-52
Identity = 80/158 (50.63%), Postives = 110/158 (69.62%), Query Frame = -2
Query: 2770 IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 3225
            +DN  FH +K++  AP      E  L+V FEP+KLGE + LLTIS+   GE++FPL G   PPKPQGP+++K GS+ SI FRNVF +   F FQ+D+  FH+ K SENIK  K++++V+ FDG+  G    VMGKL++TCP++  G  N+QWVYYL+G
Sbjct: 5152 VDNNDFHTEKTVAAAPGAPGGTEVALDVTFEPSKLGEQRALLTISSPQGGEYVFPLFGTCVPPKPQGPYVVKAGSTTSIPFRNVFHQQTAFTFQVDNPAFHLTKQSENIKHRKEYKIVVGFDGNDSGTKAGVMGKLIITCPKSAGG-QNIQWVYYLKG 5308          

HSP 2 Score: 64.6994 bits (156), Expect = 1.572e-52
Identity = 30/69 (43.48%), Postives = 46/69 (66.67%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKN-KSDFSCKVN 3470
            L+V ES+ ++E+ S D  S  Y+L+L  TP+RPE+ L F  G+G     +A F N+AK  K+D++CKV+
Sbjct: 5085 LKVGESLQRIEMVSNDLGSYVYELKLKATPARPEKALYFRAGLGQSHIQVAKFLNFAKQAKADYTCKVD 5153          
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Match: V4BQE4 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_122343 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.984e-51
Identity = 81/158 (51.27%), Postives = 106/158 (67.09%), Query Frame = -2
Query: 2770 IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDG--SADGGPVMGKLVVTCPEAENGLNNLQWVYYLRG 3225
            IDN+ FH DK++  AP      E   +V FEP+KLGE K +LT+S+Q  GE+IFPL G   PPKPQGP IIK GS+  I+FRNVF     F FQ+D+  FH++K  E++++ KDHR+V+ FDG  S     VMGKL+V+C  +  G  N QWVYYL+G
Sbjct: 4840 IDNSDFHVDKTVAAAPGSTGGTEVAFDVSFEPSKLGEQKAVLTVSSQTGGEYIFPLNGSCIPPKPQGPCIIKAGSNTPITFRNVFNATTPFTFQVDNPLFHVSKQGESVRARKDHRIVVGFDGNDSNSKAAVMGKLIVSCASSAGGKTNAQWVYYLKG 4997          

HSP 2 Score: 62.7734 bits (151), Expect = 1.984e-51
Identity = 31/68 (45.59%), Postives = 40/68 (58.82%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            LRV E   ++E S  D     YDL L  TPS PE+ L F T +G  Q   A F N+AK K+D+SCK++
Sbjct: 4774 LRVGEVPGRIEFSCNDLGLYMYDLILKATPSGPEKALYFRTCLGQSQVQTAKFLNFAKQKTDYSCKID 4841          
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Match: A0A2C9K9X8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059989 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 6.356e-50
Identity = 75/156 (48.08%), Postives = 106/156 (67.95%), Query Frame = -2
Query: 2770 IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRG 3225
            IDN  FH +K+I  AP      E  L+V FEP+KLGE +  LT+++ +  ++IFPL G    PKPQGPF +K GS++SI FRN+F     F FQ+D+  FH+ K  E+I+ HKDHR+V+ FDG+    PV+GKL+V+C  +  G +N+QW+YYL+G
Sbjct: 2531 IDNPDFHVEKTIAAAPGSTGGTEVALDVVFEPSKLGEQRAQLTVTSPLGSDYIFPLFGTCISPKPQGPFTVKSGSNLSIVFRNIFSTTTPFTFQVDNPLFHVAKPGESIRPHKDHRIVVGFDGTNIKNPVVGKLIVSCARSAGGASNVQWIYYLKG 2686          

HSP 2 Score: 62.3882 bits (150), Expect = 6.356e-50
Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L+V E   +LE++  D     YD+ L+  PS  E+P+ F T +GS  T +A F N+AK K+D+SCK++
Sbjct: 2465 LKVGEVTGRLELNCADLGQYLYDMVLNAQPSGQEKPIYFRTWLGSSVTQVAKFLNFAKQKTDYSCKID 2532          
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Match: A0A1I8GWQ9 (Hydin_ADK domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.473e-48
Identity = 77/155 (49.68%), Postives = 109/155 (70.32%), Query Frame = -2
Query: 2758 TKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 3216
            T FHCDK++TV+P  E  L+V FEP +LG+ K  LT+++Q AG ++FPL  V  PPKPQGPF++K G++ +ISFRNVF  A QF FQ+D+  F ++K+ + ++ HK++R+V+ F+  AD G   VM KL+VTC  +    + LQWVYYLRG   D
Sbjct: 4317 TDFHCDKTVTVSPGSEGVLDVVFEPCRLGDIKSTLTVTSQSAGAYLFPLHAVCLPPKPQGPFVVKAGATATISFRNVFPSATQFTFQVDNPAFSVHKSGDTVRPHKEYRIVVTFNPGADAGQDAVMAKLLVTCARSSGAGSALQWVYYLRGHPPD 4471          

HSP 2 Score: 52.7582 bits (125), Expect = 1.473e-48
Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = -3
Query: 3270 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKV 3470
            L+  +   KLE+  P+     Y+L+L GT   PE+ L F T +G  Q L A F N+ ++K+DF+C++
Sbjct: 4247 LKPQDYRGKLELQCPELGLYTYELDLKGTQPGPERALHFTTYLGGQQVLQARFVNYGRSKADFACRI 4313          
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Match: A0A1I8GKJ3 (Hydin_ADK domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.795e-48
Identity = 77/155 (49.68%), Postives = 109/155 (70.32%), Query Frame = -2
Query: 2758 TKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 3216
            T FHCDK++TV+P  E  L+V FEP +LG+ K  LT+++Q AG ++FPL  V  PPKPQGPF++K G++ +ISFRNVF  A QF FQ+D+  F ++K+ + ++ HK++R+V+ F+  AD G   VM KL+VTC  +    + LQWVYYLRG   D
Sbjct: 4893 TDFHCDKTVTVSPGSEGVLDVVFEPCRLGDIKSTLTVTSQSAGAYLFPLHAVCLPPKPQGPFVVKAGATATISFRNVFPSATQFTFQVDNPAFSVHKSGDTVRPHKEYRIVVTFNPGADAGQDAVMAKLLVTCARSSGAGSALQWVYYLRGHPPD 5047          

HSP 2 Score: 52.7582 bits (125), Expect = 1.795e-48
Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = -3
Query: 3270 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKV 3470
            L+  +   KLE+  P+     Y+L+L GT   PE+ L F T +G  Q L A F N+ ++K+DF+C++
Sbjct: 4823 LKPQDYRGKLELQCPELGLYTYELDLKGTQPGPERALHFTTYLGGQQVLQARFVNYGRSKADFACRI 4889          
BLAST of Copper homeostasis protein CutC vs. Ensembl Cavefish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 134.035 bits (336), Expect = 5.609e-31
Identity = 65/178 (36.52%), Postives = 108/178 (60.67%), Query Frame = -2
Query: 2770 FMQSKLKNYQKIYFHEII*IDNTKFHCDKSITVAP-----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVM--GKLVVTCPEAENGLNNLQWVYYLRG 3282
            ++ +K  +Y ++        D   F  +K+++ A        +  ++V FEP++LGE +GLLT+S+ + G+++FPL G  TPPKPQGP  I  GS V+I F+NVF +AA F FQ+++  F + K ++ I+S K H +V++F+G  +G   +  GKL ++ P  +     + WVYYL+G
Sbjct: 4238 YLTAKFTSYSRVKTEYTCKTDCPDFFVEKTVSAAAAGSQTGSDVSVKVHFEPSQLGEVRGLLTVSSSLGGDYLFPLYGTCTPPKPQGPLTIYAGSHVTIPFKNVFPQAAAFSFQVNNPAFTV-KGADTIQSKKTHNIVVSFEGPPEGSKTLCTGKLTISSPRTDGHGQAIFWVYYLKG 4414          

HSP 2 Score: 52.373 bits (124), Expect = 4.210e-6
Identity = 23/68 (33.82%), Postives = 41/68 (60.29%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            L + ES  +L + + +  S  Y+L L   P+ PE+PL F   +GS Q L A F ++++ K++++CK +
Sbjct: 4191 LCIGESTTRLTLQNSELGSFHYELLLRALPAPPEKPLYFKAPLGSSQYLTAKFTSYSRVKTEYTCKTD 4258          
BLAST of Copper homeostasis protein CutC vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001803.1 (pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1 gene:ENSPMAG00000001615.1 transcript:ENSPMAT00000001803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 4.062e-31
Identity = 61/172 (35.47%), Postives = 99/172 (57.56%), Query Frame = -2
Query: 2770 SKLKNYQKIYFHEII*IDNTKFHCDKSITVAPN----VEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRG 3273
            ++  NY +        I + +FH +K++T AP      E  ++V +EP+ LG+++ LLT+S+   GE+  PLVGV + P+PQGPF ++ GSSVS+ F+NVF + A F   +DS  F +    E ++  +   +V+ F+G+    PV  +L V+CP+         W +YLRG
Sbjct: 5015 ARFVNYSRQKTEYACKITSGEFHVEKTVTAAPGAAGGTEVSVDVLYEPSHLGDTRALLTLSSPQGGEYTIPLVGVCSAPRPQGPFTVRAGSSVSVPFKNVFAQTASFMAAVDSPAFSVRAAGEAVRPKRTITIVVGFEGAPGAAPVTARLTVSCPQQPAS----SWTFYLRG 5182          

HSP 2 Score: 51.9878 bits (123), Expect = 1.070e-6
Identity = 22/68 (32.35%), Postives = 40/68 (58.82%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            LRV ES  +L + S +  +  +DL+L   P+  E+PL F   +G+     A F N+++ K++++CK+ 
Sbjct: 4965 LRVGESSGRLVLQSAELGAFTWDLQLRSLPAAHEKPLHFRASLGASHVQAARFVNYSRQKTEYACKIT 5032          
BLAST of Copper homeostasis protein CutC vs. Ensembl Nematostella
Match: EDO36886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHG1])

HSP 1 Score: 133.265 bits (334), Expect = 8.480e-35
Identity = 75/179 (41.90%), Postives = 107/179 (59.78%), Query Frame = 1
Query:   73 MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLK-EYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGV 606
            M LE+CVDS+ SA  A  GGA R+ELCA L   G TPS+G  + IK+  S+P + IIRPR GDF+Y   E  VM  D+  LK E ADG V+G L  +G+I  ++   +I+     P+TFHRA D  R+P+++++ L+ +  +        R+LTSG    ALEG  +I+ LV    + +
Sbjct:    1 MLLEICVDSVQSAINAEKGGASRVELCANLMEGGTTPSLGMLKIIKKLVSVPVFVIIRPRGGDFVYSESEFWVMKEDLKCLKSEGADGIVLGILEANGEIDRERCQELIDISRPLPVTFHRAFDMVRDPVLSLDILVSMGVE--------RILTSGLDSTALEGLPIIKILVEHANKRI 171          
BLAST of Copper homeostasis protein CutC vs. Ensembl Medaka
Match: cutc (cutC copper transporter [Source:NCBI gene;Acc:101165753])

HSP 1 Score: 133.65 bits (335), Expect = 1.790e-34
Identity = 74/172 (43.02%), Postives = 105/172 (61.05%), Query Frame = 1
Query:   79 LEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLK-EYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQ 591
            +EVCVDS+ SA  A  GGA RLELCA L   GLTPS+G  + +K++  IP + +IRPR GDF+Y ++E++VM  DI+  K +  DGFV+G L E G +  +    ++      P+TFHRA D   +  + + +LI L  +        RVLTSG   +ALEG  VI++L+ Q
Sbjct:    7 MEVCVDSVESAINAERGGAGRLELCASLLEGGLTPSLGLVQVVKQYIKIPIFVMIRPRGGDFLYSDQEVEVMKKDIELTKGQGVDGFVLGALTEDGRVDAELCMELLAAARPLPVTFHRAFDMVHDSAVALETLISLGFE--------RVLTSGCDISALEGLPVIKRLIDQ 170          
BLAST of Copper homeostasis protein CutC vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 327.02 bits (837), Expect = 1.047e-124
Identity = 156/156 (100.00%), Postives = 156/156 (100.00%), Query Frame = -2
Query: 2758 IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 3225
            IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD
Sbjct: 4922 IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 5077          

HSP 2 Score: 141.739 bits (356), Expect = 1.047e-124
Identity = 66/68 (97.06%), Postives = 68/68 (100.00%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCK++
Sbjct: 4856 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKID 4923          
BLAST of Copper homeostasis protein CutC vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 326.635 bits (836), Expect = 1.138e-124
Identity = 156/156 (100.00%), Postives = 156/156 (100.00%), Query Frame = -2
Query: 2758 IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 3225
            IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD
Sbjct: 4915 IDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 5070          

HSP 2 Score: 141.739 bits (356), Expect = 1.138e-124
Identity = 66/68 (97.06%), Postives = 68/68 (100.00%), Query Frame = -3
Query: 3267 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKVN 3470
            LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCK++
Sbjct: 4849 LRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKID 4916          
BLAST of Copper homeostasis protein CutC vs. Planmine SMEST
Match: SMESG000016227.1 (SMESG000016227.1)

HSP 1 Score: 372.089 bits (954), Expect = 4.376e-120
Identity = 193/251 (76.89%), Postives = 204/251 (81.27%), Query Frame = 1
Query:   73 MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAGQYIKGTERATGRVMARIHLSGDCLSYWIWGGRGSTPSLSRYRSARH-WDTF 822
            MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVG                QVASSGIQIMAG  I  TE     ++ + ++     S+ +  G+     +   R+ R+  D F
Sbjct:    1 MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCSIPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEYADGFVIGCLRESGDISVDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFRVLTSGGSPAALEGSDVIRQLVG----------------QVASSGIQIMAGGGI--TELNVQEILDKTNVRAIHGSFSVSRGQAKCTVVEAVRNVRNILDKF 233          

HSP 2 Score: 112.464 bits (280), Expect = 2.267e-27
Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 1
Query: 1075 VFLGGGITELNVQEILDKTNVRAIHGSFSVSRGQAKCTVVEAVRNVRNILDKFDRYK 1245
            +  GGGITELNVQEILDKTNVRAIHGSFSVSRGQAKCTVVEAVRNVRNILDKFDRYK
Sbjct:  181 IMAGGGITELNVQEILDKTNVRAIHGSFSVSRGQAKCTVVEAVRNVRNILDKFDRYK 237          
The following BLAST results are available for this feature:
BLAST of Copper homeostasis protein CutC vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CUTC2.657e-3443.02cutC copper transporter [Source:HGNC Symbol;Acc:HG... [more]
CUTC2.072e-3343.02cutC copper transporter [Source:HGNC Symbol;Acc:HG... [more]
HYDIN2.977e-3040.46HYDIN axonemal central pair apparatus protein [Sou... [more]
HYDIN2.977e-3040.46HYDIN axonemal central pair apparatus protein [Sou... [more]
CUTC4.794e-2037.50cutC copper transporter [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cutc-12.203e-3238.64Copper homeostasis protein cutC homolog [Source:U... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG61366.412e-3442.70gene:FBgn0038332 transcript:FBtr0303235[more]
CG61366.412e-3442.70gene:FBgn0038332 transcript:FBtr0332540[more]
CG61366.412e-3442.70gene:FBgn0038332 transcript:FBtr0303236[more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cutc1.560e-3343.43cutC copper transporter homolog (E. coli) [Source:... [more]
cutc2.230e-3343.43cutC copper transporter homolog (E. coli) [Source:... [more]
hydin1.756e-3036.28HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gtf2e16.857e-3437.19general transcription factor IIE subunit 1 [Source... [more]
gtf2e11.139e-3337.19general transcription factor IIE subunit 1 [Source... [more]
maob8.011e-3138.64monoamine oxidase B [Source:Xenbase;Acc:XB-GENE-94... [more]
gtf2e11.189e-2835.40general transcription factor IIE subunit 1 [Source... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hydin2.291e-3339.66HYDIN, axonemal central pair apparatus protein [So... [more]
Cutc2.529e-3343.02cutC copper transporter [Source:MGI Symbol;Acc:MGI... [more]
Cutc3.609e-3343.02cutC copper transporter [Source:MGI Symbol;Acc:MGI... [more]
Cutc5.856e-2941.86cutC copper transporter [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CNA6|CUTC_PASMU5.762e-3739.21Copper homeostasis protein CutC OS=Pasteurella mul... [more]
sp|Q9VF71|CUTC_DROME6.427e-3342.70Copper homeostasis protein cutC homolog OS=Drosoph... [more]
sp|Q9NTM9|CUTC_HUMAN9.948e-3343.02Copper homeostasis protein cutC homolog OS=Homo sa... [more]
sp|Q80W93|HYDIN_MOUSE1.603e-3239.66Hydrocephalus-inducing protein OS=Mus musculus OX=... [more]
sp|Q87DU4|CUTC_XYLFT2.061e-3243.60Copper homeostasis protein CutC OS=Xylella fastidi... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QL991.572e-5250.63Hydrocephalus-inducing-like protein OS=Crassostrea... [more]
V4BQE41.984e-5151.27Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A2C9K9X86.356e-5048.08Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1I8GWQ91.473e-4849.68Hydin_ADK domain-containing protein OS=Macrostomum... [more]
A0A1I8GKJ31.795e-4849.68Hydin_ADK domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hydin5.609e-3136.52HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001803.14.062e-3135.47pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368868.480e-3541.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cutc1.790e-3443.02cutC copper transporter [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Copper homeostasis protein CutC vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016228.11.047e-124100.00SMESG000016228.1[more]
SMESG000016228.11.138e-124100.00SMESG000016228.1[more]
SMESG000016227.14.376e-12076.89SMESG000016227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010437 ID=SMED30010437|Name=Copper homeostasis protein CutC|organism=Schmidtea mediterranea sexual|type=transcript|length=3769bp
ATTTAAATGATTTTTCTTTAAATAATATTTATTGCGGGTGATTTGAATTT
ATATTTTTTATCAAAATTCGAAATGGAATTAGAAGTTTGTGTTGATTCAT
TAACTTCTGCTAAAGCAGCTATTAATGGTGGTGCAGATAGACTCGAATTA
TGTGCTGGATTGCACTGTGATGGTCTGACTCCATCAATTGGATTTTGTCG
GAAAATAAAGGAATTTTGTAGCATTCCAAGTTACGCTATAATTAGACCTC
GTCCAGGAGATTTTATTTATGATAATGAAGAGTTAGACGTCATGCTTTAT
GACATTGATCATTTGAAAGAATATGCAGATGGATTTGTAATTGGTTGCTT
GAGAGAGTCCGGCGATATCTCAGTCGACCAGACGGGATTGGTGATTGAGC
GGATTGGCAGCTACCCAATTACATTCCACAGGGCCATCGACGCCAGCAGG
AATCCTCTGATCACGATTAACAGCCTTATCCAATTGGCTAACCAATACAT
GCCTCCTCATTGCCCATTCCGTGTGTTGACCAGCGGGGGTAGCCCTGCGG
CATTGGAGGGGTCCGATGTGATTCGGCAGTTGGTCGGTCAGGTCGGGAGG
GGGGTTTATTGTACCGATATTGATCGCGTATATATTCAGGTGGCCTCGAG
CGGGATTCAGATCATGGCAGGTCAGTACATCAAAGGGACTGAGAGGGCGA
CTGGCAGGGTGATGGCACGCATTCACCTCAGTGGTGATTGCTTATCCTAC
TGGATTTGGGGTGGGAGGGGATCAACACCATCACTGTCCCGATATAGATC
GGCCCGGCACTGGGATACCTTTATTGCCCCTTACACAGTATCAGCCAGCT
GAGACGTCTTGTAGTGCAATAAGCGTGATTGGCGTAATATTTACGCCATA
ATTAAATAACCCAATCGAATTTCGTATCAGTTACCAATAGCAACCCGTTT
CCGTATTCCTAGGCCACAATTATAAGTTCTCCATGCGTTTCCCGCCTCAG
ATCGACATACGATTGATCAGTCCGTCATTTAAGCTTTCCCCTATTCCGAA
TCGTGCTGACATAATTTTCTCATCGTCTTTCTAGGAGGTGGAATAACCGA
ACTGAATGTCCAGGAGATTCTCGACAAGACAAATGTGCGGGCTATTCACG
GATCTTTTAGTGTTTCGAGGGGCCAGGCGAAATGCACTGTCGTAGAAGCG
GTCAGAAATGTTCGCAATATTCTCGATAAGTTTGATCGATATAAATAATC
TTTTGTCTTTTCTTTTACATTGAAATAATCAATAAGTTTGACAGCATTCC
CATCCGGGTAACAAAACACGAGCAGCCAGATATTTATCAACCGATTTCTA
AATAACCGCAAAACTGAATTTTCTGTCGTACATGTTGATCGTGAGGATCA
CTGGGACAGAAATGCTAGAAAACCTTCACCGGATGAGTTCTGCATCCACT
GATTGGGGACTTTATTATTATTTGGATATTTAAAGGCCATAGTGAGTTTC
CAAGGTAGCAAGATAACAAATTATATCGTTAATCCTGGGTGGCTTCTCAG
GAATATTGTCGGCATAAATTTTATTTTTTTAACATTAGATAAAATAGATT
TTTCGTCACATCTGGAGTGAGTAGCAGTCAGCATTATTCCAATTTGCCGT
ATAAAGTATATTATTCCAATAATAAAATGCAAGCCACCTTATAATTATTA
TATCCAGTTTCTCCCTTCATGAATAAAATATAAAGCTAACTCGAACTTTT
AATCCTAATTCCAAACAAGCGGGATATACAAAGTCTTCCCTGTCTTAAAT
TTGTTAATTACTAATTTGACGTTTTGATAAACATGTAGATCGCGTGCACT
TGTCAATCTTTACAATTGGATTGTCGAAATTGTATTATATATTTGTATTT
GTAAACTAGATCTTTTATCTTCCTAAATTCTGGGGATTTTTCATTGGTGA
CTTCCTGTGATTTTATCTACTTATTTAGCTTTCTTCGTTCTCGAACTCAC
TTGACTAGGCAAATATAATCATTGAATCTGTGAATAAAGGAATTGGATGC
ATTAAAGTTGTAGGAGCATCAACTTACGGATATTTCCTAATAATAAAGAC
TGACGTGTTTGAATTCATAGATAAATTTCTGCTCAAATTTAGTTGACAAA
TATAAGTGTTTATGGAAGATTTTCTTATGTATTTAGCATATACAAAATAT
CCATGAATATATAAGTTGGACGGATTTAACTTAATGCCACAAGGACTTTC
ACACAGGCCCATAAATATTGGGTTCAATACAAAAACTTCTCCATAACTAA
TAAAACTCGCAAATTTAATGAAAATTTAACTACGCAAAATTTTAGTTTTC
TATACAGAGCCCCAAAAGTTAAGGCATGGAGCTAATTCCTGGCTAGAAAC
AAATTGTGGGTCACTCTGTGTTAAACGCATTTTTGATCATCAAAATAGTT
TTTATATATAGTAAGATTTAATGTAAAAAATAAATTTTGATGGTAAAAAG
TAACTCGGACGTCATTTCAGTAGAAACAAGACCTCGACTGTACCGGTAAT
GTGAATAGTACTGCGGGTTTATTATCAAATCACGCTTGGTACCAGTCTAA
TGACAATGAGCATCCTAATTCACTGAATAATCCAAAAGTATTTCTACAAT
ATGTTTTTAATTATCATGTCAAATGAACGAAAGTAGATAAGTCATCAACA
ATGACTTAATCATTGATAATTATTATTCACACAATTCTCTACGCAACATC
TAAATTAATCTTTCTGAGAACCTCGCAAGTAGTAAACCCATTGTAAATTG
TTCAGTCCGTTTTCTGCTTCAGGACATGTGACCACGAGCTTGCCCATGAC
CGGGCCTCCATCTGCTGACCCATCAAATGCAATTACCATTCTGTGATCCT
TATGCGATTTGATATTTTCGGAATTCTTATTTATATGGAATTCAGTACTG
TCAATTTGGAAATAGAACTGAGCTGCTTCTACAAAAACATTTCTAAAGCT
AATTGAAACACTTGATCCAGGCTTGATGATGAAAGGTCCTTGTGGCTTAG
GGGGAGTTGCAACCCCTACCAATGGGAATATAAATTCTCCGGCCACTTGA
TTTGAAATTGTTAGCAGGCCCTTTGATTCACCGAGTTTGTTTGGTTCAAA
TTGCACTTCCAGCTGTGCCTCGACATTCGGAGCTACTGTTATCGACTTAT
CACAATGGAATTTCGTATTATCGATCTAAATAATTTCATGAAAATAGATT
TTCTGATAATTTTTTAATTTACTTTGCATGAAAAATCTGATTTATTTTTC
GCCCAATTTTTAAAATGAGCCAACAATGTCTGACAGCTCCCAATACCGGT
GTTGAAAATCAGAGGTTGCTCTGGCCTTGAAGGAGTACCAGATAGTTCCA
GGTCATAAAACATACTACTAGAGTCTGGCGAGGAAATCTCAAGTTTAGCT
ACAGACTCAGCCACTCGCAACGGAAAGAATTCAAAAGTGAAGGGAATCTA
GAAGATATTTATATAAACAATTATGCACAATTATGAAATAGAATTTGTAA
CTATTCTGTGATATTATTATTATTAACCATATAATCTAATGTTCTCCTCC
TTGCCTACAGTATAATATCGGAACAATGCAAGATAATGTTGGTTGAATAG
ATGTAATTCCTTCAATTTCTTTCGACCCCCTTTTTTATTCAATTATTTAT
TCAACTAGCTGTAACCCTTTCTTTGTTTGAAGTTAAGATTTACATTAATA
AATTTATTTTCTAGCGGTC
back to top

protein sequence of SMED30010437-orf-1

>SMED30010437-orf-1 ID=SMED30010437-orf-1|Name=SMED30010437-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MELEVCVDSLTSAKAAINGGADRLELCAGLHCDGLTPSIGFCRKIKEFCS
IPSYAIIRPRPGDFIYDNEELDVMLYDIDHLKEYADGFVIGCLRESGDIS
VDQTGLVIERIGSYPITFHRAIDASRNPLITINSLIQLANQYMPPHCPFR
VLTSGGSPAALEGSDVIRQLVGQVGRGVYCTDIDRVYIQVASSGIQIMAG
QYIKGTERATGRVMARIHLSGDCLSYWIWGGRGSTPSLSRYRSARHWDTF
IAPYTVSAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: biological process
TermDefinition
GO:0006878cellular copper ion homeostasis
GO:0055070copper ion homeostasis
Vocabulary: INTERPRO
TermDefinition
IPR036822CutC_dom_sf
IPR005627Cu_homeostasis_CutC
IPR023648Cu_homeostasis_CutC_dom
Vocabulary: molecular function
TermDefinition
GO:0005507copper ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036822Copper homeostasis (CutC) domain superfamilyGENE3DG3DSA:3.20.20.380coord: 1..226
e-value: 1.4E-55
score: 190.0
IPR036822Copper homeostasis (CutC) domain superfamilySUPERFAMILYSSF110395CutC-likecoord: 1..184
IPR023648Copper homeostasis CutC domainPFAMPF03932CutCcoord: 1..176
e-value: 6.2E-47
score: 159.7
IPR005627Copper homeostasis protein CutCPANTHERPTHR12598COPPER HOMEOSTASIS PROTEINcoord: 1..174