Acid-sensing ion channel 4

Overview
NameAcid-sensing ion channel 4
Smed IDSMED30010425
Length (bp)2030
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acid-sensing ion channel 4 (SMED30010425) t-SNE clustered cells

Violin plots show distribution of expression levels for Acid-sensing ion channel 4 (SMED30010425) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acid-sensing ion channel 4 (SMED30010425) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acid-sensing ion channel 4 (SMED30010425) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010425

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010425h1SMcG0003218 SmedASXL_011169SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:HGNC Symbol;Acc:HGNC:21263])

HSP 1 Score: 61.2326 bits (147), Expect = 5.285e-9
Identity = 77/326 (23.62%), Postives = 121/326 (37.12%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTG-APQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHC-IKHEQWVP------------CMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPEN-CLCTKRCDQVDYKFESITQSIKNNIFSVFL 965
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG  P+D          R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C  + E   P            C   C ++++   C+C ++          M   L  G       PE  C C   C+   Y  E     I N   + +L
Sbjct:  210 YQAAGLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPPKD----------RDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMV---------HMPDSLGGG-------PEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYL 506          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:HGNC Symbol;Acc:HGNC:21263])

HSP 1 Score: 60.4622 bits (145), Expect = 7.139e-9
Identity = 57/220 (25.91%), Postives = 89/220 (40.45%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTG-APQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG  P+D          R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:  210 YQAAGLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPPKD----------RDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYL 416          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 58.151 bits (139), Expect = 2.618e-8
Identity = 51/194 (26.29%), Postives = 81/194 (41.75%), Query Frame = 3
Query:  201 LPTISICNINPVKGSALL-NAAYKTGA------PQDYELFIDSLNGRINTDVPFQRLTRPIF---QIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
             P +++CNINP++ S L  N  +  G+      P ++  F+ +L GR      F  +  P F   Q+  +A H L DML  C    + C   NFT      G C+TFN               + + + ++LD +  +YL             G RV IHS  +P  +   L   V P + T++     +  +L
Sbjct:   86 FPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRAL-GRPPAPPGF--MPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQ-LGLGVSPGYQTFVSCQQQQLSFL 275          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 58.151 bits (139), Expect = 2.618e-8
Identity = 51/194 (26.29%), Postives = 81/194 (41.75%), Query Frame = 3
Query:  201 LPTISICNINPVKGSALL-NAAYKTGA------PQDYELFIDSLNGRINTDVPFQRLTRPIF---QIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
             P +++CNINP++ S L  N  +  G+      P ++  F+ +L GR      F  +  P F   Q+  +A H L DML  C    + C   NFT      G C+TFN               + + + ++LD +  +YL             G RV IHS  +P  +   L   V P + T++     +  +L
Sbjct:   86 FPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRAL-GRPPAPPGF--MPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQ-LGLGVSPGYQTFVSCQQQQLSFL 275          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Match: ASIC2 (acid sensing ion channel subunit 2 [Source:HGNC Symbol;Acc:HGNC:99])

HSP 1 Score: 58.5362 bits (140), Expect = 3.015e-8
Identity = 70/310 (22.58%), Postives = 109/310 (35.16%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALL-NAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP---------------------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKHEQWV---------PCMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V+     V  S+  P +++CN+N  + S L  N  Y  G   +    +D     +N  +P   L  P                     + + + +  H LKDM+  C    ++C H +FT      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL      C   E  +          C   C  + I   CNC +  M  +A  CT     +C               CLC   C+   Y  E
Sbjct:   73 VTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAG---ELLALLD-----VNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYL-PIWGETEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKE 372          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Celegans
Match: delm-1 (DEgenerin Linked to Mechanosensation [Source:UniProtKB/TrEMBL;Acc:O45402])

HSP 1 Score: 51.6026 bits (122), Expect = 1.644e-6
Identity = 96/424 (22.64%), Postives = 165/424 (38.92%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVI-SSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRIN--TDVPF-------QRLTR------------PIF---QIIDKASHKLKDMLKLCSIGKKK---CSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVH---------DYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-----RHCIKHEQW----------VPCMHHCFEKSIFNACNC----YLMGKN--ACTFSHIMKC---GLNFGNFK----EYAIPENCLCTKRCDQVDYKFESIT----QSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSI 1097
            ++F+++++L +  L  Y+  I    YLS   K +VS  +  +    M+ P++++CN  P++ S  + A  +TG     ++  D +N  +N  T++P        Q L +            P F   Q    AS    D++KLCS   +    CS    + +L P G CFT +          E  I+  ++L LD  +          D L+PN    GFR  +H   D +         V PN   Y  ++      L      +C +   +            C+  C  K   N C C    Y +G N   CT      C    L+  N +    E+  P    C ++CD   Y+ ++       +   N F+     WSV+           +S+   +  F R+ + T +++++  SI
Sbjct:   94 KLFWLIMVLGSLGLLIYQCWILSASYLS---KPIVSQVSFLIPEDGMEFPSVTVCNFTPIRKS-YIEAMNRTG-----DVSPDMINYLMNWFTEIPILLGNTDQQSLNKGNEELREYQSIHPNFTVDQFFMDASFDCSDLMKLCSFQGESFDCCSLA--SPTLTPVGKCFTLDLSKSPMNKQTEPGIRAGLSLTLDANLDEQFDSSTGIDALLPNSFVNGFRYFVHP-KDTIPNLASDEYTVSPNSVAYSAISKFRYVLLPPNDWGNCTEDYPYGIQSNLSYTSGNCLSLCKAKYFMNQCGCTPALYNIGNNFQECTPFETYNCVNNSLSLLNEETGKMEFQPPSCTRCGQQCDSQVYRADNSNGNQFSAGAFNYFNSKNSSWSVD---------YMKSNFQMIRIFYRDMSYTEYNQVQDASI 496          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 75.485 bits (184), Expect = 9.759e-14
Identity = 78/292 (26.71%), Postives = 118/292 (40.41%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQ-IIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIK-HEQWVP---------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V++        M  P ++ICNIN  + SAL +A     A  TG P   +      +G   TD+ +     P  Q I ++  H+L++MLK C+   + CS  +FT      G C+TFN         K+  + + + ++LD +  DYL            AG RV IHS  +P ++   L   V P F T++        YL     +C    EQ +P         C   C    +   C C ++      N CT S I KC        + +  + C C   C+   Y  E
Sbjct:   97 VTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPKNK------DGHKPTDLEY---PAPDMQDIFNRTGHQLEEMLKSCNFSGQNCSAEDFTVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIMLDIQQDDYLPIWKETNETSLEAGIRVQIHSQDEPPYIH-QLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSTSEQMIPGYDTYSISACRLRCETLEVLRECKCRMVHMPGDANICTPSDI-KCVDKALALLQKSSGDTCFCETPCNLTRYGKE 377          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Match: asic4b (acid-sensing (proton-gated) ion channel family member 4b [Source:NCBI gene;Acc:407667])

HSP 1 Score: 66.6254 bits (161), Expect = 5.966e-11
Identity = 69/280 (24.64%), Postives = 112/280 (40.00%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHC-IKHEQWVP---------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P I++CN+N  + SAL +A     A  TG P        S  G   +++ +      +  I  +  H+L+DMLK C+   + CS  +F+      G C+TFN         ++    + + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C    E  +P         C  HC    +   CNC ++      + C  S I KC        + +  ++C C   C+   Y  E
Sbjct:  112 LTFPAITLCNVNRFRFSALTDADIYHLANLTGLPPK------SRKGHRPSELQYPPPN--MLDIFQRTGHQLEDMLKSCNFSGQNCSSEDFSVVYTRYGKCYTFNGNKTSPKRVRQGGTGNGLEMMLDIQQDEYLPIWRETNETTLEAGIRVQIHSQNEPPYIH-QLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRASSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMPGDADICAPSKI-KCVDKALASLQKSTGDSCPCETPCNLTRYGKE 381          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 58.5362 bits (140), Expect = 1.621e-8
Identity = 76/339 (22.42%), Postives = 120/339 (35.40%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALL-NAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP---------------------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKHE---------QWVPCMHHCFEKSIFNACNC---YLMGKNA-CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEK--NRQEK 1001
            V+S    V  S+  P +++CN+N  + + L  N  Y  G   +    +D     ++  +P   L  P                     + +  ++  H LK+M+  C    ++CSH +F       G C+ FN            +    + + ++LD +  +YL P  G        AG RV IHS  +P ++   L   V P F T++        YL      C+                C   C  + I   CNC   Y+ G +  CT      C              NC+C   C+   Y  E     I +   + +L     EK  NR EK
Sbjct:   94 VTSVDAVVSGSLVFPAVTVCNLNAYRFTRLTQNDLYHAG---ELLALLD-----VHLQIPEPHLAEPHVLAFLTEKSNFTNYRPKPFSMREFTERVGHDLKEMMLYCRFQGQECSHQDFKTVFTRYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIMLDIQQDEYL-PVWGETEETAFEAGVRVQIHSQAEPPFVH-ELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRALDSGLFQVYSVSACRIECETRYIVENCNCRMVYMPGDSPYCTPEQYKDCAEPALAALSAVEGTNCICRSPCNMTRYNKELSMVKIPSKTSARYL-----EKKFNRSEK 417          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 58.5362 bits (140), Expect = 1.621e-8
Identity = 76/339 (22.42%), Postives = 120/339 (35.40%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALL-NAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP---------------------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKHE---------QWVPCMHHCFEKSIFNACNC---YLMGKNA-CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEK--NRQEK 1001
            V+S    V  S+  P +++CN+N  + + L  N  Y  G   +    +D     ++  +P   L  P                     + +  ++  H LK+M+  C    ++CSH +F       G C+ FN            +    + + ++LD +  +YL P  G        AG RV IHS  +P ++   L   V P F T++        YL      C+                C   C  + I   CNC   Y+ G +  CT      C              NC+C   C+   Y  E     I +   + +L     EK  NR EK
Sbjct:   94 VTSVDAVVSGSLVFPAVTVCNLNAYRFTRLTQNDLYHAG---ELLALLD-----VHLQIPEPHLAEPHVLAFLTEKSNFTNYRPKPFSMREFTERVGHDLKEMMLYCRFQGQECSHQDFKTVFTRYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIMLDIQQDEYL-PVWGETEETAFEAGVRVQIHSQAEPPFVH-ELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRALDSGLFQVYSVSACRIECETRYIVENCNCRMVYMPGDSPYCTPEQYKDCAEPALAALSAVEGTNCICRSPCNMTRYNKELSMVKIPSKTSARYL-----EKKFNRSEK 417          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Match: asic1c (acid-sensing (proton-gated) ion channel 1c [Source:NCBI gene;Acc:407670])

HSP 1 Score: 54.299 bits (129), Expect = 3.793e-7
Identity = 75/348 (21.55%), Postives = 123/348 (35.34%), Query Frame = 3
Query:  192 SMKLPTISICNINPVKGS--------------ALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIID---KASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------RHCIKHEQW------VPCMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            ++  P ++ CN+N  + S              ALLN  Y+   P   +  + +L   +     F       F + D   +  H + +ML  CS   ++C  +NFT      G C+TFN  +              + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       R      ++        C   C  + +   CNC ++        CT      C     +F      + C+C   C+   Y                    KF    Q I +NI    +F    + EK  Q+KA ++
Sbjct:   86 NLTFPAVTFCNLNEFRFSKITKNDLYHVGELLALLNENYQIANPHLADPEVLTL---LKEKASFNGFKPKQFNMTDFYNRTGHDINEMLLQCSFRGEECFPLNFTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYL-PVWGDTDETSYEAGIKVQIHSQDEPPFID-QLGFGVAPGFQTFVSCQQQLLLYLPPPWGDCRSAPMDSEYFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDCADPALDFLVEKDNDYCVCDTPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYITDNILVLDIFFEALNYEKIEQKKAYEV 428          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:100489966])

HSP 1 Score: 58.151 bits (139), Expect = 3.410e-8
Identity = 71/291 (24.40%), Postives = 105/291 (36.08%), Query Frame = 3
Query:  183 VISSMKLPTISICNIN---PVKGSA--LLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNA------------------CNC---YLMGKNA-CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V   M  P ++ CN N   P + SA  LL  A   GAP+D E            D         +++I D+ SH+L DM+  C     +C   +F       G C+TFN            +    + + L+LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL        W  C     +   F+                   CNC   ++ G  A CT     +C     +F      + C+C   C+   Y  E
Sbjct:  106 VAKRMFFPAVTFCNCNRFRPSQLSADELLYLAPLIGAPEDGEATFTQTPSDSKYD---------LYEITDRTSHQLSDMMLECRYQGAECDADDFIPVFTRYGKCYTFNSGRNGRSPLVTTKGGTGNGLELMLDIQQDEYL-PVWGETDETSFEAGIKVQIHSQDEPPFIDQ-LGFGVAPGFQTFVSCQEQRLTYL-----PPPWGDCKSSAMDSEFFDTYSISACRIDCETRYLVENCNCRMVHMPGDAAYCTPELYKECADPALDFLVEKDNDFCVCETPCNMTRYGKE 380          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Match: cspg4 (chondroitin sulfate proteoglycan 4 [Source:Xenbase;Acc:XB-GENE-5893460])

HSP 1 Score: 54.299 bits (129), Expect = 5.679e-7
Identity = 69/296 (23.31%), Postives = 104/296 (35.14%), Query Frame = 3
Query:  195 MKLPTISICNINPVK-----GSALLNAAY--------KTGAPQDYELFIDSLNGRINTDVPFQRLTRP------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------RHCIKHEQWVP------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P ++ CN NPV+      S L  A Y        +T  P   EL  +           F+    P          +D+  H+L+DML  C    + C   NF+      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       R       + P      C   C  + I   C C +  M  +A  CT     +C     +        NC+CT  C+   Y  E
Sbjct:   56 LAFPAVTFCNNNPVRFHRLSKSDLYFAGYWLGLLFANRTARPMLAELLPEDRRKWFQKLADFRLFLPPRNFDGISVGFMDRLGHQLEDMLLSCKYRGEACGPHNFSTVFTRYGKCYMFNSGQDGRPVLTTVKGGAGNGLEIMLDIQQDEYL-PIWGDTEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPSPWGACRFSELGSDFFPVYSISACRIDCETRYIVENCGCKMVHMPGDAPFCTPEQYKECAEPALDLLAEKDGGNCVCTIPCNVTRYNKE 349          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Match: cspg4 (chondroitin sulfate proteoglycan 4 [Source:Xenbase;Acc:XB-GENE-5893460])

HSP 1 Score: 54.299 bits (129), Expect = 6.084e-7
Identity = 69/296 (23.31%), Postives = 104/296 (35.14%), Query Frame = 3
Query:  195 MKLPTISICNINPVK-----GSALLNAAY--------KTGAPQDYELFIDSLNGRINTDVPFQRLTRP------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------RHCIKHEQWVP------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P ++ CN NPV+      S L  A Y        +T  P   EL  +           F+    P          +D+  H+L+DML  C    + C   NF+      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       R       + P      C   C  + I   C C +  M  +A  CT     +C     +        NC+CT  C+   Y  E
Sbjct:  101 LAFPAVTFCNNNPVRFHRLSKSDLYFAGYWLGLLFANRTARPMLAELLPEDRRKWFQKLADFRLFLPPRNFDGISVGFMDRLGHQLEDMLLSCKYRGEACGPHNFSTVFTRYGKCYMFNSGQDGRPVLTTVKGGAGNGLEIMLDIQQDEYL-PIWGDTEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPSPWGACRFSELGSDFFPVYSISACRIDCETRYIVENCGCKMVHMPGDAPFCTPEQYKECAEPALDLLAEKDGGNCVCTIPCNVTRYNKE 394          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Match: cspg4 (chondroitin sulfate proteoglycan 4 [Source:Xenbase;Acc:XB-GENE-5893460])

HSP 1 Score: 53.9138 bits (128), Expect = 6.586e-7
Identity = 69/296 (23.31%), Postives = 104/296 (35.14%), Query Frame = 3
Query:  195 MKLPTISICNINPVK-----GSALLNAAY--------KTGAPQDYELFIDSLNGRINTDVPFQRLTRP------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------RHCIKHEQWVP------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P ++ CN NPV+      S L  A Y        +T  P   EL  +           F+    P          +D+  H+L+DML  C    + C   NF+      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       R       + P      C   C  + I   C C +  M  +A  CT     +C     +        NC+CT  C+   Y  E
Sbjct:   95 LAFPAVTFCNNNPVRFHRLSKSDLYFAGYWLGLLFANRTARPMLAELLPEDRRKWFQKLADFRLFLPPRNFDGISVGFMDRLGHQLEDMLLSCKYRGEACGPHNFSTVFTRYGKCYMFNSGQDGRPVLTTVKGGAGNGLEIMLDIQQDEYL-PIWGDTEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPSPWGACRFSELGSDFFPVYSISACRIDCETRYIVENCGCKMVHMPGDAPFCTPEQYKECAEPALDLLAEKDGGNCVCTIPCNVTRYNKE 388          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Match: cspg4 (chondroitin sulfate proteoglycan 4 [Source:Xenbase;Acc:XB-GENE-5893460])

HSP 1 Score: 53.9138 bits (128), Expect = 6.925e-7
Identity = 69/296 (23.31%), Postives = 104/296 (35.14%), Query Frame = 3
Query:  195 MKLPTISICNINPVK-----GSALLNAAY--------KTGAPQDYELFIDSLNGRINTDVPFQRLTRP------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------RHCIKHEQWVP------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P ++ CN NPV+      S L  A Y        +T  P   EL  +           F+    P          +D+  H+L+DML  C    + C   NF+      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       R       + P      C   C  + I   C C +  M  +A  CT     +C     +        NC+CT  C+   Y  E
Sbjct:  108 LAFPAVTFCNNNPVRFHRLSKSDLYFAGYWLGLLFANRTARPMLAELLPEDRRKWFQKLADFRLFLPPRNFDGISVGFMDRLGHQLEDMLLSCKYRGEACGPHNFSTVFTRYGKCYMFNSGQDGRPVLTTVKGGAGNGLEIMLDIQQDEYL-PIWGDTEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPSPWGACRFSELGSDFFPVYSISACRIDCETRYIVENCGCKMVHMPGDAPFCTPEQYKECAEPALDLLAEKDGGNCVCTIPCNVTRYNKE 401          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 62.003 bits (149), Expect = 1.694e-9
Identity = 56/219 (25.57%), Postives = 87/219 (39.73%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG P            R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:   83 YQAASLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPP---------KDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYL 289          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 62.003 bits (149), Expect = 1.824e-9
Identity = 56/219 (25.57%), Postives = 87/219 (39.73%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG P            R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:   83 YQAASLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPP---------KDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYL 289          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Match: Asic2 (acid-sensing (proton-gated) ion channel 2 [Source:MGI Symbol;Acc:MGI:1100867])

HSP 1 Score: 58.5362 bits (140), Expect = 2.017e-8
Identity = 70/310 (22.58%), Postives = 109/310 (35.16%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALL-NAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP---------------------IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKHEQWV---------PCMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V+     V  S+  P +++CN+N  + S L  N  Y  G   +    +D     +N  +P   L  P                     + + + +  H LKDM+  C    ++C H +FT      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL      C   E  +          C   C  + I   CNC +  M  +A  CT     +C               CLC   C+   Y  E
Sbjct:   73 VTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAG---ELLALLD-----VNLQIPDPHLADPTVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYL-PIWGETEETTFEAGVKVQIHSQSEPPFIQ-ELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKE 372          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Match: Asic1 (acid-sensing (proton-gated) ion channel 1 [Source:MGI Symbol;Acc:MGI:1194915])

HSP 1 Score: 55.4546 bits (132), Expect = 1.873e-7
Identity = 81/351 (23.08%), Postives = 122/351 (34.76%), Query Frame = 3
Query:  189 SSMKLPTISICNINPVKGS--------------ALLNAAYKTGAPQ-----DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL-------------RHCIKHEQWVPCMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            S +  P +++CN+N  + S              ALLN  Y+    Q       E+  D  N R     PF      + +  D+A H ++DML  C    + CS  +F       G C+TFN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL                        C   C  + +   CNC +  M  +A  CT     +C     +F      E C+C   C+   Y                    KF    Q I  NI    +F    + E   Q+KA +I
Sbjct:   83 SQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFN-----MREFYDRAGHDIRDMLLSCHFRGEACSAEDFKVVFTRYGKCYTFNSGQDGRPRLKTMKGGTGNGLEIMLDIQQDEYL-PVWGETDETSFEAGIKVQIHSQDEPPFID-QLGFGVAPGFQTFVSCQEQRLIYLPSPWGTCNAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEI 426          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Match: Asic3 (acid-sensing (proton-gated) ion channel 3 [Source:MGI Symbol;Acc:MGI:2159339])

HSP 1 Score: 54.6842 bits (130), Expect = 2.715e-7
Identity = 53/243 (21.81%), Postives = 96/243 (39.51%), Query Frame = 3
Query:   54 LIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALL-NAAYKTGA------PQDYELFIDSLNGRINTDVPFQRLTRPIF---QIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYL-----IPNVGY-AGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            L R  +   +LL+     Y++   ++ Y     K  +    ++ ++    P +++CNINP++ S L  N  +  G       P ++  ++ +L        P   +  P F   Q+  +A H L+DML  C    + C   NFT      G C+TFN                 + + ++LD +  +YL     +    +  G RV IH   +P  +   L     P   T++     +  +L
Sbjct:   41 LRRGLWATAVLLSLAAFLYQVAERVRYYGEFHHKTTLDERESHQLT---FPAVTLCNINPLRRSRLTPNDLHWAGTALLGLDPAEHAAYLRALG---QPPAPPGFMPSPTFDMAQLYARAGHSLEDMLLDCRYRGQPCGPENFTVIFTRMGQCYTFNSGAQGAELLTTPKGGAGNGLEIMLDVQQEEYLPIWKDMEETPFEVGIRVQIHGQEEPPAIDQ-LGFGAAPGHQTFVSCQQQQLSFL 276          
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Match: sp|Q708S4|ASI4A_DANRE (Acid-sensing ion channel 4-A OS=Danio rerio OX=7955 GN=asic4a PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.114e-13
Identity = 78/292 (26.71%), Postives = 118/292 (40.41%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQ-IIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIK-HEQWVP---------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V++        M  P ++ICNIN  + SAL +A     A  TG P   +      +G   TD+ +     P  Q I ++  H+L++MLK C+   + CS  +FT      G C+TFN         K+  + + + ++LD +  DYL            AG RV IHS  +P ++   L   V P F T++        YL     +C    EQ +P         C   C    +   C C ++      N CT S I KC        + +  + C C   C+   Y  E
Sbjct:   97 VTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPKNK------DGHKPTDLEY---PAPDMQDIFNRTGHQLEEMLKSCNFSGQNCSAEDFTVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIMLDIQQDDYLPIWKETNETSLEAGIRVQIHSQDEPPYIH-QLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSTSEQMIPGYDTYSISACRLRCETLEVLRECKCRMVHMPGDANICTPSDI-KCVDKALALLQKSSGDTCFCETPCNLTRYGKE 377          
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Match: sp|Q9JHS6|ASIC4_RAT (Acid-sensing ion channel 4 OS=Rattus norvegicus OX=10116 GN=Asic4 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.927e-10
Identity = 62/237 (26.16%), Postives = 95/237 (40.08%), Query Frame = 3
Query:   54 LIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            L R  +VL LL +     Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG P            R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:   65 LRRTLWVLALLTSLAAFLYQAASLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPP---------KDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQKQRLTYL 289          
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Match: sp|Q708S3|ASI4B_DANRE (Acid-sensing ion channel 4-B OS=Danio rerio OX=7955 GN=asic4b PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.504e-10
Identity = 69/280 (24.64%), Postives = 112/280 (40.00%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHC-IKHEQWVP---------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P I++CN+N  + SAL +A     A  TG P        S  G   +++ +      +  I  +  H+L+DMLK C+   + CS  +F+      G C+TFN         ++    + + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C    E  +P         C  HC    +   CNC ++      + C  S I KC        + +  ++C C   C+   Y  E
Sbjct:  112 LTFPAITLCNVNRFRFSALTDADIYHLANLTGLPPK------SRKGHRPSELQYPPPN--MLDIFQRTGHQLEDMLKSCNFSGQNCSSEDFSVVYTRYGKCYTFNGNKTSPKRVRQGGTGNGLEMMLDIQQDEYLPIWRETNETTLEAGIRVQIHSQNEPPYIH-QLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRASSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMPGDADICAPSKI-KCVDKALASLQKSTGDSCPCETPCNLTRYGKE 381          
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Match: sp|Q7TNS7|ASIC4_MOUSE (Acid-sensing ion channel 4 OS=Mus musculus OX=10090 GN=Asic4 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.276e-8
Identity = 56/219 (25.57%), Postives = 87/219 (39.73%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG P            R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:   83 YQAASLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPP---------KDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYL 289          
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Match: sp|Q96FT7|ASIC4_HUMAN (Acid-sensing ion channel 4 OS=Homo sapiens OX=9606 GN=ASIC4 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 2.538e-8
Identity = 77/326 (23.62%), Postives = 121/326 (37.12%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTG-APQDYELFIDSLNGRINTDVPFQRLTRP-IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHC-IKHEQWVP------------CMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPEN-CLCTKRCDQVDYKFESITQSIKNNIFSVFL 965
            Y+     + YL+      +  A    ++    P +++CNIN  + SAL +A     A  TG  P+D          R        R   P +  I+++  H+L DMLK C+     CS  NF+      G C+TFN         +   +   + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C  + E   P            C   C ++++   C+C ++          M   L  G       PE  C C   C+   Y  E     I N   + +L
Sbjct:  210 YQAAGLARGYLTRPHLVAMDPAAPAPVAG--FPAVTLCNINRFRHSALSDADIFHLANLTGLPPKD----------RDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMV---------HMPDSLGGG-------PEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYL 506          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A5J4NZL5 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0009266 PE=3 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 1.813e-119
Identity = 220/674 (32.64%), Postives = 341/674 (50.59%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQ----DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIF---SVFL-------------PPWSVEK---------------------NRQEKAKK-IQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQ-----------------------EKLLNIDRTS---CLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEE-------------NIKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQ--SLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKC 1832
            R FY+++ L  A LT YR+ +W+  Y  ++SK ++S+   +    +  P ++ICNINP +G  L N   +T  P     DYE+F D+  GR+  + P  RL  PI+QI+D+ASH+L DMLK C +G ++CS  NFTKS+LPTG C+TFN +    D+I L+LDP+ +DY+IPN G+ GFRVL+H   DPLW  +P + Y GP FHT +RV  ++K Y +HC+   QW  CMH C +  + N C CY+     CT  ++M CG+   +  E   P  C C   CD + Y  ESI Q++K  +F   S F              P   V+                      NR E  ++ I + SLIQLWAFLRE+N TAF++LR+LS  L+ L   +  +E+ +   Q                        K     +TS   C+   +  +   ++   G EFVR  + S L +D++  P E  HIHLV LFF  + +E + +   +QH+D  + ++M     K   C        + P   +   +              ++S +    LQ + L     FK  +    +    N  +I+  S+    H  T     ++ VTLT+ + ++ N   ++ES+Q +++P   +ID+++SGL++AF+ + LL+ C
Sbjct:   67 RGFYLVVCLAIASLTTYRVHLWLTQYTKMASKMMISAYDEHQ-RDLPFPLVTICNINPTRGHELYNP--QTSNPVNRGLDYEMFSDAYQGRVMENAPRNRLRIPIYQIVDRASHRLTDMLKGCFMGHRRCSAKNFTKSILPTGPCYTFNGQTDDLDEIQLILDPQSYDYMIPNQGFIGFRVLLHGRGDPLWATIPGAVYAGPTFHTMLRVVGLKKVYKQHCVPQTQWARCMHQCMQDMLHNRCRCYMAD---CTLLNMMHCGVKMSSMIENLPPSQCKCQNPCDIITYSIESIIQALKAPLFAHTSSFFATGEFASNSDHHQPTQKVDPFLYTAQQSNDDSHVEVKHPFNNRLEAYRQEIWEGSLIQLWAFLRESNRTAFEQLRQLSRLLQSLNMDLQTVERAVTSVQFTQGTRETNLSPFMWDVKSSSMPLKATESKQTSGDLCIDGEEYARMLARVRRLGEEFVRLFRQSILFRDVSKVPGEDFHIHLVRLFFLRMRNEFDRLASQLQHNDLFSDVTMLDLQRKTHQCEQTAAAKVQPPKLAKNRSDWIGTYADPSRIQLTVESSEDIASLQAVLLATDSQFKQLRTAFTKLTAENQELIETVSVERLPHSPTLK-VDQSLVTLTIQLTRDRNRLVRLESVQTIFNPIAELIDLIVSGLVLAFLVVCLLDLC 733          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A4S2ME25 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002079 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.953e-111
Identity = 215/668 (32.19%), Postives = 348/668 (52.10%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQ--DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIF---------------------SVFLPPW--------------SVEKNRQEKAKKIQQSS-----LIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLF---------QEKLLNIDRTS-----------------CLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAP----RLDQSNKNPGFRETSEEN----IKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGYGETT-VTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKC 1832
            R   +L+ L+ A LT YR++ W+  Y +L+ K V+S A       +  P +++CNINP +G  L N    + A +  DYELF D++ GR+  + P  +L  PI++++D+ASH+L DMLKLC+ G   CS  NFTKS+LPTGAC+TF+   +  D+  L LDP+ +DY+IPN G+ GFR+L+H   DPLW  +P + Y GP FHT +RV  ++K Y ++C  H QW  CMHHC ++ ++  C+CY+   + CT  H+M+CG    +  E   P  C C   C+QV Y  ESITQ++K  +F                      +F P                +V +N + K K +Q++      LIQLWAFLRE+N TAF+E R L+  L+ L   +  +E+ +++          Q   +  D  +                 CL + +  +  +++   G EFVR  + S L +DL   P E  HIH+V LFF  +  EL+ +   +QH+D  + ++M     K   C       L   N++  +     +      +S      LQ + L     FK  ++   +    N  +I+ +     K+  + + E + VT+T+ + +++N   ++ES+Q++Y+P   + DI++SGL++AF+ + L++ C
Sbjct:   16 RTTCLLLCLIIATLTTYRVQTWLTHYGNLAPKMVIS-AYDEHQRELPFPLVTLCNINPARGLVLYNPNSPSQATRGLDYELFSDAIQGRVTENPPKGKLEIPIYRLMDQASHQLVDMLKLCTAGPSSCSAANFTKSILPTGACYTFHGSNNDFDEFQLTLDPQSYDYMIPNQGFVGFRILLHGKGDPLWGTMPGAVYAGPTFHTMLRVVGLKKIYRQNCAPHHQWAHCMHHCMQEMLYKQCHCYM---SHCTLLHMMRCGRKVHSMVENLPPSKCRCKNPCEQVTYSIESITQALKPPLFSHISRSIISSDAASLLSPKNDGLFAPEGLFAAPPKRVHKDVEAVNQNMEAKEKNLQKNEIKDGFLIQLWAFLRESNRTAFEEFRHLARLLQSLHMDLQIVERAVSVVHFTRHPSNPQHDPVKWDEATDRSKDGPKPDHSKDDGLCLESEEDARMLSRVRRLGEEFVRLFRQSVLFRDLKLIPGEDFHIHMVRLFFLRVQDELDHLASQLQHNDLFSDVTMLDLQRKAHQCKQTGNNHLTNGNRSSDWLSNLVDGHTRLTESSGDIASLQAVLLATDTQFKQLRSAFMKLTTDNQELIEMVPIEQLKRLSSFHVEQSLVTVTIQLTRDKNRLVRLESVQSIYNPLTELFDIIVSGLVLAFLALFLMDMC 679          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A4S2M806 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002079 PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 6.600e-110
Identity = 215/668 (32.19%), Postives = 348/668 (52.10%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQ--DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIF---------------------SVFLPPW--------------SVEKNRQEKAKKIQQSS-----LIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLF---------QEKLLNIDRTS-----------------CLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAP----RLDQSNKNPGFRETSEEN----IKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGYGETT-VTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKC 1832
            R   +L+ L+ A LT YR++ W+  Y +L+ K V+S A       +  P +++CNINP +G  L N    + A +  DYELF D++ GR+  + P  +L  PI++++D+ASH+L DMLKLC+ G   CS  NFTKS+LPTGAC+TF+   +  D+  L LDP+ +DY+IPN G+ GFR+L+H   DPLW  +P + Y GP FHT +RV  ++K Y ++C  H QW  CMHHC ++ ++  C+CY+   + CT  H+M+CG    +  E   P  C C   C+QV Y  ESITQ++K  +F                      +F P                +V +N + K K +Q++      LIQLWAFLRE+N TAF+E R L+  L+ L   +  +E+ +++          Q   +  D  +                 CL + +  +  +++   G EFVR  + S L +DL   P E  HIH+V LFF  +  EL+ +   +QH+D  + ++M     K   C       L   N++  +     +      +S      LQ + L     FK  ++   +    N  +I+ +     K+  + + E + VT+T+ + +++N   ++ES+Q++Y+P   + DI++SGL++AF+ + L++ C
Sbjct:   16 RTTCLLLCLIIATLTTYRVQTWLTHYGNLAPKMVIS-AYDEHQRELPFPLVTLCNINPARGLVLYNPNSPSQATRGLDYELFSDAIQGRVTENPPKGKLEIPIYRLMDQASHQLVDMLKLCTAGPSSCSAANFTKSILPTGACYTFHGSNNDFDEFQLTLDPQSYDYMIPNQGFVGFRILLHGKGDPLWGTMPGAVYAGPTFHTMLRVVGLKKIYRQNCAPHHQWAHCMHHCMQEMLYKQCHCYM---SHCTLLHMMRCGRKVHSMVENLPPSKCRCKNPCEQVTYSIESITQALKPPLFSHISRSIISSDAASLLSPKNDGLFAPEGLFAAPPKRVHKDVEAVNQNMEAKEKNLQKNEIKDGFLIQLWAFLRESNRTAFEEFRHLARLLQSLHMDLQIVERAVSVVHFTRHPSNPQHDPVKWDEATDRSKDGPKPDHSKDDGLCLESEEDARMLSRVRRLGEEFVRLFRQSVLFRDLKLIPGEDFHIHMVRLFFLRVQDELDHLASQLQHNDLFSDVTMLDLQRKAHQCKQTGNNHLTNGNRSSDWLSNLVDGHTRLTESSGDIASLQAVLLATDTQFKQLRSAFMKLTTDNQELIEMVPIEQLKRLSSFHVEQSLVTVTIQLTRDKNRLVRLESVQSIYNPLTELFDIIVSGLVLAFLALFLMDMC 679          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A4Z2CVJ7 (Acid-sensing ion channel 3 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007183 PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.349e-104
Identity = 213/681 (31.28%), Postives = 344/681 (50.51%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLN--AAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIF---------------------------------SVFLPPWSVEKNRQEKA------------------KKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEK-----------LLNIDRTS-------------CLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEEN-------IKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSL----ANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKCLN 1838
            ++  +L+ +  A L  YR+ +W+K Y SL+SK ++S A  +  S++  P +S+CNINP +G+ L N  +A       DYE+F D+  GR + ++P  +L   IF+++DKASH++  ML+ C IG++ CS +NFTKS+LP GAC+T + +++  D+I LVLDP+ +DYL+PN G+ GFR+L+H   D LW  +P + Y GP FHT +R   ++K Y +HC     W  CMH C ++ +   C+C L     CT   +M+CGL   +  E   P  C C   C+ V Y  ESITQ++K+ +                                  S  L   S + +  +K                   K++ Q  L+Q WAFLREAN TAF++LR+LS  L+ L   +  +E+ +     K           L + DR+S             C+   +  +   ++   G EFVR  + S L +D++  P    HIHLV LFF  +  EL+ +   + H+D  + ++M     K   C     Q+N +    +TS EN       + + D    LQ + L     FK  +    + V  N  +I+++    A+   K       E  VT+T+ + ++ N   ++ES+Q +Y P   ++D+++SGL+++F+ I LLN C++
Sbjct:   26 KLICLLLCISVACLITYRVHVWLKHYDSLASKMIIS-AYDDYQSNLPFPLVSVCNINPARGTKLYNIQSAESPDRGTDYEIFSDAFQGRPSENLPENKLQMSIFKLMDKASHRMDQMLRSCKIGQRHCSVLNFTKSILPNGACYTLSGDLAGIDEIQLVLDPQSYDYLVPNQGFVGFRILLHGYGDSLWALIPTAVYAGPTFHTILRAVGLKKIYKQHCTSQSIWASCMHDCMQEMLLEKCHCQLPD---CTVFDMMRCGLTMNSMIESLSPIQCRCHNPCEAVSYSVESITQALKSPLLFTHSLNVLEKVNQTNFEAISDYQQYFNKKILSKSQHLTTVSHDNHEHDKKSDKEINLNHPGHLLNIHRKEVWQGLLLQTWAFLREANRTAFEQLRQLSRLLQSLNLDLQTVERAVYKVHRKHRFNLEANDLVLWDSDRSSTSKHSSSEKSNGLCMDGEEHSRMLERVSRLGKEFVRLFRQSILFRDISIVPGLDFHIHLVRLFFLHVVDELDRLANQLLHNDLFSDVTMLDLQRKAHQCK----QTNDHLRHNDTSWENQLEQSHLVVASDDIASLQAVLLATDSQFKQLRTVFSKLVTDNRELIETVPIDRASLNAKPDSLTSTEGLVTITIQLTRDRNRLIRLESVQAIYSPIAELLDLIVSGLLLSFLSIFLLNICVS 698          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: G7YFD4 (Amiloride-sensitive cation channel 4-A OS=Clonorchis sinensis OX=79923 GN=CLF_106580 PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.904e-103
Identity = 201/624 (32.21%), Postives = 327/624 (52.40%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNAAYKTGAPQ--DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIF-------------SVFLP------------PWSVEKNRQE---------------KAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLF---------QEKLLNIDRTS-----------------CLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNY---------LQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGY-GETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKC 1832
            +  P +++CNINP +G  L N    +   +  DYELF D++ GR+  + P  +L  PI++++D+ASH+L DMLKLC+ G+  CS  NFTKS+LPTGAC+TF+   +  D+  L LDP+ +DY+IPN G+ GFR+L+H   DPLW  +P + Y GP FHT +RV  ++K Y +HC+ H QW  C+H C ++ ++  C+CY+   + CT  H+M+CG    +  E   P  C C   C+QV Y  ESITQ++K  +F             S+  P            P   ++ R++               + K+IQ   LIQLWAFLRE+N TAF+E R L+  L+ L   +  +E+ +++          Q+  +  D +S                 CL + +  +  +++   G EFVR  + S L +DL   P E  HIH+V LFF  +  EL+ +   +QH+D  + ++M     K   C    D    N G R +   ++    QT           LQ + L     FK  ++   +    N  +I+ +     K+  + +  ++ VT+T+ + +++N   ++ES+Q++Y+P   + DI++SGL++AF+ + L++ C
Sbjct:   13 LPFPLVTVCNINPARGLVLYNPNSPSQVSRGVDYELFSDAIQGRVTENPPKGKLEIPIYRLMDQASHQLVDMLKLCTAGQSSCSATNFTKSILPTGACYTFHGSNNDVDEFQLTLDPQSYDYMIPNQGFVGFRILLHGRGDPLWGTMPGAVYAGPTFHTMMRVVGLKKIYRQHCVPHHQWAHCIHQCMQEMLYKQCHCYM---SHCTLLHMMRCGRKMHSMVENLPPSKCRCNNPCEQVTYSIESITQALKPPLFSHISRSVISSDVASLLSPRTEASLSPDGLFPAPTKRVRKDSETGNQNMEAKEKNLRKKEIQDGFLIQLWAFLRESNRTAFEEFRHLARLLQSLHMDLQIVERAVSVVHFTHHPSSPQQDPVKWDDSSDRSKDGPKPNHSKDDGLCLESEEDARMLSRVRRLGEEFVRLFRQSVLFRDLKLIPGEDFHIHMVRLFFLRVVDELDHLASQLQHNDLFSDVTMLDLQRKAHQCKQTGDNHLTN-GNRSSDWLSMLVDGQTRLTESSGDIASLQAVLLATDTQFKQLRSAFIKLTTDNQELIEMVPIEQLKRLSSFHVDQSLVTVTIQLTRDKNRLVRLESVQSIYNPLTELFDIIVSGLVLAFLALFLMDMC 632          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 71.2478 bits (173), Expect = 1.741e-12
Identity = 73/291 (25.09%), Postives = 120/291 (41.24%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQ-IIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKH-EQWVP---------CMHHCFEKSIFNACNC---YLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            V++        M  P ++ICNIN  + SAL +A     A  TG P   +      +G   TD+ +     P  Q I ++  H+L +MLK C+   + CS  +F+      G C+TFN         K+  + + + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C    EQ +P         C  HC  +++   C C   ++ G +     + +KC        + +  ++C C   C+   Y  E
Sbjct:  100 VTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPKNK------DGHKPTDLEY---PAPDMQDIFNRTGHQLDEMLKSCNFSGQNCSAEDFSVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIMLDIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSSTEQLIPGYDTYSISACRLHCETQAVQQECQCRMVHMPGTDDICPPNKIKCVDRALALLQKSSGDSCPCETPCNLTRYGKE 380          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 70.4774 bits (171), Expect = 2.537e-12
Identity = 65/245 (26.53%), Postives = 104/245 (42.45%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQ-IIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHCIKH-EQWVP---------CMHHCFEKSIFNACNCYLM 791
            V++        M  P ++ICNIN  + SAL +A     A  TG P        + +G   TD+ +     P  Q I ++  H+L +MLK C+   + CS  +F+      G C+TFN         K+  + + + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C    EQ +P         C  HC  +++   C C ++
Sbjct:  100 VTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPK------NKDGHKPTDLEY---PAPDMQDIFNRTGHQLDEMLKSCNFSGQNCSAEDFSVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIMLDIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSSTEQLIPGYDTYSISACRLHCETQAVQQECQCRMV 334          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 66.6254 bits (161), Expect = 5.402e-11
Identity = 69/280 (24.64%), Postives = 113/280 (40.36%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL----RHC-IKHEQWVP---------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            +  P +++CN+N  + SAL +A     A  TG P        S  G    ++  Q     +  I  +  H+L+DMLK C+   + CS  +F+      G C+TFN         ++  + + + L+LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL     +C    E  +P         C  HC    +   CNC ++      + CT + + KC        + +  ++C C   C+   Y  E
Sbjct:  115 LTFPAVTLCNVNRFRFSALTDADIYHLANLTGLPPK------SRGGHRPGEL--QYPPPDMLDIFQRTGHQLEDMLKSCNFSGQNCSVHDFSVVYTRYGKCYTFNGNRTSAKRTRQGGMGNGLELMLDIQQDEYLPIWRETNETTLEAGIRVQIHSQDEPPYIH-QLGFGVSPGFQTFVSCQEQRLSYLPQPWGNCRASTEPVIPGYDTYSVSACRLHCESIQVQRECNCRMIHMPGSADICTPAKV-KCVDRALGLLQKSTGDSCPCETPCNVTRYGKE 384          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 65.855 bits (159), Expect = 8.041e-11
Identity = 80/365 (21.92%), Postives = 134/365 (36.71%), Query Frame = 3
Query:  108 YRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLN-----AAYKTGAPQ-DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            Y++   + DY S     ++    + +   M  P I++CN N  + S ++       A   G  Q D++ F+ +L   ++    F   T  + + + + SH + +ML  C    K C   NFT      G C+TFN  +              + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++       +YL       +  P             C   C  + +   CNC ++        CT      C     +F      + C+C   C+   Y                    KF    Q I +NI    +F    + EK  Q+KA ++
Sbjct:   56 YQVAGAVMDYYSYPHVTILDEMDSPL---MYFPAITLCNYNSFRRSKMIRNDLFWMAGMLGVEQSDFDDFMAALGQPVDDSKFFPSKTFNMLEFVQRTSHSIDEMLLDCKYRGKDCGPENFTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYL-PVWGDTDETSYEAGIKVQIHSQDEPPFIDQ-LGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTPIDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDCADPALDFLVEKDNDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEV 415          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 59.6918 bits (143), Expect = 6.026e-9
Identity = 88/404 (21.78%), Postives = 146/404 (36.14%), Query Frame = 3
Query:   51 FLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNA-AYKTGAPQDYELFIDSLNGRINTDV-----------------------PFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALP--LSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            +L+ +F  L LL T     +   +++  Y +++  ++V +       +M  P +++CN N  + S+L  A  Y +G    Y + I  LN  +N                          P  R      ++I +  H+L+DML  C    + CS  NFT      G C+TFN  +              + + ++LD +  +YL P  G        AG +V +HS  +P     P  L  +V P F T++       +YL       +  P             C   C  + +   CNC ++        CT      C     +F      + C+C   C+   Y                    KF    Q I +NI    +F    + EK  Q+KA ++
Sbjct:   41 WLLAMFVCLGLLFTW---SWNRILYLMSYPAVTKIYMVWA------HNMTFPAVTLCNQNLFRVSSLTKADLYHSG----YWMDIMHLNHSVNRQSLAMLKHSRHRERLMRLLDFAGYSPPARHKLSTTEMISRLGHQLEDMLLECRFRGENCSFRNFTPIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYL-PVWGDTDETSYEAGIKVQLHSQSEP---PFPNELGFWVTPGFQTFVSTQEQRLQYLPPPWGDCKSTPIDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDCADPALDFLVEKDNDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEV 427          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Sea Lamprey
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 50.447 bits (119), Expect = 1.015e-6
Identity = 67/283 (23.67%), Postives = 103/283 (36.40%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINT-DVPFQRLTRP-----IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE 920
            M  P I++CN N  + S +         P    L I   +  + T DV   RL R       ++  D+A H + +ML  C    ++C   NFT      G C+ FN            +    + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++        YL       +  P             C   C  + +   CNC +  M  +A  CT     +C     +F        C+C   C+   Y  E
Sbjct:  115 MLFPAITLCNFNSFRRSKVTPVDKHYAGPI---LGIPDNDPDLATVDV---RLLRAWSRYSTYEFYDRAGHTMDEMLLRCRYRDRECGPTNFTTVFTRYGKCYMFNSGKGGRPLLTTLKGGTGNGLEMMLDIQQDEYL-PVWGETDEISLEAGVKVQIHSQDEPPFVH-QLGFGVAPGFQTFVSCQEQRLIYLPSPWGDCKADPINSDFFDTYSITACRIDCETRYVVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNNYCVCDTPCNTTRYGKE 389          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Match: EDO39446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA83])

HSP 1 Score: 68.9366 bits (167), Expect = 2.417e-12
Identity = 99/406 (24.38%), Postives = 167/406 (41.13%), Query Frame = 3
Query:   90 TAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINT--DVPFQRLTRPIFQIIDKASHK----LKDMLKLCSIGKK-KCSHVNFTK-SLLPTGACFTFN----KEISIQDD--------ITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIR-----VNTVEKKYLRHCIKHEQWVP---CMHHCFEKSIFNACNCYLMGKNA-------CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPP---WSVEKNRQE------KAKKIQQ---SSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLE----KNINLF 1154
            T+++  Y+L    +  L  +S   V +   +   S+  P ISIC+ N ++ S +L         +D + ++D L+ +     D   Q  + P F I +KA H+    L   +K C  G+  KC+  +FT       G C+TFN    +   I  D        ITL   PE +  L  + G  GFRV++H   +  W+       + P F T +R     ++++E  Y  +C +   +     C+  C+   +   C C+++G          C+   I  C   +   + +  P  C C  RC +V++  +         + S++ PP   W    N +         KK Q+     +IQL  F +E       E+RK     EK  Y ++DL      N+ LF
Sbjct:   58 TSVVLIYQLAYSTQRVLEYASMVQVETRNED---SITFPAISICSNNMMQKSKILG--------KDAQRYLDLLDQKKEDQWDAISQSFS-PDFDI-EKAVHQYGLNLSLAMKSCHYGRYLKCNPSHFTTFKEFRYGLCYTFNSGKRESAFISHDTGPTSGLSITLDAQPEEYYSLYSSTG-TGFRVIVHDQSEFPWVE-KHGWEIPPGFSTNVRLARKEISSLESPYNSNCSRDTNYASQSYCLVQCYSDMVVKRCGCHMLGMTEETGHTPWCSPQQIKAC--VYTTSRRFQ-PNMCSCPVRCSRVEFDVQ---------LSSLYYPPDNFWETISNERSLTIYANDTKKFQEWYRRRVIQLNVFYKELT----TEVRK-----EKEAYTISDLAGDFGGNMGLF 427          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Match: EDO41313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N0])

HSP 1 Score: 63.1586 bits (152), Expect = 1.448e-10
Identity = 76/356 (21.35%), Postives = 139/356 (39.04%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLN------GRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTK-SLLPTGACFTFN--------KEISIQ---DDITLVLDPEVHDYLIP-NVGYAGFRVLIHSLYDPLWMALPLSTY-VGPNFHTYIRVNTVEKKYLRHCIKHEQWVP---------------------------CMHHCFEKSIFNACNCYLMGKNA-----CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE-SITQSIKNNIFSVFLP 968
            RV +   ++++     Y+L   IK+Y   + + ++ S +    + +  P ++ICN N +K S ++          D + ++D +N      G +N+    +RL    F  + K  H L +M+  C    ++C+  +F     L  G C+TFN        + I+     + + L L+ +  +Y    +    GF + +H   +P  M L  + Y + P F T +R+   +   +R  + H+   P                           CM  C+ + I   C C L+G        CT    + C L      +   P  C C KRC  + Y  + S+      ++    LP
Sbjct:   25 RVVWTCFIVISLGFLLYQLVNGIKNY---NDRGIIMSRSVEEPNEVDFPAVTICNQNIMKKSLIIGT--------DAQRYLDEMNYIKADLGLVNSTN--ERLDAEDF--VRKYGHTLGEMMYGCEFKDRRCTAQDFIPLPFLQRGLCYTFNSGRDNSSVRRIATPGRLESLILRLNAQPEEYYGAYSYENVGFVLAVHDQAEPPDMEL--NAYDIPPGFTTNLRIRRFKVDDIR--VYHQAINPAIRRYKPYPTKCGSRNLSLYKRYSRKACMQECYARLIITHCGCRLLGMPPMKAPFCTSKEYLDCQLMMPVLLK---PSKCDCPKRCQHIHYSVQPSLAHYPSKSVIKELLP 358          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Match: EDO48656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI82])

HSP 1 Score: 58.5362 bits (140), Expect = 5.825e-9
Identity = 50/174 (28.74%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDS-LNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGK-KKCSHVNFTKSLLPTG-ACFTFN----------KEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRV 677
            +  P IS+CN N  + S +             E+F+ S L GR  + +  Q     + + + +A+H+L DM+K CS  K  KCS  NFT      G  C+TFN            +  ++ + LV+D +  +Y   +V  AGF+V++H   +       LS  V P F +Y+ +
Sbjct:  171 LPFPAISMCNYNDARMSKMNGTLMN-------EIFVASKLEGRNTSHLQSQLTGELMQRTLKEAAHRLPDMIKECSWQKHGKCSWKNFTSFKSADGDTCYTFNSGRKDPILSMSNVGEENGLRLVIDTQHSEYYY-DVKNAGFKVILHDQGETPVKMQGLS--VSPGFTSYMEL 334          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Match: EDO39877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S3])

HSP 1 Score: 55.8398 bits (133), Expect = 3.462e-8
Identity = 80/382 (20.94%), Postives = 149/382 (39.01%), Query Frame = 3
Query:   84 LLTAILTGYRLKIW----IKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLN------GRIN-TDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTK--SLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIP-NVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVN-----TVEKKYLRHCIKHE-------QWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFE-SITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLI 1115
            +L   L G+ L ++    +  Y  L ++  + +       ++  P ++ICN N ++ S +   A +         ++D L+       R+N T+  F+       +++    H + DML  C+   K CSH +F    +    G C+TFN                +  ++L L+ E  +Y  P +    GF++ +H   +   M    +  + P F T IR+       +   Y   C   +           C++ C+ K I + C C ++G         +   LN         P  C C K C  + YK + S+     ++++    P   V  N  +   K Q   L+Q+   LR+       ++ ++ IY E L+
Sbjct:   57 VLWTALVGFGLVVFFIQLVMSYGKLRARESILAKGVERPMNVLYPAVTICNQNMMRKSRITGTAAQR--------YLDQLDHIKASLSRVNRTNERFE-----TEEMVRLYGHNITDMLWECNFMNKPCSHKDFAMRYTSYSRGLCYTFNAGANGSPIGQATTSGTRTSLSLRLNAESDEYYGPFSYDATGFKLAVHDQNEIPNMDED-AFDISPGFLTNIRIRREKEINLPSPYRSECGSRDLSNAPKYSMSGCIYECYSKIIADKCKCRVLG-------MALNVELN---------PAMCDCPKPCRALHYKIQLSLAYFPSDHLWDSIFP---VLLNFTDTTGKSQDEVLLQIQEALRK-------QIAQVQIYYETLL 398          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Match: EDO39413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA77])

HSP 1 Score: 52.7582 bits (125), Expect = 3.837e-7
Identity = 48/192 (25.00%), Postives = 87/192 (45.31%), Query Frame = 3
Query:  192 SMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRI---NTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVN---FTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIP-NVGYAGFRVLIHSLYDPLWMALPLSTY-VGPNFHTYIRVNTVEKKYLRHC 710
            S+  P I+ICN N ++ +A+L +A      Q Y   +D L  R    + +V  +R+   +  I+ K+ H+L+ M+  C   + KC + +   FT      G C+TFN  +             +  ++L LD E  +Y  P +    GF++ +H     +   +    Y + P F+T I +   +K+  + C
Sbjct:  114 SLPFPAITICNQNMLRKTAILGSA-----GQRYLDQLDELRARFIGEDMNVTSERIN--MDAIVQKSGHQLEKMVYECRFVRDKCDNKSIKVFTSE--KRGLCYTFNSGVNGTPLLNVSHSGSEYSLSLRLDAEPTEYYGPYSYDGTGFKIAVHD--QKVLPDIEEDAYDISPGFYTKITMKRAQKQTKQSC 294          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 63.1586 bits (152), Expect = 5.071e-10
Identity = 55/201 (27.36%), Postives = 88/201 (43.78%), Query Frame = 3
Query:  162 VSSATTNVISSMKLPTISICNINPVKGSALLNA-----AYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQ-IIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFN---------KEISIQDDITLVLDPEVHDYLI------PNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYL 701
            V++        M  P ++ICNIN  + SAL +A     A  TG P        + +G   TD+ +     P  Q I ++  H+L++ML  C+   + CS  +F+      G C+TFN         K+  + + + ++LD +  +YL            AG RV IHS  +P ++   L   V P F T++        YL
Sbjct:   97 VTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPK------NRDGHKPTDLMY---PAPDMQDIFNRTGHQLEEMLMSCNFSGQNCSAEDFSVVYTRYGKCYTFNGNKTASRKTKQGGMGNGLEIMLDIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQ-LGFGVSPGFQTFVSCQEQRLTYL 287          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Match: ENSORLT00000015581.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 60.077 bits (144), Expect = 4.804e-9
Identity = 76/336 (22.62%), Postives = 121/336 (36.01%), Query Frame = 3
Query:  195 MKLPTISICNINPVKGSALLN-----AAYKTGAPQ-DYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            M  P I+ CN N  + S +        A   G  Q D++ F+ +L    +    F   T  + + + ++SH +++ML  C    + C   NFT      G C+TFN  +              + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++       +YL       +  P             C   C  + +   CNC ++        CT      C     +F        C+C   C+   Y                    KF    Q I +NI    +F    + EK  Q+KA +I
Sbjct:   82 MFFPAITFCNYNSFRKSQITRNDIFWMAKMLGVEQGDFDDFMAALGKPSDDSKFFPSKTFNMLEFVQRSSHSIEEMLLDCKYRGQDCGPENFTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYL-PVWGETDETSYEAGIKVQIHSQDEPPFIDQ-LGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTPIDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPDQYKDCADPALDFLVEKDNNYCVCETPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEI 415          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 55.8398 bits (133), Expect = 1.121e-7
Identity = 88/393 (22.39%), Postives = 145/393 (36.90%), Query Frame = 3
Query:   54 LIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKL-PTISICNINPVKGS--------------ALLNAAYKTGAPQDYEL-FIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQ-----------DDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYL--MGKNA--CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            L R  ++L  +L+  +    L +   D +    ++   +    V +SM + P I+ CN+N  + S              ALLN  Y+   P   E   +  L  R + +  ++  +  + +  D+  H +KDML  CS    +CS  NF       G C+TFN     Q           + + L+LD +  +YL P  G        AG +V IH+  +P ++   L   V P F T++        YL       +  P             C   C  + +   CNC +  M  +A  C+     +C     +F      + C+C   C+   Y                    KF    Q I +NI    +F    + E   Q+KA ++
Sbjct:   41 LKRTLWILFFMLSVGV----LVMVCVDRVQFYFEYPHVTKLDEVAASMIVFPAITFCNLNSFRFSRVTRNDLYHAGELLALLNGRYEIRDPHLVEENVLQVLRERADFE-SYKPRSFNMREFYDRTGHDIKDMLLSCSYRGTECSAENFKVIFTRYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYL-PVWGETDETSFEAGIKVQIHTQEEPPFID-QLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTPMDSDFFNSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCSPEQYKECADPALDFLVERDNDYCVCETPCNLTRYGKELSFVKIPSKASAKYLAKKFNKTEQYIADNILVLDIFFEALNYETIEQKKAYEL 426          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Match: ENSORLT00000021925.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 55.0694 bits (131), Expect = 1.593e-7
Identity = 76/350 (21.71%), Postives = 124/350 (35.43%), Query Frame = 3
Query:  189 SSMKLPTISICNINPVKGS--------------ALLNAAYKTGAPQDYEL-FIDSLNGRINTDVPFQRLTRPIFQIID---KASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEI-----------SIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNCYLM----GKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            +++  P ++ CN+N  + S              ALLN  ++   P   E   + +L  + N    F      +F + D   +  H + +ML  C+   + C  +NFT      G C+TFN  +              + + ++LD +  +YL P  G        AG +V IHS  +P ++   L   V P F T++       +YL       +  P             C   C  + +   CNC ++        CT      C     +F        C+C   C+   Y                    KF    Q I +NI    +F    + EK  Q+KA +I
Sbjct:   82 TNLTFPAVTFCNLNEFRFSKITRNDLYHVGELLALLNNDHQIANPHLAEPEVLAALKDKAN----FNNFKPKLFNMTDFYNRTGHDISEMLLQCTFRGEDCYAMNFTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYL-PVWGETDETSYEAGIKVQIHSQDEPPFID-QLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTPIDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPDQYKDCADPALDFLVEKDNNYCVCETPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEI 425          
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Match: asic1a (acid-sensing ion channel 1 [Source:NCBI gene;Acc:101159102])

HSP 1 Score: 55.0694 bits (131), Expect = 1.939e-7
Identity = 88/392 (22.45%), Postives = 139/392 (35.46%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGS--------------ALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRL-TRP--IFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNK-----------EISIQDDITLVLDPEVHDYLIPNVG-------YAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVP-------------CMHHCFEKSIFNACNC---YLMGKNA-CTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDY--------------------KFESITQSIKNNI--FSVFLPPWSVEKNRQEKAKKI 1013
            R  ++L+ L +  L  Y     I  YL       +    T +   M  P I+ CN+N  + S              ALLN  Y+    +D  L  +S+   +     F     RP  + +  D+  H +KDML  C     +C   +F       G C+TFN            +  + + + L+LD +  +YL P  G        AG +V IHS  +P  +   L   V P F T++        YL       +  P             C   C  + + + CNC   Y+ G    C+     +C     +F      + C+C   C+   Y                    K+    Q IK+NI    +F    + E   Q+KA ++
Sbjct:   43 RCLWLLVFLCSLTLLLYVCVDRIHYYLEYPHVTRLDEVATPI---MTFPAITFCNLNAFRFSRVTRNDLYHAGELLALLNHRYEI---RDVHLVEESVLESLKVKADFHNFKPRPFNMREFYDRTGHDIKDMLLSCHFHGTECRPGDFKVVFTRYGKCYTFNAGGDGRPPLITTKGGMGNGLELMLDIQQDEYL-PVWGDTDETSFEAGVKVQIHSQDEPPSID-QLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKVTPMDSDFFDSYSITACRVDCETRYLVDNCNCRMVYMPGDAPYCSPELYKECADPALDFLVQRDNDFCVCETPCNMTRYNKELSFVKIPSKASAKYLAKKYNKSEQYIKDNILVLDIFFEALNYETIEQKKAYEV 426          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000027888.1 (SMESG000027888.1)

HSP 1 Score: 1307.35 bits (3382), Expect = 0.000e+0
Identity = 641/660 (97.12%), Postives = 641/660 (97.12%), Query Frame = 3
Query:   27 MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI 2006
            MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKLFL           KCE      L I QSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI
Sbjct:    1 MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKLFL-----------KCEI-----LIINQSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI 644          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000027888.1 (SMESG000027888.1)

HSP 1 Score: 1293.1 bits (3345), Expect = 0.000e+0
Identity = 637/660 (96.52%), Postives = 637/660 (96.52%), Query Frame = 3
Query:   27 MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI 2006
            MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKL             KCE      L I QSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQI  IDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI
Sbjct:    1 MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESITQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNKIFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEKFIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQTNYLQKL-------------KCEI-----LIINQSLANFTHKKTYNGYGETTVTLTVHMLKNENMAFKMESIQNLYDPQI--IDILMSGLIIAFIFISLLNKCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDMESPVTTFHLI 640          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000063169.1 (SMESG000063169.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.037e-19
Identity = 87/371 (23.45%), Postives = 157/371 (42.32%), Query Frame = 3
Query:   60 RVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSATTNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIF---QIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLI---HSLYDPLWMALPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNACNCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESI---TQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFDELRKLSIYLEKLIYFVNDLEKNI 1145
            R+ Y  I LL   +  YR+  W   Y   S   +  +   N    +  P + +CN+NP++G+ +      +   + Y++  DS+  R +      ++ +      +++ + SHK++DMLK C +  K C   +F      +  C   N   SI   I+L LDPE  DY+IPN G+ GFR+++    S Y P + ++      GP + T +++                                     + KN  T ++   C  N  +F E ++      +KR  Q       I   +Q  K+  FS  L P S+ ++     + ++ ++LIQ  A+LR  + + F +L++L+     L   +  L K +
Sbjct:   23 RILYGFIWLLIFGIMSYRIIDWGNQYFWSSDNKINFAGANNAPKILIKPYLLLCNVNPIRGTRIF---LMSNGSKIYDIISDSITSRTSYQKGILKVLKQSMINKKLLFECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHKININNSI-SKISLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPAYDSI----MAGPFYQTNVKIK------------------------------------LSKN-ITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSL-RSIMRNGEHLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQL 347          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000018290.1 (SMESG000018290.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.330e-19
Identity = 57/162 (35.19%), Postives = 86/162 (53.09%), Query Frame = 3
Query:  210 ISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYV--GPNFHTYIRVNTVE 689
            +++CNIN  +GSAL     K    + ++ +I SL  R      +Q L  PI  +++ ++HKL+DMLK+C IG   CS   F + +   GACF+     +  + + + LDPE  DY++PN G  GF V +H+   PL M       V  GP+F T IR    +
Sbjct:   48 VTLCNINIARGSALFQ---KFDTLEAFDKYIQSL-SRWQQAPNYQTLPDPI--MVNLSAHKLEDMLKICRIGTIVCSTHQFIRHISRYGACFSLRINYTELNWLKITLDPEEFDYILPNFGIVGFNVFVHNKL-PLNMGSMAENMVVIGPSFETMIRAKVTQ 202          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000018290.1 (SMESG000018290.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.424e-19
Identity = 57/162 (35.19%), Postives = 86/162 (53.09%), Query Frame = 3
Query:  210 ISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRINTDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTGACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMALPLSTYV--GPNFHTYIRVNTVE 689
            +++CNIN  +GSAL     K    + ++ +I SL  R      +Q L  PI  +++ ++HKL+DMLK+C IG   CS   F + +   GACF+     +  + + + LDPE  DY++PN G  GF V +H+   PL M       V  GP+F T IR    +
Sbjct:   34 VTLCNINIARGSALFQ---KFDTLEAFDKYIQSL-SRWQQAPNYQTLPDPI--MVNLSAHKLEDMLKICRIGTIVCSTHQFIRHISRYGACFSLRINYTELNWLKITLDPEEFDYILPNFGIVGFNVFVHNKL-PLNMGSMAENMVVIGPSFETMIRAKVTQ 188          
The following BLAST results are available for this feature:
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASIC45.285e-923.62acid sensing ion channel subunit family member 4 [... [more]
ASIC47.139e-925.91acid sensing ion channel subunit family member 4 [... [more]
ASIC32.618e-826.29acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC32.618e-826.29acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC23.015e-822.58acid sensing ion channel subunit 2 [Source:HGNC Sy... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
delm-11.644e-622.64DEgenerin Linked to Mechanosensation [Source:UniP... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a9.759e-1426.71acid-sensing (proton-gated) ion channel family mem... [more]
asic4b5.966e-1124.64acid-sensing (proton-gated) ion channel family mem... [more]
asic21.621e-822.42acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic21.621e-822.42acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic1c3.793e-721.55acid-sensing (proton-gated) ion channel 1c [Source... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASIC13.410e-824.40acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
cspg45.679e-723.31chondroitin sulfate proteoglycan 4 [Source:Xenbase... [more]
cspg46.084e-723.31chondroitin sulfate proteoglycan 4 [Source:Xenbase... [more]
cspg46.586e-723.31chondroitin sulfate proteoglycan 4 [Source:Xenbase... [more]
cspg46.925e-723.31chondroitin sulfate proteoglycan 4 [Source:Xenbase... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asic41.694e-925.57acid-sensing (proton-gated) ion channel family mem... [more]
Asic41.824e-925.57acid-sensing (proton-gated) ion channel family mem... [more]
Asic22.017e-822.58acid-sensing (proton-gated) ion channel 2 [Source:... [more]
Asic11.873e-723.08acid-sensing (proton-gated) ion channel 1 [Source:... [more]
Asic32.715e-721.81acid-sensing (proton-gated) ion channel 3 [Source:... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q708S4|ASI4A_DANRE7.114e-1326.71Acid-sensing ion channel 4-A OS=Danio rerio OX=795... [more]
sp|Q9JHS6|ASIC4_RAT1.927e-1026.16Acid-sensing ion channel 4 OS=Rattus norvegicus OX... [more]
sp|Q708S3|ASI4B_DANRE4.504e-1024.64Acid-sensing ion channel 4-B OS=Danio rerio OX=795... [more]
sp|Q7TNS7|ASIC4_MOUSE1.276e-825.57Acid-sensing ion channel 4 OS=Mus musculus OX=1009... [more]
sp|Q96FT7|ASIC4_HUMAN2.538e-823.62Acid-sensing ion channel 4 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NZL51.813e-11932.64Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
A0A4S2ME251.953e-11132.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M8066.600e-11032.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CVJ71.349e-10431.28Acid-sensing ion channel 3 isoform 1 OS=Schistosom... [more]
G7YFD42.904e-10332.21Amiloride-sensitive cation channel 4-A OS=Clonorch... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a1.741e-1225.09acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4a2.537e-1226.53acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4b5.402e-1124.64acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic1c8.041e-1121.92acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c6.026e-921.78acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1a1.015e-623.67acid-sensing (proton-gated) ion channel 1a [Source... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394462.417e-1224.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413131.448e-1021.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486565.825e-928.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398773.462e-820.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394133.837e-725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a5.071e-1027.36acid sensing ion channel subunit family member 4 [... [more]
ENSORLT00000015581.24.804e-922.62acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
ENSORLT00000031246.11.121e-722.39acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000021925.21.593e-721.71acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
asic1a1.939e-722.45acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027888.10.000e+097.12SMESG000027888.1[more]
SMESG000027888.10.000e+096.52SMESG000027888.1[more]
SMESG000063169.11.037e-1923.45SMESG000063169.1[more]
SMESG000018290.11.330e-1935.19SMESG000018290.1[more]
SMESG000018290.11.424e-1935.19SMESG000018290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010425 ID=SMED30010425|Name=Acid-sensing ion channel 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2030bp
TATATGCATTCTATTTTCTCTAGCAAATGACGACCAAGAAGCTTAATTCC
TTTCTAATACGGGTTTTCTACGTACTCATTTTATTGTTGACTGCCATTCT
TACTGGTTACAGGTTAAAAATATGGATAAAAGATTATTTATCACTGTCTT
CCAAATTTGTTGTTTCGTCAGCAACAACAAATGTTATTTCCTCAATGAAA
TTGCCCACAATCAGCATTTGCAATATTAATCCCGTCAAAGGATCTGCACT
TTTGAATGCAGCCTACAAAACTGGAGCACCACAAGATTATGAGTTATTCA
TAGACAGTCTTAATGGTAGAATTAATACCGATGTACCCTTTCAAAGGCTC
ACAAGACCTATATTTCAGATCATTGATAAGGCTTCTCACAAGTTAAAAGA
TATGTTGAAACTTTGCAGCATTGGTAAAAAGAAATGCAGCCATGTTAATT
TTACGAAAAGTCTACTTCCAACTGGAGCTTGTTTTACATTCAATAAAGAA
ATATCAATTCAGGACGACATAACTTTAGTTCTTGATCCAGAAGTTCATGA
CTATCTCATTCCAAATGTTGGATATGCAGGATTTAGAGTTTTGATTCATT
CACTTTACGATCCTCTTTGGATGGCTCTTCCTTTGTCGACCTACGTAGGG
CCTAATTTCCACACATATATAAGAGTGAATACAGTTGAAAAAAAATATTT
AAGGCATTGCATCAAACATGAGCAATGGGTTCCATGTATGCATCATTGTT
TTGAAAAGTCTATTTTCAACGCCTGCAATTGCTATCTCATGGGTAAAAAT
GCTTGCACATTCAGTCATATTATGAAATGTGGCCTCAATTTTGGGAATTT
TAAAGAATACGCGATTCCAGAAAATTGTCTTTGTACCAAACGATGCGATC
AAGTCGATTATAAATTTGAATCAATCACACAGTCTATAAAAAATAACATT
TTTTCCGTGTTTTTGCCACCATGGTCAGTAGAAAAAAATCGACAGGAAAA
AGCGAAAAAAATCCAGCAATCTTCACTGATCCAATTGTGGGCCTTTCTTA
GGGAGGCAAATGGGACCGCATTCGATGAGTTGCGGAAATTATCTATTTAT
TTGGAAAAGTTGATTTATTTTGTAAACGATCTAGAAAAGAATATTAATTT
ATTTCAAGAAAAATTATTAAACATTGACAGAACTTCATGCCTCCACACAA
CGCAAGTACCAAAGAAAAGCAATAAAATCTTTATCACGGGAATGGAATTT
GTAAGATTTATGAAAAGTTCTTCTTTAATAAAAGACCTAACTGCTTCACC
ATTTGAGCTGATTCATATCCATTTAGTTCACCTATTCTTCAAAGGTATAG
ACAGCGAATTGAATGAAATTGAAAAATTCATCCAACACTCCGATTTCATT
ACCGCCCTAAGTATGTTTCAATATCCCACAAAGGACATCAATTGCGCTCC
ACGATTGGATCAATCAAACAAAAATCCGGGATTCCGAGAAACCTCTGAAG
AAAATATCAAATCGAAAGATCAAACAAATTACTTACAAAAATTGTTTTTG
TTATTTACCTGGAATTTCAAAACTTTTAAGGCAAAATGCGAAGAAAATGT
GAAATATAATTTGAATATCATCCAATCTCTGGCGAATTTTACTCATAAAA
AAACGTATAATGGATATGGTGAAACAACCGTAACACTGACAGTTCACATG
TTAAAGAACGAAAACATGGCATTCAAAATGGAATCAATACAAAATTTATA
CGACCCCCAAATTGCAGTAATAGATATTTTGATGTCTGGGCTAATAATAG
CATTTATTTTTATATCATTATTAAACAAATGTTTGAATATTAGTTATCAA
AATTGCAAAACAGGTGCAAGTTTCAATAACCAACAAGAAGTAACTATTCA
GAACAATCTGTCGCAAAAATTCAATCAAAAAATATGGAATCAATATAGAG
AAAATTCAATGCATTCAAGAGACATGGAGAGTCCAGTTACTACATTTCAC
TTAATATAACACTGTAATTGTAATTACGCA
back to top

protein sequence of SMED30010425-orf-1

>SMED30010425-orf-1 ID=SMED30010425-orf-1|Name=SMED30010425-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=661bp
MTTKKLNSFLIRVFYVLILLLTAILTGYRLKIWIKDYLSLSSKFVVSSAT
TNVISSMKLPTISICNINPVKGSALLNAAYKTGAPQDYELFIDSLNGRIN
TDVPFQRLTRPIFQIIDKASHKLKDMLKLCSIGKKKCSHVNFTKSLLPTG
ACFTFNKEISIQDDITLVLDPEVHDYLIPNVGYAGFRVLIHSLYDPLWMA
LPLSTYVGPNFHTYIRVNTVEKKYLRHCIKHEQWVPCMHHCFEKSIFNAC
NCYLMGKNACTFSHIMKCGLNFGNFKEYAIPENCLCTKRCDQVDYKFESI
TQSIKNNIFSVFLPPWSVEKNRQEKAKKIQQSSLIQLWAFLREANGTAFD
ELRKLSIYLEKLIYFVNDLEKNINLFQEKLLNIDRTSCLHTTQVPKKSNK
IFITGMEFVRFMKSSSLIKDLTASPFELIHIHLVHLFFKGIDSELNEIEK
FIQHSDFITALSMFQYPTKDINCAPRLDQSNKNPGFRETSEENIKSKDQT
NYLQKLFLLFTWNFKTFKAKCEENVKYNLNIIQSLANFTHKKTYNGYGET
TVTLTVHMLKNENMAFKMESIQNLYDPQIAVIDILMSGLIIAFIFISLLN
KCLNISYQNCKTGASFNNQQEVTIQNNLSQKFNQKIWNQYRENSMHSRDM
ESPVTTFHLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane