G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30010420
Length (bp)830
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010420) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30010420) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010420

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010420SMESG000053136.1 SmedASXL_001960SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3P6SAQ6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2461 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.544e-27
Identity = 78/232 (33.62%), Postives = 127/232 (54.74%), Query Frame = 2
Query:  110 KQIYLDVYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPEN------SSIFVV---------LLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIF-SRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRK 757
            K IY DVY Y +L L  LN+  NG +L IF      +  +S IL  LS++E  F L L+++      ++NY   +      +S+F +         L+    + +    +FQI+RNW++VLL A+R++++C S   R   F +  I  I+  +    FLI+ PR FET   FC   +++  E  LL   R+YQ +++G + FI+QSGGP IC+   ++ ++R+I  +R YR+
Sbjct:   44 KAIY-DVYTYITLVLSPLNVVLNGFSLRIFTHRAWKNSTMSCILKTLSIFETCFGLCLLLHTLSHSLLENYVSGSDGNEWLASVFTISTQRRIGIFLMAFHPILSGALFAFQIARNWSVVLLAAYRYDSVCRSIG-RVSAFSRVSICVIMSLVLAAAFLIALPRVFETRAFFCYSNAQIYNEEYLLAASRVYQMVFIGIITFIVQSGGPVICVCVLSFFVVRQISLRRKYRR 273          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3Q0KV19 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.223e-24
Identity = 79/238 (33.19%), Postives = 123/238 (51.68%), Query Frame = 2
Query:  131 YQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPEN--------------------------SSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFC-IFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNR 763
            Y+   L LG LN   NGL ++IF         +S IL  LS+ E+   LSL ++   LI  +N T  +                           +IF   ++T  +++   + FQISRNW++VLL A+R++ IC         F + +I  I+  I F+  LI  PR FE+G+  C I   V+++  LL+ ++LYQ LYLG VMFI+QSGGP IC+   +  ++R I ++R + + +
Sbjct:   42 YRAIGLLLGPLNTILNGLCVHIFNHSSWKKSIMSRILKGLSIIELGMGLSLFIHA--LIFSQNSTTTSHLHQNTTNSIYPYHNEQDTIQTNAYIKTIFSFFIMT--ISSRFLVVFQISRNWSVVLLAAYRYDQICRPIGS-PSAFPRERIRYILIIIFFLACLIVIPRIFESGIVVCYISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREK 274          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G4VR07 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_204230 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.527e-24
Identity = 79/238 (33.19%), Postives = 123/238 (51.68%), Query Frame = 2
Query:  131 YQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPEN--------------------------SSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFC-IFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNR 763
            Y+   L LG LN   NGL ++IF         +S IL  LS+ E+   LSL ++   LI  +N T  +                           +IF   ++T  +++   + FQISRNW++VLL A+R++ IC         F + +I  I+  I F+  LI  PR FE+G+  C I   V+++  LL+ ++LYQ LYLG VMFI+QSGGP IC+   +  ++R I ++R + + +
Sbjct:   43 YRAIGLLLGPLNTILNGLCVHIFNHSSWKKSIMSRILKGLSIIELGMGLSLFIHA--LIFSQNSTTTSHLHQNTTNSIYPYHNEQDTIQTNAYIKTIFSFFIMT--ISSRFLVVFQISRNWSVVLLAAYRYDQICRPIGS-PSAFPRERIRYILIIIFFLACLIVIPRIFESGIVVCYISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREK 275          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SGW5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4169 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.581e-23
Identity = 84/283 (29.68%), Postives = 138/283 (48.76%), Query Frame = 2
Query:  107 EKQIYLD-------VYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSL---VVNMSIL---IGMKNYTPEN---------SSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIFS-RVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTI-----------GSS---------RLGKSSDKLVMLMC 826
            E Q+ +D       +Y+   L +  +N+  NG++L IF      +   S IL  LSV+EI F  SL    +N  +L     + NYT  N         + +   + V++++ +    +FQISRNW++VLL A+R++ IC         F + +I  I+ +   +  L + PR FE     CI +  + +E  LL    +YQ LYLG   FI+QSGGP +C+   ++ ++R+I  +R +RK   +T+           GS+         R   S DKL++ +C
Sbjct:   21 ESQLEVDEYNEIFQIYKILVLVIAPINVLLNGISLKIFGHRLWKNSSTSAILKSLSVFEICFGSSLFLHTINSKVLETYTRLDNYTTANLTEKERMVNAKLVAGMTVSQQILSGFLFAFQISRNWSVVLLAAYRYDAICRKLGTVSS-FPRERIPWIMTTTMVLSGLFALPRLFEIKSFICIPTVMIYQEEPLLAGNLMYQLLYLGIGTFIVQSGGPVLCVCILSFFVIRKIALRRKFRKQNQRTVFIAANKNEDNSGSAQQTATKVVERKLPSGDKLMLALC 302          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183P9C9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10965 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.531e-23
Identity = 77/248 (31.05%), Postives = 122/248 (49.19%), Query Frame = 2
Query:  131 YQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPENSSIFVVLLVTKRL---------------------AAWLQ---------------ISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFC-IFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNR 763
            Y+   L LG LN   NGL ++IF         +S IL  LS+ E+   LSL ++  I       +  N ++F +   T  +                      A+++               ++FQISRNW++VLL A+R++ IC         F + +I  I+  I F+  LI  PR FE+G+  C I   V+++  LL+ ++LYQ LYLG VMFI+QSGGP IC+   +  ++R I ++R + + +
Sbjct:   42 YRAIGLLLGPLNTILNGLCVHIFNHHLWKKSIMSRILKGLSIIELGMGLSLFIHALIFSQNSTSSYSNQNLFNINNTTNSIYPNYDIHINHLNQFQHDSIHTNAYIKTICSFFITTISSRFLVAFQISRNWSVVLLAAYRYDQICRPIGTSSA-FPRERIRYILIIIFFLACLIVIPRIFESGIVVCYISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREK 288          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053136.1 (SMESG000053136.1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 263/264 (99.62%), Postives = 263/264 (99.62%), Query Frame = 2
Query:   38 MYYIDNCTYRNESHSKVMIMWKSEKQIYLDVYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTIGSSRLGKSSDKLVMLMCA 829
            MYYIDNCTYRNESHSKVMIMWKSEKQIYLDVYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKI RIVHSISFVIFLISFPRTFETGVRFCIFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTIGSSRLGKSSDKLVMLMCA
Sbjct:    1 MYYIDNCTYRNESHSKVMIMWKSEKQIYLDVYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIKRIVHSISFVIFLISFPRTFETGVRFCIFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTIGSSRLGKSSDKLVMLMCA 264          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063294.1 (SMESG000063294.1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.433e-22
Identity = 71/250 (28.40%), Postives = 131/250 (52.40%), Query Frame = 2
Query:   98 WKSEKQIYLD-VYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVI-FLISFPRTFETGVRFCIFS-RVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTI---GSSRLGKSSDKLVMLMCA 829
            + S+  I  D +Y+Y +L L  L+I +N  A  +F++       +S IL  LS++EILF +++++  SI   ++   P    + + + V    A  L I F I+RNWT+V+L  +R+E +C      K  +++   I +     F +  LI+ PR  ET +  C  +  V   +  L+ ++ Y  L+ G ++F++Q+GGP I +   +  +L+ I + +  RK+ F      GS +   S D+L++++ A
Sbjct:   22 FSSQNSIETDTIYKYITLILTPLSILSNTFAFVVFKESIWKKSVMSKILRMLSLFEILFNVNVLLEASIRHKIEEQHPSMVELVIFIYVITA-AKVLMIVFLIARNWTVVILAGYRYEAVCRPVGSCK--YIRYNNINLAFCFIFALSILIALPRMMETKIEICQPTLSVNRFVPFLISYKWYLYLHTGILLFLIQNGGPVILVCFLSSCVLKVIRKMKKIRKSNFNLADKKGSPQ--PSGDRLIVILSA 266          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000022454.1 (SMESG000022454.1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.569e-20
Identity = 76/246 (30.89%), Postives = 120/246 (48.78%), Query Frame = 2
Query:  131 YQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSILIGMKNYT----PENSSIFVVLLVTKRLAAWLQ---ISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFL----ISFPRTFETGVRFCIFS--RVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYR-KNRFKTIGSSRLGKSSDKLVMLMC 826
            Y Y+S+ L  ++   N LA++IF          S+IL YLSV+E LF  ++++  S      NY       N S +  LL+ +    +++   I F I RN T+ +L A R+E +C     +++I       R V  I  VIFL    I+ PR FE  V  C     ++  ++  L     Y  L+ G V+FI QSGGP I +F  ++ IL+ I + + +R +N    +    LG   DK++  +C
Sbjct:   29 YNYSSIVLSSISFLLNTLAIFIFNHRLWRKSLTSIILKYLSVFESLFNATVLIKNS----YDNYAIQSKSPNFSSYESLLIDETFRLFIRLFGIVFLICRNVTVAVLAAHRYECVCLPVGAKRRINS-----RNVFQIELVIFLLALVIALPRLFEKYVVACAEPLWKIEGKVAFLDSSNWYVYLHKGVVLFIFQSGGPVITVFILSFYILQVIKKMKKFRNRNSNNKVRPQPLG---DKIIFPLC 262          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023730.1 (SMESG000023730.1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.678e-20
Identity = 76/266 (28.57%), Postives = 135/266 (50.75%), Query Frame = 2
Query:   53 NCTYR-----NESHSKVMIMWKSEKQIYLDVYQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLS-LVVNMSILIGMKNYTPEN--SSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIFSRVTEEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTIGSSRLGKSSDKLVMLMC 826
            NC+Y      N+S      +     +IY + + Y  L + I++I  NG  L+IF         LS++L YLS  EI+F +S  + +++  I   +Y   N  S +F V ++  ++  +   S  I RNWT++ L  +RF++IC   +  KKI+ +    +++     +  +I+FPRTFE    FC  + V +    L+ +  Y   Y G ++FI+Q+  P +C    +  ++R I + + +RK+  KTI +     S D L++ +C
Sbjct:  238 NCSYPLETVGNKSDESDENLAAFALRIY-NFHNYALLVIPIISIIFNGFCLFIFFDKIWKKSILSILLKYLSATEIVFNISGFLYSVTKFI---DYPSINQFSKLFWVFIL--QIGTFSVASGLICRNWTILHLAIYRFDSICRPLNT-KKIYTETSTYKLLWITYILAAVIAFPRTFEYKATFCEGNLVLKPS--LLNYDWYAYGYQGSLIFIIQTAAPVVCTSILSISVMRAILKVKRFRKSFSKTIKTKNNAISGDALMIFIC 494          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000076138.1 (SMESG000076138.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.741e-17
Identity = 69/250 (27.60%), Postives = 116/250 (46.40%), Query Frame = 2
Query:  131 YQYTSLCLGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQL-SLVVNMSILI---------GMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFENICCSFSQRK-----KIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIFSRVTEEIQLLMKFR-LYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTYRKNRFKTIGS--SRLGKSSDKLVMLMC 826
            Y Y +  L + NI  N  A+ I          L+ IL  +S +EILF L + + N+  L          G+K      +++ ++LL+   L     I FQ++RNW++ +L  FR++ +C S + R+       F    + +I   +      ++ PR FE   + CI + V       +  R ++Q  YLG VMFI QSGGP I     + +++R+I  +   RK +     +   R  ++   LVM +C
Sbjct:   38 YTYITFVLVVTNILGNMFAVIILSDSVWNKSVLTTILKAISYFEILFNLLNFINNICQLTEPLKPFQYFGLKAL----ATVEILLLICDSL----MIGFQMARNWSVTILALFRYDMVCRSKTVRRLNNQSNFFSNENLPKIFTFLMIFCIGLALPRMFEVTPQICINTAVICHYADFLSVRKVFQYGYLGVVMFIFQSGGPIIITSCVSLMLIRKIQNRHAIRKRQTNATSNRFQRSQRNPGTLVMAVC 279          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6SAQ62.544e-2733.62G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A3Q0KV193.223e-2433.19G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G4VR073.527e-2433.19G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3SGW51.581e-2329.68G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183P9C94.531e-2331.05G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053136.10.000e+099.62SMESG000053136.1[more]
SMESG000063294.11.433e-2228.40SMESG000063294.1[more]
SMESG000022454.12.569e-2030.89SMESG000022454.1[more]
SMESG000023730.16.678e-2028.57SMESG000023730.1[more]
SMESG000076138.11.741e-1727.60SMESG000076138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010420 ID=SMED30010420|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=830bp
TGAGATGTTTCACATTTACAATAGGTCTTTTCTCATTATGTATTACATTG
ACAATTGTACATATCGAAACGAGTCTCATTCAAAAGTGATGATTATGTGG
AAATCAGAAAAACAGATCTATCTAGATGTATATCAGTATACAAGTTTATG
CCTTGGAATTCTTAACATATTCGCTAATGGACTAGCTCTGTATATTTTCC
AACAGATGAAAAGTACTCACGTCAGACTAAGTTTAATTCTTTCATATCTT
TCTGTCTATGAAATTCTTTTTCAATTGAGTTTAGTTGTCAACATGTCCAT
TTTAATTGGAATGAAGAACTATACTCCAGAAAACTCTAGTATATTTGTAG
TGCTGCTAGTGACCAAAAGGCTGGCAGCATGGCTTCAAATTTCCTTCCAA
ATCAGTCGAAACTGGACATTGGTTTTGCTGACAGCGTTTAGATTCGAAAA
TATTTGCTGTAGTTTTTCCCAAAGAAAAAAAATTTTTGTTAAACCCAAAA
TCATAAGGATTGTTCATTCGATTTCTTTTGTGATATTCCTAATATCTTTT
CCGAGAACATTTGAAACTGGAGTCCGATTCTGCATTTTTTCTCGCGTCAC
AGAAGAAATACAGCTACTCATGAAATTCCGACTTTATCAAACTCTTTATT
TAGGATTTGTTATGTTTATTTTACAGTCAGGCGGTCCATTTATTTGTATT
TTCACTTTTAATTATCTGATTCTTCGAAGAATCTACCAACAAAGAACCTA
CAGGAAAAACCGTTTTAAAACCATTGGATCATCCAGACTGGGGAAGTCCA
GCGACAAGCTCGTCATGCTCATGTGTGCCG
back to top

protein sequence of SMED30010420-orf-1

>SMED30010420-orf-1 ID=SMED30010420-orf-1|Name=SMED30010420-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=276bp
EMFHIYNRSFLIMYYIDNCTYRNESHSKVMIMWKSEKQIYLDVYQYTSLC
LGILNIFANGLALYIFQQMKSTHVRLSLILSYLSVYEILFQLSLVVNMSI
LIGMKNYTPENSSIFVVLLVTKRLAAWLQISFQISRNWTLVLLTAFRFEN
ICCSFSQRKKIFVKPKIIRIVHSISFVIFLISFPRTFETGVRFCIFSRVT
EEIQLLMKFRLYQTLYLGFVMFILQSGGPFICIFTFNYLILRRIYQQRTY
RKNRFKTIGSSRLGKSSDKLVMLMCA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 33..276
e-value: 4.5E-13
score: 50.8
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 39..257
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 43..274
e-value: 1.90371E-14
score: 69.584
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 12..257
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 219..241
NoneNo IPR availableTMHMMTMhelixcoord: 170..187