DNA topoisomerase 2

Overview
NameDNA topoisomerase 2
Smed IDSMED30010418
Length (bp)4810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA topoisomerase 2 (SMED30010418) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA topoisomerase 2 (SMED30010418) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA topoisomerase 2 (SMED30010418) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA topoisomerase 2 (SMED30010418) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010418

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SmedASXL_017863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SmedASXL_017863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 Contig6222uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 Contig6222newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010418SMESG000077843.1 SMESG000075930.1 SMESG000072474.1 SMESG000071411.1 SMESG000070882.1 SMESG000049741.1 SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000034944.1 SMESG000021315.1 SMESG000020394.1 SMESG000011999.1 Contig18945uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010418SMESG000077843.1 SMESG000075930.1 SMESG000072474.1 SMESG000071411.1 SMESG000070882.1 SMESG000049741.1 SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000034944.1 SMESG000021315.1 SMESG000020394.1 SMESG000011999.1 Contig18945newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010418SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010418SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 709/1201 (59.03%), Postives = 898/1201 (74.77%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGK---PDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+  K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW K    K   E     + +++  DSG    PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++ V +Q+  +   G     +  K GK   K +++  ET PS + RRI P
Sbjct:   51 VERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAW-KEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQL-EETMPSPYGRRIIP 1244          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1374.38 bits (3556), Expect = 0.000e+0
Identity = 709/1201 (59.03%), Postives = 898/1201 (74.77%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGK---PDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+  K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW K    K   E     + +++  DSG    PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++ V +Q+  +   G     +  K GK   K +++  ET PS + RRI P
Sbjct:   46 VERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAW-KEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQL-EETMPSPYGRRIIP 1239          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2A (DNA topoisomerase II alpha [Source:HGNC Symbol;Acc:HGNC:11989])

HSP 1 Score: 1367.44 bits (3538), Expect = 0.000e+0
Identity = 686/1157 (59.29%), Postives = 873/1157 (75.45%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNAN-----KLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVV 3565
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   +  +++T+ P LYKIFDEILVNA+DNK RD KM+ IR+ ID + N++ IWNNG+GIPV  HK  ++Y+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+S+EY K FKQTW +NM    + E+     ED+TC+TF PDL +F M  LD+DIVAL  RRAYDIA  T+ + VFLNG ++ VK F+ YVD+Y K  LD     LKV++E    RWEV +T S  + F Q+SFVNSIAT+KGG HV+Y+ADQ+  K+++  KKK K           QVK +MWIFV  LIENP+FDSQTKENMTL  K FGS C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K  ++K +PKLDDAN AG +NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+ +TP+  KW++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  LK+L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ +++++N++R+++G  P+ M P Y+NF GTI E+  N+YV++GE+  L+ TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDY+EY+TD TV+F+V+M   K AEAE  G HK FKLQT LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A+++KL NQARFILEKI+GK+I EN     LI  L+   YDSDPVKAW +         +      E E ++        P F YL  M +  LT EKK+ L + R+EK +EL  +K KSP  +W +DL    +E+  V
Sbjct:   30 VERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMS-EKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAH---QVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAV 1181          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1354.35 bits (3504), Expect = 0.000e+0
Identity = 675/1107 (60.98%), Postives = 846/1107 (76.42%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGK---PDFGYLTQMQI 3421
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+  K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW K    K   E     + +++  DSG    PDF Y+  M +
Sbjct:   46 VERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAW-KEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSL 1146          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2A (DNA topoisomerase II alpha [Source:HGNC Symbol;Acc:HGNC:11989])

HSP 1 Score: 170.244 bits (430), Expect = 3.998e-48
Identity = 76/131 (58.02%), Postives = 108/131 (82.44%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVT 502
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   +  +++T+ P LYKIFDEILVNA+DNK RD KM+ IR+ ID + N++ IWNNG+GIPV  HK  ++Y+P +IFGQLLTS+N++DD+K+VT
Sbjct:   18 VERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVT 147          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: top-2 (DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23670])

HSP 1 Score: 1302.73 bits (3370), Expect = 0.000e+0
Identity = 663/1220 (54.34%), Postives = 882/1220 (72.30%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKL-MWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAE-AAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW--------------MKFNANKLTXXXXXXXXXXXXXXXSGK---PDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDL-----EILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            IE +YQKK+QLEHILLRPD+Y+GS++  +K  MWV++ E++++ ++ I+Y P LYKI+DEILVNA+DNK RD KM TI+I I+ + N + ++NNG+GIPVT HK  +VY+P +IFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS++F LETSS++Y  +FKQTW  NM    +P+I K+  EDFT +TF PDL +F M  LD+DI  L +RRAYD+A  ++G+ VFLNGK+I +K F+DYV +YT    +   EPLK+ YE  G RW+VA+  S  + F QVSFVNSIATTKGG HV+Y+ADQ+ AK ++  K+K+      +K  P Q+K +MW+FV CLIENP+FDSQTKE MTL QK FGS C L+EKF    +  GI + +  W  FK    L+KKCSKTK +KLK +PKL+DAN AGTKNS QCTLILTEGDSAK+LAVSGL+V+GRD YGVFPLRGKLLNVRE  +KQ+ +NAE+  +IKI+GLQY +KYE  +  KTLRYGKLM+M DQDQDGSHIKGL+INFIH  WP+L++ NFVE+FITPIVKA K  + +SFYS+PE  EW+ NT +   +++KYYKGLGTSTSKEAKEYF DM RH I+F+Y+G +D  ++ +AFSK K +ERK+WL+ WM + K R++ G+ E YLY K T+++TF++F+N+EL+LFSN DNERSIPCL+DGFKPGQRKVLFAC KR   +E+KVAQLAG+VAE+SAYHHGE SLM TI+NLAQD+VGSNNINLL+P GQFGTRL GGKDSAS RYI TQLS +T+ +F   D+ VL++L ++NQ IEPEWY PIIPMVL+NG  GIGTGWS+ IPN+NP++++ N+KR+I G     + PWY+NF G I+++  +++   GE+  LD  T+EITELP++ WT  YKE V+E     +DK    I DYKEY+TD TV+F+V+++P K  E E     H+ FKLQ  +  + M+LFD  G +R Y +   I + F+  R E Y++RK YLLG+L AQ+ +L NQARFIL KIN +++ EN K A ++D L+  K+D+DPVK W              ++ + + L     E++E   +   + +    D+ YL  M ++ L+ E+K  L+KE +EK+ E+  I+ K+ + +W +DL     E+ ++E     +QD S               RG K   +  E  PSK  +RIEP
Sbjct:   63 IEDIYQKKSQLEHILLRPDTYIGSVEHTEKTPMWVYNMEESKLEQRDISYVPGLYKIYDEILVNAADNKQRDPKMNTIKITINKEKNEISVYNNGKGIPVTQHKVEKVYVPELIFGTLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTKFTLETSSRDYKSAFKQTWIKNMTRDEEPKIVKSTDEDFTKITFSPDLAKFKMKELDDDICHLMARRAYDVAGSSKGVAVFLNGKRIPIKGFEDYVQMYTSQ-FNNEGEPLKIAYEQVGDRWQVALALS-EKGFQQVSFVNSIATTKGGRHVDYVADQMVAKFIDSIKRKLTKTSMNIK--PFQIKNHMWVFVNCLIENPTFDSQTKETMTLQQKQFGSTCVLSEKFSKAASSVGITDAVMSWVRFKQMDDLNKKCSKTKTSKLKGIPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPLRGKLLNVREGNMKQIADNAEVNAMIKILGLQYKKKYETEDDFKTLRYGKLMVMADQDQDGSHIKGLVINFIHHFWPSLIQRNFVEEFITPIVKATKGKEEVSFYSLPEYSEWRMNTDNWKSYKIKYYKGLGTSTSKEAKEYFLDMVRHRIRFKYNGADDDNAVDMAFSKKKIEERKDWLSKWMREKKDRKQQGLAEEYLYNKDTRFVTFKDFVNRELVLFSNLDNERSIPCLVDGFKPGQRKVLFACFKRADKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSNNINLLLPIGQFGTRLQGGKDSASARYIFTQLSPVTRTLFPAHDDNVLRFLYEENQRIEPEWYCPIIPMVLVNGAQGIGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRFACYGEVAVLDDNTIEITELPIKQWTQDYKEKVLEGLMESSDKKSPVIVDYKEYHTDTTVKFVVKLSPGKLRELERGQDLHQVFKLQAVINTTCMVLFDAAGCLRTYTSPEAITQEFYDSRQEKYVQRKEYLLGVLQAQSKRLTNQARFILAKINNEIVLENKKKAAIVDVLIKMKFDADPVKKWKEEQKLKELRESGEIELDEDDLAAVAVEEDEAISSAAKAVETKLSDYDYLVGMALIKLSEEEKNKLIKESEEKMAEVRVIEKKTWQDLWHEDLDNFVSELDKQEAREKADQDASIKNAAKKLAADAKTGRGPKK-NVCTEVLPSKDGQRIEP 1277          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 449/1129 (39.77%), Postives = 688/1129 (60.94%), Query Frame = 2
Query:  122 YQKKTQLEHILLRPDSYVGSIK-KEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKE---DFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAAC-TQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQ--------VSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGS--ECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKR-NLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMING-GTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQL-------DGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMN---PAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQI 3421
            Y+KK+  EH+LLRPD+Y+G +  +ED+++W+ D E  +M+ K++TY P L KIFDEILVNA+DNK RDS M  + + +D +   + +WNNG G+PV IH    +Y+PT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EF++ET      + F+Q W +NM  C + E+ +   E   D+T V F PDL+RF + +L +D++ L  RR +++AA   + + V+LNG++ +V  F+DYV ++         +   +++     RW V V    N  F +        VSFVN+I T KGG+HV+Y+ D      + K     K       +KPA +K N+ IF+ CLIENPSF+SQTKE +T   K+FGS  EC   +K      + G++E +    L  N         +   + ++D+ KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  +  +  KW++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +RSIP L+DG KP QRK+L+  L   +   E+KV+QLAG+VA   +YHHGE SL+ TII + Q F GS+N+ LL P GQFGTR  GG D+AS RYI T L+  T+L+F   D+ +L+  +++   +EP W  PI+P++LING +GIGTGWS+KI N NP D+ID ++R I+   T  ++ P+Y  F G +  V   K++ +G+I  +          ++EI ELP+ +WT+ YKE + +I     +  P  + ++ E +T+K V F + ++    +++ +   +    +FKL+T LT  N +LFD  G ++++ N  EI   FF+VR ++Y KR         A+   ++NQ  FI    NG +   ++    L +KL    +  DP+    K                     +S K ++GYL +M +
Sbjct:   47 YEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFN--------DSSSLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD--KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDA-KKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRSIPSLIDGLKPSQRKILWTLLNNMDESTEIKVSQLAGAVAHRQSYHHGEESLVRTIIRMGQTFCGSSNLPLLQPIGQFGTRHEGGNDAASARYIFTALAPTTRLLFPQADDDLLQKNVEEGMVVEPTWLCPIVPLILINGTEGIGTGWSTKIANRNPIDIIDMIRRKIDSISTEYEIPPFYEEFRGKLEVVTPTKFISSGKIQLIRPERKNASTFSIEIVELPIGIWTSKYKEKLSKIV----ETLP--VLEFSERHTEKRVHFRITLDRKKSSRFLQKSNSDLLNYFKLRTSLT-ENRVLFDRNGELKEFGNISEIAAEFFEVRRDLYEKRLKIQKEECEAKLIYVENQLNFIEMVTNGTIEIRSMGRNQLEEKLQEMGFRVDPMATIAK---------------------NSKKANYGYLLEMPV 1119          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: cin-4 (DNA topoisomerase-like protein cin-4 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ8])

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 359/654 (54.89%), Postives = 476/654 (72.78%), Query Frame = 2
Query: 1349 MPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAE-AAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW 3307
            +PKL+DAN AGTKNS QCTLILTEGDSAK+LAVSGL+V+GRD YGVFP R KLLNV +  V Q+ ++AE+  IIKI+GLQY++KYE  +  KTLRYGKL+IM + D DGS  KGLL+NF H  WP L K +FVE FITPI KA +  + +SFYS+PE  EW+ NT +   + +KYY GLGT TSKEAK+ FSDM RH I+F+Y+G +D K++ +AFSK K + R ++L   M+D  +R++ G+ E  LY K T+++T ++F N E++   N     SIPCL+DG KPGQRKVLFAC KR   +E+KVAQLAG+VAE+SAYHHGE SLM TI+NLAQD+VGS+NINLL+P GQFGTRL GGKDSAS R I  QLS++T+ +F   D+ VL++L ++NQ IEPEWY PIIPMVL+NG  G GTGWS+ IPN+NP++++ N+KR+I G     + PWY+NF G I+++  +++   GE++ LD  T+EITELP++ WT  YKE V+E     +DK    I DYKEY+TD TV+F+V+++P K  E E     H+ FKLQ  +  + M+LFD  G +R Y +   I + F+  R E Y++RK YLLG+L AQ+ +L NQARFIL  IN K++ EN K   ++D L+  K+D+DPVK W
Sbjct:   40 IPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPFRRKLLNVCDLNVNQIADSAEVNAIIKILGLQYTKKYETEDDFKTLRYGKLLIMANHDSDGSQFKGLLLNFFHRFWPALFKRDFVEDFITPIAKATEGKEEVSFYSLPEYSEWRMNTDNWKSYTIKYYNGLGTLTSKEAKKCFSDMVRHRIRFKYNGADDDKAVNMAFSKKKIEARTDYLMKLMQDKNQRKQQGLAEECLYNKETRFVTLKDFFNYEIVCSWNL---HSIPCLVDGLKPGQRKVLFACFKRANKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSHNINLLLPIGQFGTRLQGGKDSASARSIFAQLSQVTRTLFPAHDDNVLRFLYEENQRIEPEWYCPIIPMVLVNGAQGTGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRFACYGEVSVLDDNTIEITELPIKQWTQDYKEKVLEGLMESSDKKSPVIVDYKEYHTDTTVKFVVKLSPGKLRELERGQDLHQVFKLQAVINTTCMVLFDAAGWLRTYTSPEAITQEFYDSRQEKYVQRKEYLLGVLQAQSKRLTNQARFILATINNKIVLENKKKTAIVDVLIKMKFDADPVKKW 690          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 555.058 bits (1429), Expect = 4.457e-179
Identity = 295/703 (41.96%), Postives = 449/703 (63.87%), Query Frame = 2
Query:  122 YQKKTQLEHILLRPDSYVGSIK-KEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKE---DFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAAC-TQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQ--------VSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGS--ECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERS 2179
            Y+KK+  EH+LLRPD+Y+G +  +ED+++W+ D E  +M+ K++TY P L KIFDEILVNA+DNK RDS M  + + +D +   + +WNNG G+PV IH    +Y+PT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EF++ET      + F+Q W +NM  C + E+ +   E   D+T V F PDL+RF + +L +D++ L  RR +++AA   + + V+LNG++ +V  F+DYV ++         +   +++     RW V V    N  F +        VSFVN+I T KGG+HV+Y+ D      + K     K       +KPA +K N+ IF+ CLIENPSF+SQTKE +T   K+FGS  EC   +K      + G++E +    L  N         +   + ++D+ KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  +  +  KW++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +R+
Sbjct:   47 YEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFN--------DSSSLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD--KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDA-KKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 555.058 bits (1429), Expect = 4.457e-179
Identity = 295/703 (41.96%), Postives = 449/703 (63.87%), Query Frame = 2
Query:  122 YQKKTQLEHILLRPDSYVGSIK-KEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKE---DFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAAC-TQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQ--------VSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGS--ECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERS 2179
            Y+KK+  EH+LLRPD+Y+G +  +ED+++W+ D E  +M+ K++TY P L KIFDEILVNA+DNK RDS M  + + +D +   + +WNNG G+PV IH    +Y+PT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EF++ET      + F+Q W +NM  C + E+ +   E   D+T V F PDL+RF + +L +D++ L  RR +++AA   + + V+LNG++ +V  F+DYV ++         +   +++     RW V V    N  F +        VSFVN+I T KGG+HV+Y+ D      + K     K       +KPA +K N+ IF+ CLIENPSF+SQTKE +T   K+FGS  EC   +K      + G++E +    L  N         +   + ++D+ KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  +  +  KW++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +R+
Sbjct:   47 YEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFN--------DSSSLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD--KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDA-KKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0332320)

HSP 1 Score: 1330.47 bits (3442), Expect = 0.000e+0
Identity = 673/1173 (57.37%), Postives = 868/1173 (74.00%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYA--EAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKF---------------------NANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEIN 3559
            IE++YQKK+QLEHILLRPDSY+GS++   +LMWV+D+ +N MV+K+I++ P LYKIFDEILVNA+DNK RD  M TI+IDID + NMV +WNNG+GIPVT+HKE ++Y+PTMIFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS+ F +ET+++EY KSFKQTW NNM    D +I      D+T +TF PDL +F M RLDEDIVAL SRRAYD+AA ++G++VFLNG ++ V+ FKDY+DL+ K+  D +  P+K+V+E   +RWEVA   S +  F QVSFVNSIAT KGG HV+++ D L  ++LE  KKK K         P QV+ ++W+FV CLIENP+FDSQTKENMTL QK FGS+CTL+EKFI+ ++K GIVE +  W  FK Q     K    K +K+K +PKL+DAN AG KNS++CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGKLLNVREA  KQL+ENAEI N+ KIIGLQY +KY   + LKTLRYGK+MIMTDQDQDGSHIKGLLINFIH+ WP LL+  F+E+FITPIVKA K N+ LSFYS+PE  EW+ +T + + + +KYYKGLGTSTSKEAKEYF DM+RH I F+Y G  D +SIV+AFSK   + RK WLTN M++ KRR+ELG+ E YLY KGTK IT+ +FIN EL+LFSN DNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQL+GSVAE+SAYHHGE SL  TI+NLAQ+FVG+NNINLL P GQFGTRL+GGKD AS RYI T +S LT+LI+H  D+ +L Y +DD Q IEP WY PIIPMVL+NG +GIGTGWS+KI N+NP++++ NL++MING  P  MHPWY+NF G +  V + +Y+  G I  L G  LEI+ELPV VWT +YKE+V+E   +G +K    I++Y+EY+TD TVRF++   P ++    AE  GF++ FKL T L+ + M  FD+   +R++   I+IL+ ++K+R E Y +R+++L+G L+AQA +L +QARFILEK   K++ EN +   + D+L+   Y  DPVK W +                      + +    ++ E + ++   + +    F YL  M +  LT EKK  LLK+RD KL EL  ++ K+PE +WLDDL+ LE ++N
Sbjct:   10 IEQMYQKKSQLEHILLRPDSYIGSVEFTKELMWVYDNSQNRMVQKEISFVPGLYKIFDEILVNAADNKQRDKSMNTIKIDIDPERNMVSVWNNGQGIPVTMHKEQKMYVPTMIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETATREYKKSFKQTWGNNMGKASDVQIKDFNGTDYTRITFSPDLAKFKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNGNKLGVRNFKDYIDLHIKNTDDDSGPPIKIVHEVANERWEVACCPS-DRGFQQVSFVNSIATYKGGRHVDHVVDNLIKQLLEVLKKKNKGGINIK---PFQVRNHLWVFVNCLIENPTFDSQTKENMTLQQKGFGSKCTLSEKFINNMSKSGIVESVLAWAKFKAQN-DIAKTGGRKSSKIKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQKIEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRYIQTGNIQILSGNRLEISELPVGVWTQNYKENVLEPLSNGTEKVKGIISEYREYHTDTTVRFVISFAPGEFERIHAEEGGFYRVFKLTTTLSTNQMHAFDQNNCLRRFPTAIDILKEYYKLRREYYARRRDFLVGQLTAQADRLSDQARFILEKCEKKLVVENKQRKAMCDELLKRGYRPDPVKEWQRRIKMEDAEQADEEDEEEEEAAPSVSSKAKKEKEVDPEKAFKKLTDVKKFDYLLGMSMWMLTEEKKNELLKQRDTKLSELESLRKKTPEMLWLDDLDALESKLN 1177          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0081287)

HSP 1 Score: 1330.47 bits (3442), Expect = 0.000e+0
Identity = 673/1173 (57.37%), Postives = 868/1173 (74.00%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYA--EAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKF---------------------NANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEIN 3559
            IE++YQKK+QLEHILLRPDSY+GS++   +LMWV+D+ +N MV+K+I++ P LYKIFDEILVNA+DNK RD  M TI+IDID + NMV +WNNG+GIPVT+HKE ++Y+PTMIFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS+ F +ET+++EY KSFKQTW NNM    D +I      D+T +TF PDL +F M RLDEDIVAL SRRAYD+AA ++G++VFLNG ++ V+ FKDY+DL+ K+  D +  P+K+V+E   +RWEVA   S +  F QVSFVNSIAT KGG HV+++ D L  ++LE  KKK K         P QV+ ++W+FV CLIENP+FDSQTKENMTL QK FGS+CTL+EKFI+ ++K GIVE +  W  FK Q     K    K +K+K +PKL+DAN AG KNS++CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGKLLNVREA  KQL+ENAEI N+ KIIGLQY +KY   + LKTLRYGK+MIMTDQDQDGSHIKGLLINFIH+ WP LL+  F+E+FITPIVKA K N+ LSFYS+PE  EW+ +T + + + +KYYKGLGTSTSKEAKEYF DM+RH I F+Y G  D +SIV+AFSK   + RK WLTN M++ KRR+ELG+ E YLY KGTK IT+ +FIN EL+LFSN DNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQL+GSVAE+SAYHHGE SL  TI+NLAQ+FVG+NNINLL P GQFGTRL+GGKD AS RYI T +S LT+LI+H  D+ +L Y +DD Q IEP WY PIIPMVL+NG +GIGTGWS+KI N+NP++++ NL++MING  P  MHPWY+NF G +  V + +Y+  G I  L G  LEI+ELPV VWT +YKE+V+E   +G +K    I++Y+EY+TD TVRF++   P ++    AE  GF++ FKL T L+ + M  FD+   +R++   I+IL+ ++K+R E Y +R+++L+G L+AQA +L +QARFILEK   K++ EN +   + D+L+   Y  DPVK W +                      + +    ++ E + ++   + +    F YL  M +  LT EKK  LLK+RD KL EL  ++ K+PE +WLDDL+ LE ++N
Sbjct:   10 IEQMYQKKSQLEHILLRPDSYIGSVEFTKELMWVYDNSQNRMVQKEISFVPGLYKIFDEILVNAADNKQRDKSMNTIKIDIDPERNMVSVWNNGQGIPVTMHKEQKMYVPTMIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETATREYKKSFKQTWGNNMGKASDVQIKDFNGTDYTRITFSPDLAKFKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNGNKLGVRNFKDYIDLHIKNTDDDSGPPIKIVHEVANERWEVACCPS-DRGFQQVSFVNSIATYKGGRHVDHVVDNLIKQLLEVLKKKNKGGINIK---PFQVRNHLWVFVNCLIENPTFDSQTKENMTLQQKGFGSKCTLSEKFINNMSKSGIVESVLAWAKFKAQN-DIAKTGGRKSSKIKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQKIEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRYIQTGNIQILSGNRLEISELPVGVWTQNYKENVLEPLSNGTEKVKGIISEYREYHTDTTVRFVISFAPGEFERIHAEEGGFYRVFKLTTTLSTNQMHAFDQNNCLRRFPTAIDILKEYYKLRREYYARRRDFLVGQLTAQADRLSDQARFILEKCEKKLVVENKQRKAMCDELLKRGYRPDPVKEWQRRIKMEDAEQADEEDEEEEEAAPSVSSKAKKEKEVDPEKAFKKLTDVKKFDYLLGMSMWMLTEEKKNELLKQRDTKLSELESLRKKTPEMLWLDDLDALESKLN 1177          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 1372.07 bits (3550), Expect = 0.000e+0
Identity = 703/1212 (58.00%), Postives = 894/1212 (73.76%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXX--XXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAA--------------ETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+E   M  ++I++ P LYKIFDEILVNA+DNK RD  MTTI+I ID + N + +WNNG+GIPV  HK+ ++Y+P +IFG LLTS+N++D++K+VTGGRNGYGAKLCNIFS +F +ET+ KEY +SFKQTW+ NM    + +I     EDFTCVTF PDL +F+M +LD+DIVAL +RRAYD+A   +G+ V LNGK++ V +F+ YVD Y K  LD     LKVV E+  +RWEV +T S  + F Q+SFVNSIATTKGG H++Y+ DQ+  K++E  KKK K         P QVK ++W+FV  LIENP+FDSQTKENMTL  K FGS+C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESLK+LRYG++MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+E+FITPIVKA KN Q +SFYSIPE  EW+++T     W +KYYKGLGTSTSKEAKEYFSDMERH I F+Y+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  T+++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C+KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNN+N+L P GQFGTR+ GGKD+ASPRYI T LS L KL+F   D ++LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF GTI E+ +N+Y+V+GE++ LD  T+EI+ELPVR WT +YKESV+E    G DKTP  I+DYKEY+TD TV+F+V M   K A+AEAAG HK FKLQ+ LT ++M+LFD  G +++Y +  EIL+ FF++RL  Y  RK++L+G L A+++KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K     L  E     D +          P+F Y+  M +  LT EK E LLK+RD K  EL  +++K+ E +W +DL +  +E++ V  Q+     E VN          GKA+K+                ET PS F RR+EP
Sbjct:   50 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEEIG-MNLREISFVPGLYKIFDEILVNAADNKQRDKNMTTIKITIDPESNTISVWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSLKFTVETACKEYKRSFKQTWTENMGKSNEAKIKYFDGEDFTCVTFQPDLAKFNMEKLDKDIVALLTRRAYDVAGSCRGVKVILNGKKLPVNSFRSYVDFYVKDKLDETGVALKVVNETVNERWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYIVDQIVGKLIEVVKKKNKAGVSVK---PFQVKNHLWVFVNALIENPTFDSQTKENMTLQTKSFGSKCALSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKILGLQYKKSYDDPESLKSLRYGRIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEEFITPIVKASKNKQEVSFYSIPEFEEWKKHTESYKTWHIKYYKGLGTSTSKEAKEYFSDMERHRIMFKYNGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTSTRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCVKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSSLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGTIHELGQNQYLVSGEVSVLDKNTIEISELPVRTWTQAYKESVLEPMLQGTDKTPPLISDYKEYHTDTTVKFVVRMTEEKLAQAEAAGLHKVFKLQSSLTCNSMVLFDHMGCMKRYESVQEILKEFFELRLHYYKLRKDWLVGSLGAESAKLSNQARFVLEKIEGKLSIENKSKRDLIRMLVQRGYESDPVAAWNKAQEKSLEEEDGGGNDSDSSVDSGSFSGPNFNYILNMPLWCLTKEKVEELLKQRDLKKAELNELQSKTSENLWREDLAVFIEELDRVEEQEK----ESVNL---------GKAVKLVKGKVGKPKVKKMQLEETLPSPFGRRVEP 1243          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 681/1156 (58.91%), Postives = 873/1156 (75.52%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQD 3577
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD++   M  + IT+ P LYKIFDEILVNA+DNK RD  M  I+++ID + N + +WNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ +E  + FKQTW +NM    + +I     +D+TC+TF PDL +F M  LD+D VAL +RRAYDIA  T+G+ V LNGK++ +  F+ YVDLY K  +D    PL VV+E   +RWEV +T S  + F QVSFVNSIATTKGG H +Y+ADQ+ +K++E  KKK K         P QVK +MW+FV CLIENPSFDSQTKENMTL QK+FGS C+L++KF+     CGIVE +  W  FK QA L+KKCS  K TK+K +PKLDDAN AG KNS  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  PESLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+KA    Q +SFYSIPE  EW+        W++KYYKGLGTSTSKEAKEYFSDM RH I F+YSG  D ++I LAFSK   +ERKEWLT++M + ++RRE  + E YLYG+ TK +++ +FIN+EL+LFSN+DNERSIPC++DG KPGQRKV+F C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LKY  DDN  +EPEWY PIIP+VL NG +GIGTGW+S+IPN++ +++I+N+ RM+NG  P+ M P Y+ F GTI E+ +N+YV NGE+  +D TT+EITELPV+ WT +YKE+V+E+  +G +K PA ITDYKEY+TD TVRF+V+M   +  EAEAAG HK FKLQ  LT ++M+LFD  G ++KY +  +IL+ FF++R++ Y+ RK++L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVKAW   +A +   E+  +++DE+  ED+  PD+ YL  M +  LT EKK+ L K+RD K+ EL  +K K+P  +W +DL    +E+  V  ++
Sbjct:   29 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDTG-MNCRDITFVPGLYKIFDEILVNAADNKQRDKTMNCIKVNIDPENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSLKFTVETACRESKRCFKQTWFDNMGRAGESKIKPFDGDDYTCITFQPDLAKFKMQALDKDTVALLTRRAYDIAGSTKGVRVLLNGKRLPINNFRTYVDLYVKDKVDETGSPLTVVHEMVNERWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKKNKAGVAVK---PFQVKNHMWLFVNCLIENPSFDSQTKENMTLQQKNFGSACSLSDKFVKQANGCGIVESIMNWVKFKAQAQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSNSCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKILGLQYKKNYSDPESLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASNKKQEISFYSIPEFTEWKEKQSSIKSWKIKYYKGLGTSTSKEAKEYFSDMTRHRIPFKYSGPADDEAITLAFSKKMIEERKEWLTSFMINRRQRREHNLPEEYLYGQETKSLSYHDFINKELVLFSNSDNERSIPCMVDGLKPGQRKVVFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDNLRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVNNGEVAIIDSTTIEITELPVKTWTQTYKENVLEVMLNGTEKVPALITDYKEYHTDTTVRFVVKMTEERLREAEAAGLHKVFKLQNLLTCNSMVLFDHVGSLKKYESVQDILKEFFELRMKYYVLRKDWLVGMLGAESAKLSNQARFILEKIQGTLVIENKPKKELIRMLQQMGYDSDPVKAWK--DAQEKEEEEDAEDDDEKEKEDTSGPDYNYLLSMPMWYLTKEKKDELCKQRDAKMTELNTLKMKAPADLWKEDLAAFTEELERVEQKE 1177          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 414.075 bits (1063), Expect = 1.289e-125
Identity = 221/418 (52.87%), Postives = 301/418 (72.01%), Query Frame = 2
Query: 2324 SLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQD 3577
            SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LKY  DDN  +EPEWY PIIP+VL NG +GIGTGW+S+IPN++ +++I+N+ RM+NG  P+ M P Y+ F GTI E+ +N+YV NGE+  +D TT+EITELPV+ WT +YKE+V+E+  +G +K PA ITDYKEY+TD TVRF+V+M   +  EAEAAG HK FKLQ  LT ++M+LFD  G ++KY +  +IL+ FF++R++ Y+ RK++L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVKAW      +   E AED++++E  + SG PD+ YL  M +  LT EKK+ L K+RD K+ EL  +K K+P  +W +DL    +E+  V  ++
Sbjct:    2 SLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDNLRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVNNGEVAIIDSTTIEITELPVKTWTQTYKENVLEVMLNGTEKVPALITDYKEYHTDTTVRFVVKMTEERLREAEAAGLHKVFKLQNLLTCNSMVLFDHVGSLKKYESVQDILKEFFELRMKYYVLRKDWLVGMLGAESAKLSNQARFILEKIQGTLVIENKPKKELIRMLQQMGYDSDPVKAWKDAQEKE-EEEDAEDDDEKEKEDTSG-PDYNYLLSMPMWYLTKEKKDELCKQRDAKMTELNTLKMKAPADLWKEDLAAFTEELERVEQKE 417          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 127.872 bits (320), Expect = 1.371e-33
Identity = 58/96 (60.42%), Postives = 77/96 (80.21%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRG 397
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+E   M  ++I++ P LYKIFDEILVNA+DNK RD  MTTI+I ID + N + +WNNG+G
Sbjct:   45 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEEIG-MNLREISFVPGLYKIFDEILVNAADNKQRDKNMTTIKITIDPESNTISVWNNGKG 139          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1401.34 bits (3626), Expect = 0.000e+0
Identity = 713/1198 (59.52%), Postives = 897/1198 (74.87%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA--AETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+++  +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+I I+ + N V +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ +EY K FKQTW++NM+D  D +I     ED+TC+TF PDL +F M  LD+DIVAL SRRAYD+A  ++G+ VFLNGK++ +  F+ YVDLY K+ LD    PLKV++E    RWE+ +T S  + F Q+SFVNSIATTKGG HV+Y+ADQ+ AK++E  KKK K         P QVK +MW+FV  LIENP+FDSQTKENMTL  K FGS+CTL+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+ NT     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK++ DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEAAG HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W +    +        EE+EE   ++  PDF YL  M +  L+ EKK+ L K+RD K  EL  +K KSP  +W +DL    +E++ V  ++  E       VVK  GK G   +K     E  PS   RR+ P
Sbjct:   27 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVK---PFQVKNHMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQ--TQEKEEAGELLEEEEETEVNTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVK--GKSGRPQVKKMQLQEIMPSPHGRRVVP 1215          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1399.42 bits (3621), Expect = 0.000e+0
Identity = 713/1198 (59.52%), Postives = 897/1198 (74.87%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA--AETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+++  +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+I I+ + N V +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ +EY K FKQTW++NM+D  D +I     ED+TC+TF PDL +F M  LD+DIVAL SRRAYD+A  ++G+ VFLNGK++ +  F+ YVDLY K+ LD    PLKV++E    RWE+ +T S  + F Q+SFVNSIATTKGG HV+Y+ADQ+ AK++E  KKK K         P QVK +MW+FV  LIENP+FDSQTKENMTL  K FGS+CTL+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+ NT     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK++ DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEAAG HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W +    +        EE+EE   ++  PDF YL  M +  L+ EKK+ L K+RD K  EL  +K KSP  +W +DL    +E++ V  ++  E       VVK  GK G   +K     E  PS   RR+ P
Sbjct:   27 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVK---PFQVKNHMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQ--TQEKEEAGELLEEEEETEVNTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVK--GKSGRPQVKKMQLQEIMPSPHGRRVVP 1215          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1399.03 bits (3620), Expect = 0.000e+0
Identity = 713/1198 (59.52%), Postives = 897/1198 (74.87%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA--AETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+++  +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+I I+ + N V +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ +EY K FKQTW++NM+D  D +I     ED+TC+TF PDL +F M  LD+DIVAL SRRAYD+A  ++G+ VFLNGK++ +  F+ YVDLY K+ LD    PLKV++E    RWE+ +T S  + F Q+SFVNSIATTKGG HV+Y+ADQ+ AK++E  KKK K         P QVK +MW+FV  LIENP+FDSQTKENMTL  K FGS+CTL+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+ NT     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK++ DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEAAG HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W +    +        EE+EE   ++  PDF YL  M +  L+ EKK+ L K+RD K  EL  +K KSP  +W +DL    +E++ V  ++  E       VVK  GK G   +K     E  PS   RR+ P
Sbjct:   27 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVK---PFQVKNHMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQ--TQEKEEAGELLEEEEETEVNTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVK--GKSGRPQVKKMQLQEIMPSPHGRRVVP 1215          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1397.1 bits (3615), Expect = 0.000e+0
Identity = 713/1198 (59.52%), Postives = 897/1198 (74.87%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA--AETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+++  +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+I I+ + N V +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ +EY K FKQTW++NM+D  D +I     ED+TC+TF PDL +F M  LD+DIVAL SRRAYD+A  ++G+ VFLNGK++ +  F+ YVDLY K+ LD    PLKV++E    RWE+ +T S  + F Q+SFVNSIATTKGG HV+Y+ADQ+ AK++E  KKK K         P QVK +MW+FV  LIENP+FDSQTKENMTL  K FGS+CTL+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+ NT     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK++ DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEAAG HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W +    +        EE+EE   ++  PDF YL  M +  L+ EKK+ L K+RD K  EL  +K KSP  +W +DL    +E++ V  ++  E       VVK  GK G   +K     E  PS   RR+ P
Sbjct:   27 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVK---PFQVKNHMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQ--TQEKEEAGELLEEEEETEVNTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVK--GKSGRPQVKKMQLQEIMPSPHGRRVVP 1215          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1392.1 bits (3602), Expect = 0.000e+0
Identity = 713/1198 (59.52%), Postives = 897/1198 (74.87%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA--AETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+++  +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+I I+ + N V +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ +EY K FKQTW++NM+D  D +I     ED+TC+TF PDL +F M  LD+DIVAL SRRAYD+A  ++G+ VFLNGK++ +  F+ YVDLY K+ LD    PLKV++E    RWE+ +T S  + F Q+SFVNSIATTKGG HV+Y+ADQ+ AK++E  KKK K         P QVK +MW+FV  LIENP+FDSQTKENMTL  K FGS+CTL+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+ NT     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK++ DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELPVR WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEAAG HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W +    +        EE+EE   ++  PDF YL  M +  L+ EKK+ L K+RD K  EL  +K KSP  +W +DL    +E++ V  ++  E       VVK  GK G   +K     E  PS   RR+ P
Sbjct:   27 VERIYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVK---PFQVKNHMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQ--TQEKEEAGELLEEEEETEVNTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVK--GKSGRPQVKKMQLQEIMPSPHGRRVVP 1215          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2a (topoisomerase (DNA) II alpha [Source:MGI Symbol;Acc:MGI:98790])

HSP 1 Score: 1380.93 bits (3573), Expect = 0.000e+0
Identity = 692/1156 (59.86%), Postives = 882/1156 (76.30%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW----MKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVV 3565
            IE++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   +  +++T+ P LYKIFDEILVNA+DNK RD KM+ IR+ ID + N++ IWNNG+GIPV  HK  ++Y+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+S+EY K FKQTW +NM    D E+   + ED+TC+TF PDL +F M  LD+DIVAL  RRAYDIA  T+ + VFLNG  + VK F+ YVDLY K  +D     LKV++E    RWEV +T S    F Q+SFVNSIAT+KGG HV+Y+ADQ+ +K+++  KKK K           QVK +MWIFV  LIENP+FDSQTKENMTL  K FGS C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+ +TP+  KW++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  L++L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  LD TT+EI+ELP+R WT +YKE V+E   +G +KTP+ ITDY+EY+TD TV+F+++M   K AEAE  G HK FKLQ+ LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A++SKL NQARFILEKI+GK++ EN     LI  L+   YDSDPVKAW     K    +   E   +    ++  ++G P F YL  M +  LT EKK+ L K+R+EK +EL  +K KSP  +W +DL +  +E+ VV
Sbjct:   29 IERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNNGKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCLTMS-ERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAH---QVKNHMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAG-PTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVV 1178          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 1375.15 bits (3558), Expect = 0.000e+0
Identity = 708/1209 (58.56%), Postives = 897/1209 (74.19%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXS--GKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAA-----------ETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   +LMWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+ +K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW +        E ++++ D+ + +      PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++ V  Q   E  +I+  +        GKAIK              ET PS + RRI P
Sbjct:   39 VERVYQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVSKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQ---EREDILAGM-------SGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVP 1232          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 186.422 bits (472), Expect = 9.081e-53
Identity = 86/156 (55.13%), Postives = 117/156 (75.00%), Query Frame = 2
Query: 2585 INGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDE 3052
            ING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M   +E
Sbjct:    2 INGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMAAEEE 157          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 55.4546 bits (132), Expect = 3.707e-7
Identity = 56/144 (38.89%), Postives = 79/144 (54.86%), Query Frame = 2
Query: 3194 RFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXX---SGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVK 3616
            RFILEKI GK+  EN     LI  LV   Y+SDPVKAW +        E ++++ D+ + +    SG PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++          G+   TVVK
Sbjct:    1 RFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSG-PDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELD----------GDPDTTVVK 133          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|O42131|TOP2B_CHICK (DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1)

HSP 1 Score: 1382.47 bits (3577), Expect = 0.000e+0
Identity = 710/1202 (59.07%), Postives = 896/1202 (74.54%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXX--XXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKP--GKRGGKAIKIAA--ETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   +LMWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I+I ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    +P+I     +D+TC+TF PDL +F M  LD+DIV+L +RRAYD+A   +G+ V LNGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+  K++E  KKK K         P QVK ++W+FV CLIENPSFDSQTKENMTL  K FGS+C L+EKF    + CGI+E +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE PESLK+LRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNN+NLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+YVV+GEI  +D  T+EITELPVR WT  YKE V+E   +G +KTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW +        E  +  +++   A   +  PDF Y+  M + +LT EK E L+K RD K  EL  +K KS   +W +DL    +E+  V  Q   E  +++  +V KP  GK G   +K     ET PS F RRI P
Sbjct:   56 VERVYQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKISIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEPKIKHFEGDDYTCITFQPDLSKFKMENLDKDIVSLMTRRAYDLAGSCKGVKVMLNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHEVVNERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVK---PFQVKNHIWVFVNCLIENPSFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIIESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYEDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHMENHKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNLLQPIGQFGTRLHGGKDAASPRYIFTMLSPLARLLFPSVDDNLLKFLYDDNQRVEPEWYIPIIPMVLVNGAEGIGTGWACKLPNYDTREIVNNVRRMLDGLDPHPMLPNYKNFRGTIQELGQNQYVVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTEKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTSLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLHYYSLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKRDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDPQNANDDASSASGSTSGPDFNYILNMSLWSLTKEKVEELIKHRDSKERELNDLKRKSASDLWKEDLAAFVEELEKVEAQ---EREDVLAGMVGKPIKGKVGKPKMKKLQLEETMPSPFGRRIVP 1249          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|P41515|TOP2A_CRIGR (DNA topoisomerase 2-alpha OS=Cricetulus griseus OX=10029 GN=TOP2A PE=1 SV=1)

HSP 1 Score: 1381.31 bits (3574), Expect = 0.000e+0
Identity = 696/1154 (60.31%), Postives = 885/1154 (76.69%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNAN--KLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVV 3565
            IE++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   +  +++T+ P LYKIFDEILVNA+DNK RD KM+ IR+ ID + N++ IWNNG+GIPV  HK  ++Y+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS+ F +ET+SKEY K FKQTW +NM    D E+     ED+TC+TF PDL +F M  LD+DIVAL  RRAYDIA  T+ + VFLNG ++ VK F+ YVD+Y K  LD     LKVV+E    RWEV +T S  + F Q+SFVNSIAT+KGG HV+Y+ADQ+ +K+++  KKK K           QVK +MWIFV  LIENP+FDSQTKENMTL  K FGS C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K  ++K +PKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q L+FYS+PE  EW+ +TP+  KW++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLT++MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS LT+L+F   D+  LK+L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  L+ TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDY+EY+TD TV+F+++M   K AEAE  G HK FKLQT LT ++M+LFD  G ++KY+  ++IL+ FF++RL+ Y  RK +LLG+L A+++KL NQARFILEKI+GK+I EN     LI  L+   YDSDPVKAW +           +  D E+ +++ +SG P F YL  M +  LT EKK+ L K+R+EK +EL  +KNKSP  +W +DL +  +E+ VV
Sbjct:   29 IERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTRFTVETASKEYKKMFKQTWMDNMGRAGDMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNALKVVHEQVNPRWEVCLTMS-EKGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAH---QVKNHMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQELAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLTRLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILKDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNENSDSVAESG-PTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKNKSPSDLWKEDLAVFIEELEVV 1176          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q01320|TOP2A_MOUSE (DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2)

HSP 1 Score: 1380.93 bits (3573), Expect = 0.000e+0
Identity = 692/1156 (59.86%), Postives = 882/1156 (76.30%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW----MKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVV 3565
            IE++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   +  +++T+ P LYKIFDEILVNA+DNK RD KM+ IR+ ID + N++ IWNNG+GIPV  HK  ++Y+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+S+EY K FKQTW +NM    D E+   + ED+TC+TF PDL +F M  LD+DIVAL  RRAYDIA  T+ + VFLNG  + VK F+ YVDLY K  +D     LKV++E    RWEV +T S    F Q+SFVNSIAT+KGG HV+Y+ADQ+ +K+++  KKK K           QVK +MWIFV  LIENP+FDSQTKENMTL  K FGS C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+ +TP+  KW++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  L++L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  LD TT+EI+ELP+R WT +YKE V+E   +G +KTP+ ITDY+EY+TD TV+F+++M   K AEAE  G HK FKLQ+ LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A++SKL NQARFILEKI+GK++ EN     LI  L+   YDSDPVKAW     K    +   E   +    ++  ++G P F YL  M +  LT EKK+ L K+R+EK +EL  +K KSP  +W +DL +  +E+ VV
Sbjct:   29 IERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNNGKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCLTMS-ERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAH---QVKNHMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAG-PTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVV 1178          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q64511|TOP2B_MOUSE (DNA topoisomerase 2-beta OS=Mus musculus OX=10090 GN=Top2b PE=1 SV=2)

HSP 1 Score: 1375.15 bits (3558), Expect = 0.000e+0
Identity = 708/1209 (58.56%), Postives = 897/1209 (74.19%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXS--GKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAA-----------ETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   +LMWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+ +K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW +        E ++++ D+ + +      PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++ V  Q   E  +I+  +        GKAIK              ET PS + RRI P
Sbjct:   39 VERVYQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVSKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQ---EREDILAGM-------SGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVP 1232          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q02880|TOP2B_HUMAN (DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3)

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 709/1201 (59.03%), Postives = 898/1201 (74.77%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGK---PDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWV+D++   M  +++T+ P LYKIFDEILVNA+DNK RD  MT I++ ID + N++ IWNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    + +I     ED+TC+TF PDL +F M +LD+DIVAL +RRAYD+A   +G+ V  NGK++ V  F+ YVDLY K  LD     LKV++E   +RW+V +T S  + F Q+SFVNSIATTKGG HV+Y+ DQ+  K++E  KKK K         P QVK ++W+F+ CLIENP+FDSQTKENMTL  K FGS+C L+EKF    + CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+++  +   W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK+L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELPVR WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEAAG HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW K    K   E     + +++  DSG    PDF Y+  M + +LT EK E L+K+RD K  E+  +K KSP  +W +DL    +E++ V +Q+  +   G     +  K GK   K +++  ET PS + RRI P
Sbjct:   51 VERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVG-MNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVK---PFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAW-KEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQL-EETMPSPYGRRIIP 1244          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A2R2MQU0 (DNA topoisomerase 2 OS=Lingula unguis OX=7574 GN=LOC106174550 PE=3 SV=1)

HSP 1 Score: 1426.38 bits (3691), Expect = 0.000e+0
Identity = 729/1202 (60.65%), Postives = 919/1202 (76.46%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFN-----ANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIA-AETAPSKFSRRIEP 3697
            +E++YQKK+QLEHILLRPD+Y+GS++K  + MWV ++E + M+++ +T+ P LYKIFDEILVNA+DNK RD KMTTI+IDIDS+ N V+IWNNG+GIPV  HK  +V +PT+IFG LLTS+N+ND++++VTGGRNGYGAKLCNIFS++FV+ETSSK+ G +FKQTW++NM    + +I+  A ED+TC+TF PDL +F M  LD+DIV LFSRRAYDIAA T+G+ VFLNGK++ + +F+ YVDL+ K   D N +PL VV+E    RWEVAVT S +  F Q SFVNSIATTKGG H++Y  DQ+  K+ +  KKK      AVK  P Q+K +MW+FV CLI NP+FDSQTKENMTL  K FGS+C LN+KFI  V+KCGIVE +  W  FK Q  L+KKC  +K +KLK +PKLDDAN AGTKNS  CTLILTEGDSAK+LAV+GL+VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI N+IKI+GLQY  KY+ PE+LKTLRYGK+MIMTDQDQDGSHIKGLL+NFIH  WP+LLKHNFVE+FITPIVK  K  +  +FYS+PE  EW+  TP+ + +R KYYKGLGTSTSKEAKEYFSDMERH I F+YSG  D  SI LAFSK K +ERK+WL+N+MED KRR ELG+ +VYLYGK T++IT+ +FIN+ELILFSN DNERSIP L+DGFKPGQRKV+F CLKRNL KE+KVAQLAGSV+E+SAYHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKD+ASPRYI T LS L + +F+  DE + KY  DDN  +EP++Y PI+PMVL+NG +GIGTGWS+KIPN++ ++++ NLKR+I+G  P  M P ++NF GTI E    + + +GE++ LD  T+EITELP+RVWT +YKESV+E    G DKTPA I+DYKEY+TD TV+F+V+M   K A+AE  G HKFFKLQT ++ SNM+LFD+ G ++KY+   ++L  F+ VR+E YIKRK+YL G+LSA+A KL+NQARFI EKI+G++  EN     LI  LV   YDSDP+KAW +       A++  +E   D+E  EA   +G PDF Y+  + + +L+ EKKE LLK+RD K EEL  ++ K+P  +W DDLE   +E+  V  ++  +    VN  V K  K   K  KI   ET PS   RR+EP
Sbjct:   65 VERIYQKKSQLEHILLRPDTYIGSVEKVTQPMWVINEEADRMIQRDLTFVPGLYKIFDEILVNAADNKQRDPKMTTIKIDIDSENNRVKIWNNGKGIPVIEHKTEKVMVPTLIFGHLLTSSNYNDEEQKVTGGRNGYGAKLCNIFSNKFVVETSSKDEGHAFKQTWTHNMGKATEAKITPCASEDYTCITFEPDLAKFKMDSLDKDIVDLFSRRAYDIAASTKGVKVFLNGKKLPINSFRSYVDLFLKDKFDDNGQPLNVVHEVINPRWEVAVTLS-DSGFKQASFVNSIATTKGGRHIDYFVDQVVNKLADVVKKKQGKGGMAVK--PFQIKNHMWVFVNCLIVNPTFDSQTKENMTLQAKSFGSKCELNDKFIQQVSKCGIVESILSWVKFKTQTQLNKKCHASKHSKLKGIPKLDDANDAGTKNSAHCTLILTEGDSAKTLAVAGLSVIGRDQYGVFPLRGKVLNVREATHKQIMENAEINNLIKIVGLQYKNKYDSPETLKTLRYGKIMIMTDQDQDGSHIKGLLVNFIHHNWPSLLKHNFVEEFITPIVKVTKGKEEKAFYSLPEFEEWKEATPNWHTYRCKYYKGLGTSTSKEAKEYFSDMERHRIPFKYSGPSDDASITLAFSKKKIEERKQWLSNFMEDRKRRAELGLPDVYLYGKDTRHITYNDFINKELILFSNMDNERSIPSLIDGFKPGQRKVMFTCLKRNLQKEIKVAQLAGSVSEMSAYHHGEMSLMGTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDAASPRYIFTALSPLARAVFNAHDEPLYKYCYDDNLKVEPQFYVPILPMVLVNGAEGIGTGWSTKIPNYDIREIVSNLKRLIDGEEPRPMIPAFKNFIGTI-EDHSGETICHGEVSILDDETIEITELPIRVWTQNYKESVLEPMLQGTDKTPAVISDYKEYHTDVTVKFVVKMTAEKLAQAEQVGLHKFFKLQTSIS-SNMVLFDKNGCLKKYDRAEDVLREFYDVRMEYYIKRKDYLEGLLSAEALKLENQARFICEKIDGEISIENKPKKELIQLLVRRGYDSDPLKAWREAQDKLAEADRGGVETESDDEQSEASSTAGGPDFNYILNLPLWSLSKEKKEELLKQRDAKQEELRALRRKTPSCLWKDDLEKFLEELEKVEQKEREDAAAGVNPGVVKTAKGRAKPKKIHIEETKPSPMGRRVEP 1261          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A0L8FFS9 (DNA topoisomerase 2 (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023035mg PE=3 SV=1)

HSP 1 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 721/1197 (60.23%), Postives = 916/1197 (76.52%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQ-DTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKK+QLEHILLRPD+Y+GS++   + MWV D++ + MV+++I+Y P LYKIFDEILVNA+DNK RD KM TI+IDIDS+ N ++IWNNG+GIPV  HK  ++Y+PTMIFG LLTS+N++D +K+VTGGRNGYGAKLCNIFS++FV+ETS +EY ++FKQTW+ NM +  +P I+++  +DFT +TF PDL +F +  LD+D VALF RRA+DIAA T+G+ V LNGK++ VK FKDYVDLY K  +D   +PLKV+YES   RWE+AVT S +  F Q SFVNSIATTKGG H+++++D L  KI+E  KKK K         P Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGS+C  +EKFI+ V+KCG+VE +  W  FK QA L KKC  +K +KLK +PKLDDAN+AGTKNS  CTLILTEGDSAKSLAV+GL ++GRD YGVFPL+GK+LNVREA  KQ+ ENAEI N+IKI+GLQ+ +KYE  E L+TLRYGK+MIMTDQD DGSHIKGL+INFIH  WPNLLKHN VE+FITPIVK  KN    +FYSIPE  EWQR T + + W++KYYKGLGTST+KEAKEYFSDMERH I F+Y G ED  SI LAFSK K DERKEWLTNWME+ +RR E+G+ E+YLYGKG   I+F  FIN+ELILFS TDN RSIP L+DG KPGQRKV+F C KRN  KE+KVAQLAGSVAELSAYHHGEASLMSTIINLAQ+FVGSNNINLL+P GQFGTRL GGKD+ASPRYI T LS + K IFH DD  +LK L DDNQ IEPE+Y PIIPM+L+NG DGIGTGWS+KIPN++P+++I N++RM++G  P+ M PW++NF GTI E+ ENKY+V+GEI+ LD TT+EITELP+R WT +YKE V+E   HG++K P+ I DYKEY+TD +VRF+V+M+  K A AEA+G HKFFKLQT  + ++M+LFD+ G IRKY+   +I+  FF +RL+ Y +RK+Y+ G+  +++ K  N ARFI+EKI+G V  ENV    LI  LV   YDSDP+KAW +  +        ++  D+E  E++  PDF Y+  + +  LT EKKE  +++R+ K +EL R++ K PE ++ +DL++L  E++    Q    E  +I+ T     G+   K I +  ET PS   RRI+P
Sbjct:   40 VERIYQKKSQLEHILLRPDTYIGSVQLHTQQMWVIDEDLSTMVQREISYVPGLYKIFDEILVNAADNKQRDPKMNTIKIDIDSENNRIKIWNNGKGIPVVEHKTEKMYVPTMIFGHLLTSSNYDDSEKKVTGGRNGYGAKLCNIFSTKFVVETSCQEYKRAFKQTWTGNMLNASEPVITESRADDFTAITFCPDLPKFQLESLDKDHVALFCRRAFDIAASTRGVKVMLNGKRVPVKNFKDYVDLYIKDKVDDAGQPLKVIYESVSDRWEIAVTIS-DSGFQQASFVNSIATTKGGRHIDHVSDPLVNKIIEVVKKKNKGGLNIK---PFQIKSHMWLFVNCLIENPTFDSQTKENMTLQPKSFGSKCQPSEKFITAVSKCGVVESVMSWMKFKEQAQLQKKCHSSKHSKLKGIPKLDDANWAGTKNSSHCTLILTEGDSAKSLAVAGLGIVGRDCYGVFPLKGKVLNVREATHKQIMENAEINNLIKILGLQFKEKYEDIEKLRTLRYGKIMIMTDQDNDGSHIKGLIINFIHHFWPNLLKHNVVEEFITPIVKVTKNKVEKAFYSIPEFEEWQRGTQNWHTWKIKYYKGLGTSTAKEAKEYFSDMERHRIPFKYEGPEDDASINLAFSKKKIDERKEWLTNWMEEKRRRLEMGLPELYLYGKGVNQISFNEFINRELILFSFTDNNRSIPSLVDGLKPGQRKVIFTCFKRNDKKEVKVAQLAGSVAELSAYHHGEASLMSTIINLAQNFVGSNNINLLLPIGQFGTRLHGGKDAASPRYIFTLLSSVGKRIFHSDDLPLLKNLYDDNQKIEPEYYVPIIPMILVNGTDGIGTGWSTKIPNYDPREIITNIRRMLSGNDPLNMVPWFKNFKGTIEELSENKYLVSGEISVLDETTVEITELPIRTWTQNYKEEVLEPMLHGSEKNPSVIIDYKEYHTDTSVRFVVKMSGEKLANAEASGLHKFFKLQTTFSTNSMVLFDQNGCIRKYDKVEQIMREFFDLRLDYYKRRKDYMEGMFKSESLKFDNIARFIMEKIDGLVKIENVSKKDLIQLLVRRGYDSDPIKAWRESQSKNKE---KDESSDDEEKEETTGPDFNYILGLPLWCLTKEKKEEYIRQREAKADELERLRRKRPEDIYRNDLDVLLTELDQFEEQVREDEKVDIIKTQKTSKGRVKQKKITL-EETLPSPVGRRIQP 1228          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A0X3PUD6 (DNA topoisomerase 2 OS=Schistocephalus solidus OX=70667 GN=TR96187 PE=3 SV=1)

HSP 1 Score: 1418.68 bits (3671), Expect = 0.000e+0
Identity = 728/1238 (58.80%), Postives = 905/1238 (73.10%), Query Frame = 2
Query:   89 NERVPED-----------IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANE--EPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXX---------------XXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGG-------KAIKIAAETAPSKFSRRIEP 3697
            N  VPED           +E++YQKKTQLEHIL+RPD+Y+GS+++   LMW++D EK  M++K+ITY P LYKI+DEILVNA+DNK+RD  M  I+IDI ++ N++RIWNNG GIPV  H+  ++++P++IFG LLTS+N++D +K+VTGGRNG+GAKLCNIFS +FV+ETSSKE+ K FKQTW +NM    +P I+ +A EDFTC++FYPDL RF MT L+ D VALF RRAYDIAA T+G+ V LNG ++ +K FKDYVDLY K   D  E  E + VVYE    RWEVAV  S N  F QVSFVNSIATTKGG H++Y++DQ+A K+++  KKK       VK    Q++ +MW+FV CLIENPSFDSQTKE MTL  K FGS C L+EKFI+ V++ GIVE +  W  FK Q  +DK+C K+K  KLK +PKLDDAN AGTKNS  CTLILTEGDSAK+LAV+GL+V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI N+IKI+GLQY  KYE PES+ TLRYGK+MIMTDQDQDGSHIKGLLI+FIH  WP LL HNF+E+FITPIVK FK  Q L+FYSIPE  EWQ+ T + + WR+KYYKGLGTSTSKEAK+YFSDM RH I+FRYSG ED  SI LAF+K K+D+RK WLT WM + KRR ELG+ E YLYG GT  IT+ +F+++ELILFSN DNERSIP L+DG KPGQRKVL+ CLKRNLVKE+KVAQL+GSVAE+S+YHHGEASLM TII LAQDFVGSNN+NLLMP+GQFGTRL+GGKD+ASPRYI T LS  T+ IF   D+A+L YL +DNQ IEP WY P+IPMVLING DGIGTGW +KIPN++  +VI NL+RMI+G  P+ M P +R+F G I E+ +N+YVV GEI  LD  T+EITELPVRVWT SYKE V+E+  +G++K PA I DYKEY+TD TVRF+V M P K  EAEA G HKFFKL T +T ++M+LFD  G +++Y +  EIL+ FF++RLE Y KRK+YL G+LSA+A +L+NQARF+LEKI GK+  EN     LI  L    Y+ DPV AW K   +KL   +                       A   S   D+ Y+  M + +LT E+K+ LL +RD+K  EL  + +KS  ++W DDL+ LE  +         +   ++    KK  K+         KA K   +T P    +RI P
Sbjct:    8 NGDVPEDGIVDPAKKRLSVERIYQKKTQLEHILIRPDTYIGSVERATTLMWLYDKEKQAMIQKEITYTPGLYKIYDEILVNAADNKVRDPSMNCIKIDIKAEDNLIRIWNNGAGIPVVHHRVEKMFVPSLIFGHLLTSSNYDDTEKKVTGGRNGFGAKLCNIFSRKFVVETSSKEHKKCFKQTWIDNMTKTSEPRITASAGEDFTCISFYPDLARFGMTELEADTVALFERRAYDIAASTRGVKVILNGVRVPIKNFKDYVDLYLK---DKGEDGEAVPVVYECVNPRWEVAVAAS-NLGFQQVSFVNSIATTKGGKHIDYISDQVANKLVDVVKKKSGKSGVTVKSF--QIRSHMWVFVNCLIENPSFDSQTKEFMTLQSKSFGSTCVLSEKFINQVSRSGIVENVLSWVRFKAQEKMDKQCHKSKHVKLKGIPKLDDANDAGTKNSAACTLILTEGDSAKTLAVAGLSVVGRDRYGVFPLRGKLLNVREASSKQIMENAEINNLIKILGLQYKNKYETPESVATLRYGKIMIMTDQDQDGSHIKGLLISFIHHNWPKLLHHNFLEEFITPIVKVFKGKQELAFYSIPEFEEWQKTTSNWHTWRVKYYKGLGTSTSKEAKDYFSDMTRHRIRFRYSGPEDDASITLAFNKNKSDDRKSWLTTWMNERKRRVELGLPEDYLYGSGTHAITYSDFVHKELILFSNMDNERSIPSLVDGLKPGQRKVLYTCLKRNLVKEIKVAQLSGSVAEMSSYHHGEASLMGTIIGLAQDFVGSNNLNLLMPHGQFGTRLSGGKDAASPRYIFTSLSPFTRKIFSERDDAILHYLFEDNQRIEPYWYIPVIPMVLINGADGIGTGWGTKIPNYDVMEVISNLRRMIDGADPLPMLPSFRDFRGVIQELGDNRYVVFGEIAILDEQTVEITELPVRVWTQSYKEGVLEVMLNGSEKVPASILDYKEYHTDATVRFVVRMTPEKLREAEAIGLHKFFKLSTAMTTNSMVLFDHMGCVKRYASVSEILKEFFELRLEWYNKRKSYLEGMLSAEARRLENQARFVLEKIQGKISIENRAKRDLIRLLKEHNYEPDPVHAW-KECIDKLAAIEDARAASRAAGEGEEEDSEEQGGDASTSSAAADYNYILGMPLWSLTKERKDDLLAQRDKKQAELTELLSKSARRLWRDDLDELEAVVKKYEEDRQKDMQSLIEAAEKKMSKQTASGRNVPSKASKSVKQTLPDPLGKRIVP 1238          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: G4VPA9 (DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183 GN=Smp_065840 PE=3 SV=1)

HSP 1 Score: 1414.05 bits (3659), Expect = 0.000e+0
Identity = 723/1211 (59.70%), Postives = 913/1211 (75.39%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTX------XXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKK--------PGKRGG-KAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPDSY+GS  K+ + MWV D+ +  MV + IT++P LYKIFDEILVNA+DNK+RD  M+ I+IDI+   NMVRIWN+G+GIPV  HK    Y+PT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +F++ETSSKEY KSF+Q W +NM    DP+I     EDFTC+TFYPDL RF M  L++D V+LF+RRAYD+AA   GI VFLNGK++ +K F DYV+L+ K   D + + +KVVYE+  +RW+VAV  S N  F QVSFVNSIATTKGGTH+NY++DQ+  K+++  KKK       +K  P Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGS CTL+EKFI   +K GIVE +  W  FK    +DK+C K+K +KLK +PKLDDAN AGTKNS QCTLILTEGDSAK+LAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE  ++LK LRYGK+MIMTDQDQDGSHIKGL+INF+H  WPNLLKHN VE+FITPIVK FK  Q  SFYS+PE  EWQ++TP+ + WR+KYYKGLGTSTSKEAKEYFSDM RH I+FRYSG ED  SI LAF K+K  +RK WLTN+ ++ KRRRELG+ E YLYGK T+ IT+ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNL++E+KVAQLAGSVAELSAYHHGE SLMSTII LAQ+FVGSNN+NLL P GQFGTRL+GGKD+ASPRYI T L+ LT+LIFH +D+ +L YL DDNQ IEPEWYAPIIPMVL+NG DGIGTG+++ I N+N  ++I+NL RM++G  P +M P +R FTGTI ++  N+YV  GE+  LD  TLEITELP+RVWT +YKESV+E   +G++K PA ITDYKEY+TD TVRF+++M+P K  EAE+ G HKFFKLQT ++  +M+ FD  G ++ Y N I I+  F+++RL  Y KRK YL G+LSA+A KL+NQARF+LEKI   ++ EN     LI  L  A YDSDPVKAW K + +K          + ++   +    ++G+PD+ Y+  M + +LT E+K+ LL +RD K +EL+ +K+KSP  +W +DL+ LE+E   V  +  ++    +    KK         G+    K+ K+A ET P    RRI P
Sbjct:   32 VERIYQKKTQLEHILLRPDSYIGSTLKDTQQMWVLDESQQHMVNRDITFSPGLYKIFDEILVNAADNKVRDPTMSCIKIDINPAENMVRIWNDGKGIPVVHHKVENTYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWVDNMTKTSDPKILADKGEDFTCITFYPDLSRFGMNELEQDTVSLFTRRAYDMAATCNGIKVFLNGKRLPIKNFVDYVNLFIKPNKD-DADSVKVVYEAVNQRWQVAVAVS-NTGFQQVSFVNSIATTKGGTHINYVSDQIVNKLMDIVKKKSGKSGVQIK--PFQIKNHMWLFVNCLIENPTFDSQTKENMTLQIKSFGSTCTLSEKFIGQASKSGIVENVLSWIRFKAMEKMDKQCHKSKHSKLKGIPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESADTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVEEFITPIVKVFKGKQEHSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGIEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQRIEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGSNRYVCYGEVAVLDDDTLEITELPIRVWTQNYKESVLEPMLNGSEKVPACITDYKEYHTDVTVRFVIKMSPEKLREAESTGLHKFFKLQTVMSTGSMVCFDPLGCLKCYPNEIIIIREFYELRLTWYEKRKVYLEGVLSAEARKLENQARFVLEKIQSIMVIENKPKKELIRMLKEANYDSDPVKAW-KESIDKAAALQEQEEARTDEAVSQTEAVEAGQPDYNYILNMPLWSLTKERKDDLLAQRDAKQKELLILKSKSPSDLWREDLKKLEEEYKKVEAELAADEQAAIEAADKKLKIASTTTAGRVAATKSRKLAMETRPDPMGRRIVP 1237          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A3Q0KH18 (DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1413.67 bits (3658), Expect = 0.000e+0
Identity = 723/1211 (59.70%), Postives = 913/1211 (75.39%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTX------XXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKK--------PGKRGG-KAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPDSY+GS  K+ + MWV D+ +  MV + IT++P LYKIFDEILVNA+DNK+RD  M+ I+IDI+   NMVRIWN+G+GIPV  HK    Y+PT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +F++ETSSKEY KSF+Q W +NM    DP+I     EDFTC+TFYPDL RF M  L++D V+LF+RRAYD+AA   GI VFLNGK++ +K F DYV+L+ K   D + + +KVVYE+  +RW+VAV  S N  F QVSFVNSIATTKGGTH+NY++DQ+  K+++  KKK       +K  P Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGS CTL+EKFI   +K GIVE +  W  FK    +DK+C K+K +KLK +PKLDDAN AGTKNS QCTLILTEGDSAK+LAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE  ++LK LRYGK+MIMTDQDQDGSHIKGL+INF+H  WPNLLKHN VE+FITPIVK FK  Q  SFYS+PE  EWQ++TP+ + WR+KYYKGLGTSTSKEAKEYFSDM RH I+FRYSG ED  SI LAF K+K  +RK WLTN+ ++ KRRRELG+ E YLYGK T+ IT+ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNL++E+KVAQLAGSVAELSAYHHGE SLMSTII LAQ+FVGSNN+NLL P GQFGTRL+GGKD+ASPRYI T L+ LT+LIFH +D+ +L YL DDNQ IEPEWYAPIIPMVL+NG DGIGTG+++ I N+N  ++I+NL RM++G  P +M P +R FTGTI ++  N+YV  GE+  LD  TLEITELP+RVWT +YKESV+E   +G++K PA ITDYKEY+TD TVRF+++M+P K  EAE+ G HKFFKLQT ++  +M+ FD  G ++ Y N I I+  F+++RL  Y KRK YL G+LSA+A KL+NQARF+LEKI   ++ EN     LI  L  A YDSDPVKAW K + +K          + ++   +    ++G+PD+ Y+  M + +LT E+K+ LL +RD K +EL+ +K+KSP  +W +DL+ LE+E   V  +  ++    +    KK         G+    K+ K+A ET P    RRI P
Sbjct:   32 VERIYQKKTQLEHILLRPDSYIGSTLKDTQQMWVLDESQQHMVNRDITFSPGLYKIFDEILVNAADNKVRDPTMSCIKIDINPAENMVRIWNDGKGIPVVHHKVENTYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWVDNMTKTSDPKILADKGEDFTCITFYPDLSRFGMNELEQDTVSLFTRRAYDMAATCNGIKVFLNGKRLPIKNFVDYVNLFIKPNKD-DADSVKVVYEAVNQRWQVAVAVS-NTGFQQVSFVNSIATTKGGTHINYVSDQIVNKLMDIVKKKSGKSGVQIK--PFQIKNHMWLFVNCLIENPTFDSQTKENMTLQIKSFGSTCTLSEKFIGQASKSGIVENVLSWIRFKAMEKMDKQCHKSKHSKLKGIPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESADTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVEEFITPIVKVFKGKQEHSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGIEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQRIEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGSNRYVCYGEVAVLDDDTLEITELPIRVWTQNYKESVLEPMLNGSEKVPACITDYKEYHTDVTVRFVIKMSPEKLREAESTGLHKFFKLQTVMSTGSMVCFDPLGCLKCYPNEIIIIREFYELRLTWYEKRKVYLEGVLSAEARKLENQARFVLEKIQSIMVIENKPKKELIRMLKEANYDSDPVKAW-KESIDKAAALQEQEEARTDEAVSQTEAVEAGQPDYNYILNMPLWSLTKERKDDLLAQRDAKQKELLILKSKSPSDLWREDLKKLEEEYKKVEAELAADEQAAIEAADKKLKIASTTTAGRVAATKSRKLAMETRPDPMGRRIVP 1237          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 1379 bits (3568), Expect = 0.000e+0
Identity = 708/1200 (59.00%), Postives = 895/1200 (74.58%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXX--XXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQ--DTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD+E   M  ++ITY P LYKIFDEILVNA+DNK RD  M++I+I ID + N V IWNNG+GIPV  HK+ ++Y+P +IFG LLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    DP+I     +DFTCVTF PDL +F M +LD+DIVAL +RRAYD+A   +G+ VFLNGK++ V  F+ YVDLY K  LD     LKVV ES  +RWEV +T S  + F Q+SFVNSIATTKGG H++Y+ DQ+ +K++E  KKK K         P QVK ++W+FV  LIENP+FDSQTKENMTL  K FGS+C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESLK+LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+E+FITPIVKA KN Q + FYSIPE  EW++ T +   W +KYYKGLGTSTSKEAKEYF+DMERH I F+Y G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  T+++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C+KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNN+N+L P GQFGTR+ GGKD+ASPRYI T LS L KL+F   D  +LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM++   P+ M P Y+NF G I E+ +N+YVV+GEI+ LD  T+EITELP+R WT +YKESV+E    G +KTPA I DYKEY+TD TV+F+V M   K A+AEAAG HK FKLQ+ LT ++M+LFD  G +++Y +  +IL+ FF++RL  Y  RK++L+G L A+++KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW +     L  E     + +       S  P+F Y+  M +  LT EK + LLK+RD K  EL  ++ K  E +W +DL +  +E++ V  Q  +++  G+ V  V  K GK   K I++  ET PS F RR+EP
Sbjct:   50 VERVYQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEEIG-MNLREITYVPGLYKIFDEILVNAADNKQRDKNMSSIKITIDPESNTVSIWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWQNNMTKTSDPKIKYFDGDDFTCVTFQPDLSKFKMEKLDKDIVALLTRRAYDVAGSCKGVKVFLNGKKLPVNGFRSYVDLYVKDKLDETGVALKVVNESVNERWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVSKLIEVVKKKNKAGVTVK---PFQVKNHIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCALSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEEFITPIVKASKNKQEIPFYSIPEFDEWKKQTENYKTWHIKYYKGLGTSTSKEAKEYFADMERHRIMFKYGGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTATRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCMKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLDHQDPLPMLPSYKNFKGVIHELGQNQYVVSGEISVLDKNTIEITELPIRTWTQAYKESVLEPMLQGTEKTPALINDYKEYHTDTTVKFVVRMTEEKLAQAEAAGLHKVFKLQSSLTCNSMVLFDHMGCMKRYESVQDILKEFFELRLHYYKLRKDWLVGSLGAESAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQRGYESDPVAAWNRAQEKALEEEDRDGNESDSSIDSGSSSGPNFNYILNMPLWCLTKEKVDELLKQRDLKKAELNELQRKCSEDLWREDLAVFVEELDRVEEQERESASQGKGVKLVKGKVGKPKVKKIQL-EETLPSPFGRRVEP 1243          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 682/1196 (57.02%), Postives = 875/1196 (73.16%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD++   +  + IT+ P LYKIFDEILVNA+DNK RD+ M  I+I+IDS+ N + +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+  E   SFKQTW +NM+   + +I   + +D+TC+TF PDL +F M  LD D VAL +RRAYDIA  ++G+ V LNG +++V  F+ YVDLY K  +D    PL VV+E    RWEV +T S  + F QVSFVNSIATTKGG H +Y+ADQ+ +K++E  KK+ K         P QVK +MW+FV CLIENPSFDSQTKENMTL QK FGS C L+EKFI     CGIV+ +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG K+S  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  P+SLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+K    NQ  SFYSIPE  EW+    +   W++KYYKGLGTSTSKEAKEYFSDM RH I FRYSG  D ++I LAFS+ K +ERK+WLT++M + ++RRE  + E YLYGK T  +T+ +F+N+EL+LFSN+DNERSIPCL+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ L              P GQFGTRL GGKDSASPRYI T LS L++L+F   D+ +LKY  DDN  +EPEWY PIIP+VL+NG DGIGTGW+ K+PNF+ +++I+N+ RM+NG  P+ M P Y+ F GTI E+  N Y+++GE++ +D TT+EI+ELPV+ WT SYKE+V+E+  +G+DK PA ITDY+EY+TD TVRF+V+M   +  EAEAAG HK FKLQ+PLT ++M+LFD  G ++KY    +IL+ FF++RL+ Y+ RK +L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVK W K    K     A +E++++  + SG PD+ YL  M +  LT EKK+ L K+RD KL EL  ++ K+P  +W  DL    +E+  V   +     ++  T VK  G R  K +K+  ET P+   RR+ P
Sbjct:   29 VERIYQKKTQLEHILLRPDTYIGSVEPLSQQMWVFDEDVG-LNCRDITFVPGLYKIFDEILVNAADNKQRDNSMNCIKINIDSENNTISVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTKFTVETACAESKYSFKQTWFDNMSRAGEAKIKPFSGDDYTCITFRPDLTKFKMQSLDRDTVALMTRRAYDIAGASKGVRVLLNGTKLSVNGFRSYVDLYLKDKVDETGTPLTVVHEVVNSRWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKRNKGGVAVK---PFQVKNHMWLFVNCLIENPSFDSQTKENMTLQQKSFGSTCLLSEKFIKQANTCGIVDSIMNWVKFKAQNQLNKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTIVGL--------------PLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDNVKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEELTSNHYLISGEVSIIDSTTIEISELPVKTWTQSYKENVLEVMLNGSDKVPALITDYREYHTDSTVRFVVKMTEERLIEAEAAGLHKVFKLQSPLTCTSMVLFDHVGSLKKYEFVQDILKDFFELRLKYYVLRKAWLVGMLGAESAKLSNQARFILEKIEGTLVIENKPKKELIRMLQEMGYDSDPVKVW-KQAQEKEVEIDAGEEDEQKEEQTSG-PDYNYLLSMPMWYLTKEKKDELCKQRDAKLTELNMLEKKTPSDLWQADLAAFTEELERVEQAEKESQAKV--TQVKGKGGR-TKVVKMKDETLPTPQGRRVIP 1200          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1322.76 bits (3422), Expect = 0.000e+0
Identity = 682/1196 (57.02%), Postives = 875/1196 (73.16%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD++   +  + IT+ P LYKIFDEILVNA+DNK RD+ M  I+I+IDS+ N + +WNNG+GIPV  HK  +V++P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ET+  E   SFKQTW +NM+   + +I   + +D+TC+TF PDL +F M  LD D VAL +RRAYDIA  ++G+ V LNG +++V  F+ YVDLY K  +D    PL VV+E    RWEV +T S  + F QVSFVNSIATTKGG H +Y+ADQ+ +K++E  KK+ K         P QVK +MW+FV CLIENPSFDSQTKENMTL QK FGS C L+EKFI     CGIV+ +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG K+S  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  P+SLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+K    NQ  SFYSIPE  EW+    +   W++KYYKGLGTSTSKEAKEYFSDM RH I FRYSG  D ++I LAFS+ K +ERK+WLT++M + ++RRE  + E YLYGK T  +T+ +F+N+EL+LFSN+DNERSIPCL+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ L              P GQFGTRL GGKDSASPRYI T LS L++L+F   D+ +LKY  DDN  +EPEWY PIIP+VL+NG DGIGTGW+ K+PNF+ +++I+N+ RM+NG  P+ M P Y+ F GTI E+  N Y+++GE++ +D TT+EI+ELPV+ WT SYKE+V+E+  +G+DK PA ITDY+EY+TD TVRF+V+M   +  EAEAAG HK FKLQ+PLT ++M+LFD  G ++KY    +IL+ FF++RL+ Y+ RK +L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVK W K    K     A +E++++  + SG PD+ YL  M +  LT EKK+ L K+RD KL EL  ++ K+P  +W  DL    +E+  V   +     ++  T VK  G R  K +K+  ET P+   RR+ P
Sbjct:   29 VERIYQKKTQLEHILLRPDTYIGSVEPLSQQMWVFDEDVG-LNCRDITFVPGLYKIFDEILVNAADNKQRDNSMNCIKINIDSENNTISVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTKFTVETACAESKYSFKQTWFDNMSRAGEAKIKPFSGDDYTCITFRPDLTKFKMQSLDRDTVALMTRRAYDIAGASKGVRVLLNGTKLSVNGFRSYVDLYLKDKVDETGTPLTVVHEVVNSRWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKRNKGGVAVK---PFQVKNHMWLFVNCLIENPSFDSQTKENMTLQQKSFGSTCLLSEKFIKQANTCGIVDSIMNWVKFKAQNQLNKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTIVGL--------------PLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDNVKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEELTSNHYLISGEVSIIDSTTIEISELPVKTWTQSYKENVLEVMLNGSDKVPALITDYREYHTDSTVRFVVKMTEERLIEAEAAGLHKVFKLQSPLTCTSMVLFDHVGSLKKYEFVQDILKDFFELRLKYYVLRKAWLVGMLGAESAKLSNQARFILEKIEGTLVIENKPKKELIRMLQEMGYDSDPVKVW-KQAQEKEVEIDAGEEDEQKEEQTSG-PDYNYLLSMPMWYLTKEKKDELCKQRDAKLTELNMLEKKTPSDLWQADLAAFTEELERVEQAEKESQAKV--TQVKGKGGR-TKVVKMKDETLPTPQGRRVIP 1200          
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 516/880 (58.64%), Postives = 662/880 (75.23%), Query Frame = 2
Query: 1103 VKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYK---GLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWM----------KFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKR--GGKAIKIAAETAPSKFSRRIEP 3697
            VK +MWIFV CL+ENP+FDSQTKENMTL  K FGS C+L+EKFI     CGIVE +  W  FK Q+ L++ CS  K +KL+ +PKLDDAN AG KNS +CTLILTEGDSAK+LAVSGL V+GRD+YG+FPLRGK+LNVREA  KQ+ ENAEI N+IKI+GLQY +KY+ PESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q L FYS+PE  EW+  T +   W++KYYK   GLGTSTSKEAKEYF+DM+RH I+FRYSG ED  +I LAFS+ K ++RKEWLTNWM D ++RRE G+ E +LYGK T Y+T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI++LAQ+FVGSNNIN+L P GQFGTRL GGKD+ASPRYI T +S + +L+F   D+ +LK+L DDNQ +EPEWY PIIP+VL+NG DGIGTGW+S+IPNFNP+++I+N++R+++G  P+ M PWY+NF G+I E+  N+++ +GEI+ LD  T+EI+ELPVR WT +YKESV+E    G DKT   ITDYKEY+TD TVRF+++++  K  EAEAAG HK FKLQ PLT ++M+LFD  G ++KY +  +IL  F++VRL+ Y  RK +L GIL A+++KL NQARFILEKI G V+ EN     LI  L A  YDSDP++AW           + N+ + + +  E      +   SG PD+ Y+  M +  LT E+K+ LL++RD K++EL  +K KSP  +W DDL +  +E++ V  ++  +  +  +    K G++  G K++ + AE  PS   RRI P
Sbjct:    1 VKNHMWIFVNCLVENPTFDSQTKENMTLQHKKFGSTCSLSEKFIKTAMGCGIVESILNWVKFKAQSQLNQNCSAKKISKLRGIPKLDDANDAGGKNSQKCTLILTEGDSAKTLAVSGLGVVGRDHYGIFPLRGKMLNVREASYKQIMENAEINNLIKIVGLQYKKKYDDPESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLQHRFLEEFITPIVKVSKNKQELPFYSMPEFDEWKNETSNYKTWKIKYYKDMPGLGTSTSKEAKEYFADMKRHRIEFRYSGPEDDNAITLAFSRKKIEDRKEWLTNWMVDRRQRREQGLPESFLYGKQTAYLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQSLMMTIVSLAQNFVGSNNINVLQPIGQFGTRLNGGKDAASPRYIFTMISTVARLLFPPVDDNLLKFLWDDNQRVEPEWYCPIIPLVLVNGADGIGTGWASRIPNFNPREIINNIRRLLDGEEPLPMLPWYKNFKGSIDELGPNQFMFSGEISILDSETIEISELPVRTWTQTYKESVLEPMLSGTDKTTPLITDYKEYHTDTTVRFIIKISREKLLEAEAAGLHKVFKLQAPLTCNSMVLFDHLGCLKKYESVADILREFYEVRLKYYSLRKEWLNGILGAESAKLSNQARFILEKIEGTVVIENKPKKELIRMLEARGYDSDPIRAWKEAQVKSNFEEEANSQEDSDDGEESGSATSSTPSSG-PDYNYILNMALWCLTKERKDELLRQRDLKIQELEDLKCKSPCDLWKDDLAVFLEELDRVEAKERKD--DTADMARGKGGQKKAGSKSLAMKAEVVPSPHGRRIVP 877          
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007762.1 (pep scaffold:Pmarinus_7.0:GL492656:1017:4077:-1 gene:ENSPMAG00000007010.1 transcript:ENSPMAT00000007762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 374.015 bits (959), Expect = 5.564e-118
Identity = 182/326 (55.83%), Postives = 242/326 (74.23%), Query Frame = 2
Query:   53 FKMQSSLL---DESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLAD 1021
            F +Q +LL   D++ ++R+   +E++YQKKTQLEHILLRPD+Y+GS++   + MWVFD E   M  + +TY P L+KIFDEILVNA+DNK RD  MT I++ ID + N + +WNNG+GIPV  HK  +VY+P +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS++F +ETS  E  K FKQ W NNM+   D  I  ++ EDFTC+TF PDL +F+MT LD+DI+A+ +RRAYDIA   +G+ VFLNG+++ +  F+ YVD Y K  +D +  PL VV+E    RWEV +T S  + F QVSFVNSIATTKGG HV+Y+ D
Sbjct:    8 FYLQKNLLNVKDDAKSKRL--SVERIYQKKTQLEHILLRPDTYIGSVEPVTQNMWVFD-EGIGMNCRDVTYVPGLFKIFDEILVNAADNKQRDPNMTCIKVTIDPENNKISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTQFTVETSCSESKKMFKQKWMNNMSKECDSVIKPSSGEDFTCITFQPDLTKFNMTILDKDIMAIMTRRAYDIAGICKGVKVFLNGQKLPLTGFRKYVDFYLKDRVDESGMPLHVVHEVVSNRWEVCLTIS-EKGFQQVSFVNSIATTKGGRHVDYVVD 329          
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Match: TOP2 (Topoisomerase II; relieves torsional strain in DNA by cleaving and re-sealing phosphodiester backbone of both positively and negatively supercoiled DNA; cleaves complementary strands; localizes to axial cores in meiosis; required for replication slow zone (RSZ) breakage following Mec1p inactivation; human homolog TOP2A implicated in cancers, and can complement yeast null mutant [Source:SGD;Acc:S000005032])

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 526/1065 (49.39%), Postives = 719/1065 (67.51%), Query Frame = 2
Query:  122 YQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAK-EDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHV-----LDANEEPLK------VVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLK-HNFVEQFITPIVKAF---KNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKL 3268
            YQK +QLEHIL RPD+Y+GS++ +++L W++D+E + M+EK +T  P L+KIFDEILVNA+DNK+RD  M  I ++I ++ + + + N+G+GIP+ IH +  +YIP MIFG LLTS+N++DD+K+VTGGRNGYGAKLCNIFS+EF+LET+    G+ + Q W NNM+ C  P+I+   K   +T VTF PDL RF M  LD DI+ +  RR YDI    + I V+LNGK + ++ FK+YV+LY K +     LD  E+         ++YE    RWEVA   S + +F Q+SFVNSIATT GGTHVNY+ DQ+  KI E  KKK K   ++      Q+K NM+IF+ CLIENP+F SQTKE +T   KDFGS C +  ++I+ + K  +  ++       N+    KK   T+++++ + PKL+DAN AGTK   +CTL+LTEGDSA SLAV+GLAV+GRDYYG +PLRGK+LNVREA   Q+ +NAEI  I KI+GLQ+ +KYE     K+LRYG LMIMTDQD DGSHIKGL+INF+ S +P LL    F+ +FITPI+K          ++FY++P+  +W+        W+ KYYKGLGTS ++E +EYFS+++RHL  F      D   I LAFSK KAD+RKEWL        R+ E G     +     K I   +FIN+ELILFS  DN RSIP ++DGFKPGQRKVL+ C K+NL  ELKVAQLA  V+E +AYHHGE SL  TII LAQ+FVGSNNI LL+PNG FGTR  GGKD+A+ RYI T+L+KLT+ IFH  D+ + KY+ +D +++EPEWY PI+PM+L+NG +GIGTGWS+ IP FNP ++I N++ ++N     +MHPW+R +TGTI E+   +Y + G I Q+    LEITELP R WT++ KE ++ +   GNDK   +I D +E + D  ++F++ ++P + A+    GF++ FKL +P++L NM+ FD  G I+KYN+  EIL  F+ VRLE Y KRK+++   L  +  K   Q +FI   I  ++   N     +I +L
Sbjct:   12 YQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLEKKRQLDNGEDGAAKSDIPTILYERINNRWEVAFAVS-DISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKKKKKSVKSF-----QIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRM-FEIADANEENALKKSDGTRKSRITNYPKLEDANKAGTKEGYKCTLVLTEGDSALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYE---DTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDIQGFLLEFITPIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKGLGTSLAQEVREYFSNLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWL--------RQYEPGT----VLDPTLKEIPISDFINKELILFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRATGGKDAAAARYIYTELNKLTRKIFHPADDPLYKYIQEDEKTVEPEWYLPILPMILVNGAEGIGTGWSTYIPPFNPLEIIKNIRHLMNDEELEQMHPWFRGWTGTIEEIEPLRYRMYGRIEQIGDNVLEITELPARTWTSTIKEYLL-LGLSGNDKIKPWIKDMEEQHDD-NIKFIITLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNSVNEILSEFYYVRLEYYQKRKDHMSERLQWEVEKYSFQVKFIKMIIEKELTVTNKPRNAIIQEL 1052          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44813 (DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:A7RUU5])

HSP 1 Score: 549.28 bits (1414), Expect = 2.713e-180
Identity = 280/484 (57.85%), Postives = 364/484 (75.21%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISK-AAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLK------VVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQL 1540
            +E++Y KKTQLEHILLRPD+Y+GS++   + M+V+DD    +V ++ITY P L+KIFDEILVNA+DNK RD  M+TI+I+I+ + N + +WN+GRGIP+ +HKEHQVY+PTMIFGQLLTS+N+NDD+K+VTGGRNGYGAKLCNIFS +F +ET+  E  K FKQ W+NNM    +P I +  + +++TC+TF PDL++F M  LD D VAL +RRAYDIAA  +G++V LNGK++ VKTFKDYV L  K      EE  +      VV+E    RWEV VT S ++ F Q SFVNSIATTKGGTHVNY+ D     + +      K +K  + +KP Q+K ++W+F+ CLIENP+FDSQTKENMTL  KDFGS+C L++KFI  V   G++E +  W  FK +A L+KKCS +K +K++ +PKLDDAN AG KNS  CTLILTEGDSAK+LA+SGL+++GRD YGVFPLRGKLLNVREA  KQ+
Sbjct:   37 VERIYTKKTQLEHILLRPDTYIGSVEPNKQNMFVYDDILEAIVNREITYVPGLFKIFDEILVNAADNKQRDPAMSTIKIEINPEKNFISVWNDGRGIPIEMHKEHQVYVPTMIFGQLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSKKFSVETACLENKKRFKQVWTNNMGKAAEPVIKEFTSNKEYTCITFQPDLEKFKMETLDRDTVALLTRRAYDIAASVRGVSVILNGKKLKVKTFKDYVQLCLKGATKDKEEDDEEEKKPTVVHEVVNNRWEVCVTVS-DKGFQQASFVNSIATTKGGTHVNYVTD---QIVDKLMTVIKKKNKGGLAIKPFQIKSHLWVFINCLIENPAFDSQTKENMTLRAKDFGSKCELSDKFIKAVQNSGVMENVMNWMRFKEKAQLNKKCSGSKHSKIRGIPKLDDANDAGGKNSRHCTLILTEGDSAKTLAISGLSIVGRDRYGVFPLRGKLLNVREASHKQV 516          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU3])

HSP 1 Score: 340.117 bits (871), Expect = 6.880e-105
Identity = 180/370 (48.65%), Postives = 244/370 (65.95%), Query Frame = 2
Query: 2465 LSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKL---TXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVV 3565
            LS ++K++F   DE  LK+L +DNQ IEPEWY PIIP +L+NG +GIGTG+S+K+PN++P+ + +N+++M+NG  P +M PWY+NF GTI +V + KY V G I  +D TTLEITELP+  WT SYKESV+E   HG DK P  ITDYKEY+T+  VRF++ M   K  EAE  G HK FKL+  +  SNM+LFD  G ++KY+   EIL+ FF +R+E YI RK Y+ G+L+A++ KL +QARFILEKI G ++ EN     LI  LV   Y SDPVKAW       L     +             +G PDF YL  M + +L+ EKK+ LLK+RD+K  EL  ++ KSP+ +W +DL+I   E+  V
Sbjct:    2 LSTVSKMLFPPSDEPNLKFLNEDNQRIEPEWYCPIIPTILVNGAEGIGTGYSTKVPNYDPRAIAENIRKMMNGEEPEEMLPWYKNFIGTITKVDDTKYSVTGNIEVIDDTTLEITELPIGTWTQSYKESVLEPMLHGTDKVPPCITDYKEYHTETRVRFVITMAENKMREAEQVGLHKKFKLEATINTSNMVLFDAMGCLKKYDTTREILKEFFTLRMERYIMRKAYMEGMLTAESGKLNSQARFILEKIEGTIVIENKPKRDLITMLVQRGYPSDPVKAWKDSQDTTLGVDDSDDDTMSTVSSTASGAGGPDFNYLLNMSMWSLSQEKKDELLKQRDQKAAELEDLRKKSPKDLWNEDLDIFLAELEAV 371          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO29547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3B9])

HSP 1 Score: 233.032 bits (593), Expect = 1.989e-70
Identity = 109/170 (64.12%), Postives = 134/170 (78.82%), Query Frame = 2
Query: 1820 LVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASL 2329
            + EW+  T +   W++KYYKGLGTST KEAKEYFSDMERH I F+Y G  D ++IV+AFSK K  ERK+WLT  +E+ K RRE G+ E+YLY K TK +++ +F+N+ELILFSNTDNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQLAGS+AELSAYHHGE   
Sbjct:    1 MEEWKAGTANHKSWKVKYYKGLGTSTPKEAKEYFSDMERHKINFKYEGPHDDEAIVMAFSKKKIQERKDWLTRGLEERKWRREQGLSELYLYEKDTKRVSYCDFVNKELILFSNTDNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLAGSIAELSAYHHGEVGF 170          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU4])

HSP 1 Score: 161.384 bits (407), Expect = 3.720e-46
Identity = 76/113 (67.26%), Postives = 88/113 (77.88%), Query Frame = 2
Query: 1544 ENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKG 1882
            +NAEI NIIKI GLQY++KY+  + LK+LRYG LMIMTDQDQDGSHIKGL+INFIHS WP LLK  FVEQFITPIVK  K  +  SFYSIPE  EW+    +   W++KYYKG
Sbjct:    2 DNAEINNIIKITGLQYNKKYKSEDDLKSLRYGHLMIMTDQDQDGSHIKGLVINFIHSNWPGLLKLGFVEQFITPIVKVSKGKEEHSFYSIPEYEEWKAGNANHKSWKVKYYKG 114          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO25698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVR1])

HSP 1 Score: 80.4925 bits (197), Expect = 2.636e-16
Identity = 56/181 (30.94%), Postives = 86/181 (47.51%), Query Frame = 2
Query: 1388 NSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPES--LKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPD------SNKWRLKYYKGLGTSTSKE 1906
            +  QC + L EGDSA   A  G     R++  + PLRGK+LNV +A   ++ EN EI N+   +G+    + E P +  L  +RY K++IM D D DGSHI  L++ F       +++  +V    TP +   K  Q   +        W  N  D           ++ YKGLG   +++
Sbjct:   59 DPAQCEIFLVEGDSAGGTAKQGR---DRNFQAILPLRGKILNVEKAMQHKVFENEEIKNMFTALGVSIGTE-EDPRALNLSKVRYHKVVIMCDADVDGSHIATLILTFFFRYMREMIEQGYV-YIATPPLYLVKKGQKREY-------AWDDNQRDLIAQKMGGGVTIQRYKGLGEMNAEQ 227          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 1385.93 bits (3586), Expect = 0.000e+0
Identity = 711/1200 (59.25%), Postives = 889/1200 (74.08%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFN--ANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKT LEHILLRPD+YVGS++   + MWVFD++   M +++ITY P LYKIFDEILVNA+DNK RD  M+ I+I ID + N + IWNNG+GIPV  HK+ ++Y+P +IFG LLTS+N++D++K+VTGGRNGYGAKLCNIFS++F +ET+ KEY  SFKQTW NNM    +P+I     +DFTCVTF PDL +F M +LD D VAL +RRAYD+A   +G+ V LNGK++ V  F+ YVDLY K  LD    PLKVV E    RWEV +T S  + F Q+SFVNSIATTKGG H++Y+ DQ+ AKI+E  KKK K         P QVK ++W+FV  LIENP+FDSQTKENMTL  K FGS+C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESL++LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+EQFITPIVKA KN Q LSFYS+PE  EW++ T +   W +KYYKGLGTSTSKEAKEYF+DMERH I FRY G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  TK++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF CLKRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNIN+L P GQFGTR+ GGKD+ASPRYI T LS LTKL+F   D  +LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELPVR WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEA G HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K    A +         +       S  P+F Y+  M +  LT EK E LLK+RD K  EL  ++ KS E +W +DL +  +E++ V  Q+  E   G  +  V  K GK   K + +  ET PS F RR++P
Sbjct:   40 VERVYQKKTPLEHILLRPDTYVGSVEPVSQPMWVFDEDVG-MNQREITYVPGLYKIFDEILVNAADNKQRDKNMSAIKITIDPESNTITIWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYRHSFKQTWQNNMTKTSEPKIRFFDGDDFTCVTFQPDLAKFKMEKLDRDTVALMTRRAYDVAGSCRGVKVTLNGKKLPVNGFRSYVDLYVKEKLDETGVPLKVVNEMVNDRWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVAKIIEVVKKKNKAGVTVK---PFQVKNHIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCVLSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQTKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEKAQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDNVEAQEREEQSAGRAIKLVKGKVGKPKAKKMNL-EETMPSPFGRRVDP 1233          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2a (DNA topoisomerase II alpha [Source:NCBI gene;Acc:101158729])

HSP 1 Score: 1357.04 bits (3511), Expect = 0.000e+0
Identity = 689/1198 (57.51%), Postives = 890/1198 (74.29%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXX--XSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            +E++YQKKTQLEHILLRPDSY+GS++   + MWV+D +   +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+++ID + N + +WNNG+GIPV  HK  +VY+P +IFGQLLTS+N++D++K+VTGGRNGYGAKLCNIFS++F +ET+ KE  K+FKQTW +NM    D  I     E+FTC+TF PDL +F M+ LD+D VAL +RRAYD+A  ++G+ VF NGK++ +  F+ YVD+Y K  +D    PL V++E+  +RWEV +T S  + F QVSFVNSIATTKGG H++Y+ADQ+  +++E  KKK K         P QVK +MW+FV CL+ENP+FDSQTKENMTL QK FGS C+L++KF      CGIVE +  W  FK Q  L+KKCS  K TK+K +PKLDDAN AG KNS+ CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI N+IKI+GLQY + Y  PESLK+LRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+KA      LSFYSIPE   W+    +   W++KYYKGLGTSTS+EAKEYFSDMERH I F+YSG ED ++I LAFSK K +ERKEWLTN+M + ++RRE  + E YLYG+ TK +++ +FIN+EL+LFSN+DNERSIPCL+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LKY  DDNQ +EPEWY PIIP VL+NG +GIGTGW+SKIPN++ ++++ N+ RM++G  P+ M P Y+ F GTI +V  N+Y+ +GE+  +D TT+EI+ELPV+ WT +YKE+V+E   +G DK PA ITDYKEY+TD TVRF+V+M   K  EAEAAG HK FKLQ+PLT ++M+LFD  G ++KY +  +IL+ FF +R++ Y+ RK +L+G+L A++SKL NQARFILEKI G ++ EN     LI  L    YDSDPV+AW +         +AE+E++E A     S   D+ YL  M +  LT EKKE L K+RD K+ EL  +K KSP  +W +DL    +E+  +  ++  +     +   K+P K G K +K+  ET P+   RR+ P
Sbjct:   26 VERIYQKKTQLEHILLRPDSYIGSVEPVTQQMWVYDVDVG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDKSMSCIKVNIDVENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDEQKKVTGGRNGYGAKLCNIFSTKFTVETACKESRKTFKQTWYDNMGRAGDTNIKAFDGEEFTCITFKPDLSKFKMSTLDKDTVALMTRRAYDVAGSSKGVKVFFNGKRLPITGFRSYVDMYVKDKVDELGGPLTVIHEAVNERWEVCLTMS-EKGFQQVSFVNSIATTKGGRHIDYVADQIVGRLIEVVKKKNKAGVAVK---PFQVKNHMWLFVNCLVENPTFDSQTKENMTLQQKSFGSTCSLSDKFFKQATSCGIVESIMNWVKFKAQTQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNVIKILGLQYKKNYSDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASNKKNQLSFYSIPEFNAWKETQSNHKSWKIKYYKGLGTSTSQEAKEYFSDMERHRIPFKYSGPEDDEAISLAFSKKKVEERKEWLTNFMVNRRQRREHNLPEDYLYGQSTKSLSYNDFINKELVLFSNSDNERSIPCLVDGFKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSPLARLVFPPVDDNLLKYNYDDNQRVEPEWYIPIIPTVLVNGAEGIGTGWASKIPNYDIREIVSNIHRMLDGEEPLPMLPNYKGFRGTIDQVMSNQYMNSGEVAIIDSTTIEISELPVKTWTQAYKENVLEPMLNGTDKVPALITDYKEYHTDATVRFVVKMTEEKLMEAEAAGLHKVFKLQSPLTCNSMVLFDYAGSLKKYESVQDILKDFFDLRMKYYVLRKEWLVGMLGAESSKLSNQARFILEKIQGTLVIENKPKKELIRMLQEMGYDSDPVRAWKEAQKKDEDDMEAEEEQEEGAEREDQSSGADYNYLLSMPMWFLTKEKKEDLCKQRDAKMTELNTLKGKSPADLWKEDLAAFSEELERLEQKEKDD----ASAPAKRPAK-GKKPMKVKQETLPTPQGRRVIP 1213          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 1167.14 bits (3018), Expect = 0.000e+0
Identity = 610/1037 (58.82%), Postives = 755/1037 (72.81%), Query Frame = 2
Query:  599 QTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFN--ANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEP 3697
            QTW NNM    +P+I     +DFTCVTF PDL +F M +LD D VAL +RRAYD+A   +G+ V LNGK++ V  F+ YVDLY K  LD    PLKVV E    RWEV +T S  + F Q+SFVNSIATTKGG H++Y+ DQ+ AKI+E  KKK K         P QVK ++W+FV  LIENP+FDSQTKENMTL  K FGS+C L+EKFI     CGIVE +  W  FK Q  L+KKCS  K +K+K +PKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESL++LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+EQFITPIVKA KN Q LSFYS+PE  EW++ T +   W +KYYKGLGTSTSKEAKEYF+DMERH I FRY G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  TK++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF CLKRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNIN+L P GQFGTR+ GGKD+ASPRYI T LS LTKL+F   D  +LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELPVR WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEA G HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K    A +         +       S  P+F Y+  M +  LT EK E LLK+RD K  EL  ++ KS E +W +DL +  +E++ V  Q+  E   G  +  V  K GK   K + +  ET PS F RR++P
Sbjct:  123 QTWQNNMTKTSEPKIRFFDGDDFTCVTFQPDLAKFKMEKLDRDTVALMTRRAYDVAGSCRGVKVTLNGKKLPVNGFRSYVDLYVKEKLDETGVPLKVVNEMVNDRWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVAKIIEVVKKKNKAGVTVK---PFQVKNHIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCVLSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQTKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEKAQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDNVEAQEREEQSAGRAIKLVKGKVGKPKAKKMNL-EETMPSPFGRRVDP 1154          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 340.887 bits (873), Expect = 7.716e-105
Identity = 183/370 (49.46%), Postives = 252/370 (68.11%), Query Frame = 2
Query: 2468 SKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFN--ANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYN 3571
            S LTKL+F   D  +LK+L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELPVR WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEA G HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K    A +         +       S  P+F Y+  M +  LT EK E LLK+RD K  EL  ++ KS E +W +DL +  +E++V ++
Sbjct:    5 SPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEKAQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDVSFS 374          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2a (DNA topoisomerase II alpha [Source:NCBI gene;Acc:101158729])

HSP 1 Score: 249.98 bits (637), Expect = 4.519e-75
Identity = 114/196 (58.16%), Postives = 153/196 (78.06%), Query Frame = 2
Query:  110 IEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLK 697
            +E++YQKKTQLEHILLRPDSY+GS++   + MWV+D +   +  + +T+ P LYKIFDEILVNA+DNK RD  M+ I+++ID + N + +WNNG+GIPV  HK  +VY+P +IFGQLLTS+N++D++K+VTGGRNGYGAKLCNIFS++F +ET+ KE  K+FKQTW +NM    D  I     E+FTC+TF PDLK
Sbjct:   20 VERIYQKKTQLEHILLRPDSYIGSVEPVTQQMWVYDVDVG-LNCRDVTFVPGLYKIFDEILVNAADNKQRDKSMSCIKVNIDVENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDEQKKVTGGRNGYGAKLCNIFSTKFTVETACKESRKTFKQTWYDNMGRAGDTNIKAFDGEEFTCITFKPDLK 214          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2356.64 bits (6106), Expect = 0.000e+0
Identity = 1386/1557 (89.02%), Postives = 1445/1557 (92.81%), Query Frame = 2
Query:   77 DESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEPXXXXXXXXXXXXXXXXXXXXXXXXXQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVXXXXXXXXXXXXXXXXXXXXXXXXXXFESXXXXXXXXXXXXXXXXXXXREFDAIPRETVLKRNAAKNVKYXXXXXXXXXXXXXXXXXXXXXXXXXXXYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKIEDISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKVDYXXXXXXXXXXXFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPQKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 4747
            D+SL+    E IEK Y KKTQLEHILLRPDSYVGSIK E+K +W+FD EKN MVEK+ITYNP LYKI+DEILVNASDNKIRD KM+ IRIDI+   NM+RIWNNG+GIPV +HK+  V++PTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFS+EF+LETS+KEYGKSFKQTW+ NM    DP IS   KEDFTCVTFYPDLKRF+M+ LD++ +ALFSRRAYDIAACT GI V+LNG+QI VK FKDYV+LYTK+ LD+NEE LKV+YE +G RWEVA+TTS+N+ F QVSFVNSIATTKGGTHVN++ DQ A K+LE AKKKIK DKQAVKLK AQVKMNMW+FV+CLIENPSFDSQTKENMTLN KDFGS C L +KFIS VAKCGIVEK+TMW +FKNQALLDKKCSKTK TKLKD+PKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQL                            +WYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELP+RVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW K +  KL      +EE++E IEDS KPDFGYLTQMQILTLTAEKK+ALLKERDEKL+EL  I+NKSP+QMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGK+GGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKK ETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDT+REFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEK+ DIS    ++K I      P AKKLKTNKPKTTTNAASNKKKEKQKVD KTKKAK PRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIP+KVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE
Sbjct:    4 DDSLSLEENESIEKRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQL----------------------------KWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQK-SVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDTSREFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKMVDIS-KPAKRKKIIKDKDEPPAKKLKTNKPKTTTNAASNKKKEKQKVDCKTKKAKAPRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPKKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 1530          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2342.38 bits (6069), Expect = 0.000e+0
Identity = 1382/1557 (88.76%), Postives = 1446/1557 (92.87%), Query Frame = 2
Query:   77 DESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEPXXXXXXXXXXXXXXXXXXXXXXXXXQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVXXXXXXXXXXXXXXXXXXXXXXXXXXFESXXXXXXXXXXXXXXXXXXXREFDAIPRETVLKRNAAKNVKYXXXXXXXXXXXXXXXXXXXXXXXXXXXYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKIEDISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKVDYXXXXXXXXXXXFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPQKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 4747
            D+SL+    E IEK Y KKTQLEHILLRPDSYVGSIK E+K +W+FD EKN MVEK+ITYNP LYKI+DEILVNASDNKIRD KM+ IRIDI+   NM+RIWNNG+GIPV +HK+  V++PTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFS+EF+LETS+KEYGKSFKQTW+ NM    DP IS   KEDFTCVTFYPDLKRF+M+ LD++ +ALFSRRAYDIAACT GI V+LNG+QI VK FKDYV+LYTK+ LD+NEE LKV+YE +G RWEVA+TTS+N+ F QVSFVNSIATTKGGTHVN++ DQ A K+LE AKKKIK DKQAVKLK AQVKMNMW+FV+CLIENPSFDSQTKENMTLN KDFGS C L +KFIS VAKCGIVEK+TMW +FKNQALLDKKCSKTK TKLKD+PKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK            W       + ++  +G+   +  KIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELP+RVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW K +  KL      +EE++E IEDS KPDFGYLTQMQILTLTAEKK+ALLKERDEKL+EL  I+NKSP+QMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGK+GGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKK ETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDT+REFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEK+ DIS    ++K I      P AKKLKTNKPKTTTNAASNKKKEKQKVD KTKKAK PRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIP+KVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE
Sbjct:    4 DDSLSLEENESIEKRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKIC----------WMT-----INLSNQNGMHQLFRCKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQK-SVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDTSREFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKMVDIS-KPAKRKKIIKDKDEPPAKKLKTNKPKTTTNAASNKKKEKQKVDCKTKKAKAPRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPKKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 1543          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2313.49 bits (5994), Expect = 0.000e+0
Identity = 1374/1557 (88.25%), Postives = 1434/1557 (92.10%), Query Frame = 2
Query:   77 DESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEPXXXXXXXXXXXXXXXXXXXXXXXXXQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVXXXXXXXXXXXXXXXXXXXXXXXXXXFESXXXXXXXXXXXXXXXXXXXREFDAIPRETVLKRNAAKNVKYXXXXXXXXXXXXXXXXXXXXXXXXXXXYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKIEDISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKVDYXXXXXXXXXXXFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPQKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 4747
            D+SL+    E IEK Y KKTQLEHILLRPDSYVGSIK E+K +W+FD EKN MVEK+ITYNP LYKI+DEILVNASDNKIRD KM+ IRIDI+   NM+RIWNNG+GIPV +HK+  V++PTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFS+EF+LETS+KEYGKSFKQTW+ NM    DP IS   KEDFTCVTFYPDLKRF+M+ LD++ +ALFSRRAYDIAACT GI V+LNG+QI VK FKDYV+LYTK+ LD+NEE LKV+YE +G RWEVA+TTS+N+ F QVSFVNSIATTKGGTHVN++ DQ A K+LE AKKKIK DKQAVKLK AQVKMNMW+FV+CLIENPSFDSQTKENMTLN KDFGS C L +KFIS VAKCGIVEK+TMW +FKNQALLDKKCSKTK TKLKD+PKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK                 I  + IN            + N N     DNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELP+RVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW K +  KL      +EE++E IEDS KPDFGYLTQMQILTLTAEKK+ALLKERDEKL+EL  I+NKSP+QMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGK+GGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKK ETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDT+REFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEK+ DIS    ++K I      P AKKLKTNKPKTTTNAASNKKKEKQKVD KTKKAK PRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIP+KVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE
Sbjct:    4 DDSLSLEENESIEKRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK-----------------ICWMTIN------------LSNQN-----DNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQK-SVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQIIVKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDTSREFDAIPRETVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPIISKGNTQPVAINKKVEIPNNDVFSIDSEKMVDIS-KPAKRKKIIKDKDEPPAKKLKTNKPKTTTNAASNKKKEKQKVDCKTKKAKAPRKKFSSDDEADSIFKPDDDSASDAEVGTQRARRKIPKKVYIDSDGDDDEFGGMADDIFSQDKTKPKRMKGGDSSGSE 1524          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037559.1 (SMESG000037559.1)

HSP 1 Score: 2242.62 bits (5810), Expect = 0.000e+0
Identity = 1215/1296 (93.75%), Postives = 1234/1296 (95.22%), Query Frame = 2
Query:   59 MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEPXXXXXXXXXXXXXXXXXXXXXXXXXQNQII---VKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPV 3937
            MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPL+GKLLNVREA  KQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQ+ TP +N+WRLKYYKGLGTST KEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAG                  K+  H    AVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELP+RVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKING +ICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGK+GGKAIKIAAETAPSKFSRRIEPKIEEEYLKK+  ETEKKKK +E KKQ ++I   V          + DN +S + EE  LAQRL+  + +EAFK L+ K  KP 
Sbjct:    1 MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGA-----------------KIALHLVTYAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGIIICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPT 1278          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037559.1 (SMESG000037559.1)

HSP 1 Score: 2226.05 bits (5767), Expect = 0.000e+0
Identity = 1208/1296 (93.21%), Postives = 1227/1296 (94.68%), Query Frame = 2
Query:   59 MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADXXXXXXXXXXXXXXXXXXXXXXXXPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALXXXXXXXXXXXXXXXMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTXXXXXXXXXXXXXXXSGKPDFGYLTQMQIXXXXXXXXXXXXXXXXXXXXXXMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAAETAPSKFSRRIEPXXXXXXXXXXXXXXXXXXXXXXXXXQNQII---VKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPV 3937
            MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPL+GKLLNVREA  KQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQ+ TP +N+WRLKYYKGLGTST KEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASL+                               GKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELP+RVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKING +ICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGK+GGKAIKIAAETAPSKFSRRIEPKIEEEYLKK+  ETEKKKK +E KKQ ++I   V          + DN +S + EE  LAQRL+  + +EAFK L+ K  KP 
Sbjct:    1 MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLI------------------------------WGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGIIICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPT 1265          
The following BLAST results are available for this feature:
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP2B0.000e+059.03DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2B0.000e+059.03DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2A0.000e+059.29DNA topoisomerase II alpha [Source:HGNC Symbol;Acc... [more]
TOP2B0.000e+060.98DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2A3.998e-4858.02DNA topoisomerase II alpha [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top-20.000e+054.34DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss... [more]
R05D3.120.000e+039.77Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
cin-40.000e+054.89DNA topoisomerase-like protein cin-4 [Source:UniP... [more]
R05D3.124.457e-17941.96Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
R05D3.124.457e-17941.96Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Top20.000e+057.37gene:FBgn0284220 transcript:FBtr0332320[more]
Top20.000e+057.37gene:FBgn0284220 transcript:FBtr0081287[more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
top2b0.000e+058.00DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a0.000e+058.91DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a1.289e-12552.87DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2b1.371e-3360.42DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP2A0.000e+059.52DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.52DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.52DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.52DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.52DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Top2a0.000e+059.86topoisomerase (DNA) II alpha [Source:MGI Symbol;Ac... [more]
Top2b0.000e+058.56topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
Top2b9.081e-5355.13topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
Top2b3.707e-738.89topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
back to top
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O42131|TOP2B_CHICK0.000e+059.07DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 ... [more]
sp|P41515|TOP2A_CRIGR0.000e+060.31DNA topoisomerase 2-alpha OS=Cricetulus griseus OX... [more]
sp|Q01320|TOP2A_MOUSE0.000e+059.86DNA topoisomerase 2-alpha OS=Mus musculus OX=10090... [more]
sp|Q64511|TOP2B_MOUSE0.000e+058.56DNA topoisomerase 2-beta OS=Mus musculus OX=10090 ... [more]
sp|Q02880|TOP2B_HUMAN0.000e+059.03DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of DNA topoisomerase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MQU00.000e+060.65DNA topoisomerase 2 OS=Lingula unguis OX=7574 GN=L... [more]
A0A0L8FFS90.000e+060.23DNA topoisomerase 2 (Fragment) OS=Octopus bimaculo... [more]
A0A0X3PUD60.000e+058.80DNA topoisomerase 2 OS=Schistocephalus solidus OX=... [more]
G4VPA90.000e+059.70DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183... [more]
A0A3Q0KH180.000e+059.70DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
top2b0.000e+059.00DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a0.000e+057.02DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a0.000e+057.02DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
top2a0.000e+058.64DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000007762.15.564e-11855.83pep scaffold:Pmarinus_7.0:GL492656:1017:4077:-1 ge... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOP20.000e+049.39Topoisomerase II; relieves torsional strain in DNA... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448132.713e-18057.85DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO448116.880e-10548.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295471.989e-7064.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448123.720e-4667.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256982.636e-1630.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top2b0.000e+059.25DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2a0.000e+057.51DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
top2b0.000e+058.82DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2b7.716e-10549.46DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2a4.519e-7558.16DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037565.10.000e+089.02SMESG000037565.1[more]
SMESG000037565.10.000e+088.76SMESG000037565.1[more]
SMESG000037565.10.000e+088.25SMESG000037565.1[more]
SMESG000037559.10.000e+093.75SMESG000037559.1[more]
SMESG000037559.10.000e+093.21SMESG000037559.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010418 ID=SMED30010418|Name=DNA topoisomerase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4810bp
TTTTGTTTTAATAACGCAATAAAGAACATAATTAATTTCAACTTTTAATT
GTTTTAAAATGCAGTCTTCATTGCTAGACGAATCTTTAAATGAAAGGGTT
CCCGAAGATATAGAAAAATTATATCAGAAAAAAACTCAATTAGAACATAT
TTTACTTCGACCAGATTCTTATGTCGGGTCAATAAAAAAAGAAGATAAAC
TAATGTGGGTTTTTGACGACGAGAAAAATGAGATGGTTGAAAAAAAGATT
ACTTACAATCCAGCTCTTTATAAGATATTCGATGAAATTCTAGTTAATGC
ATCTGATAATAAAATTAGAGATTCTAAAATGACTACTATTAGAATCGATA
TAGATAGTAAAATGAATATGGTCCGTATTTGGAACAATGGTAGAGGTATA
CCTGTTACGATACATAAAGAACATCAAGTTTACATACCGACTATGATTTT
TGGTCAGTTATTGACATCAACTAACTTCAACGACGACAAAAAACAAGTGA
CTGGTGGCCGAAATGGATACGGTGCTAAACTCTGCAATATATTCAGTTCT
GAATTCGTGCTGGAAACATCAAGCAAAGAATACGGTAAAAGTTTTAAGCA
GACTTGGTCGAATAACATGAATGATTGTTTTGATCCCGAAATTTCTAAAG
CCGCCAAAGAAGATTTCACCTGTGTCACTTTCTATCCAGATCTTAAACGA
TTCAGCATGACTCGTTTGGATGAGGATATTGTCGCCCTGTTTAGCAGGAG
AGCTTATGATATAGCAGCGTGTACGCAAGGGATCACTGTCTTTTTAAATG
GCAAGCAGATCAACGTAAAAACCTTTAAAGATTACGTAGATTTATACACG
AAACATGTTCTCGATGCAAACGAAGAGCCGTTGAAAGTAGTTTATGAATC
TTATGGTAAAAGATGGGAAGTTGCCGTAACAACAAGTGTTAATGAGACAT
TTTCCCAAGTTAGTTTCGTCAACAGTATTGCAACAACAAAGGGTGGAACC
CATGTTAACTATTTGGCGGATCAGTTGGCTGCAAAGATTTTAGAAAAAGC
TAAAAAGAAAATTAAAGATGATAAACAAGCTGTCAAATTAAAGCCTGCCC
AAGTCAAAATGAATATGTGGATATTTGTTAGATGTCTAATAGAAAATCCC
AGTTTCGATTCTCAGACAAAGGAAAATATGACTTTAAACCAAAAAGATTT
CGGCTCAGAATGTACTTTAAATGAAAAATTCATTTCATTAGTGGCAAAAT
GCGGCATTGTTGAAAAGTTAACCATGTGGACATTGTTCAAGAATCAAGCT
TTATTGGACAAGAAATGCAGTAAAACTAAACAAACAAAACTGAAGGATAT
GCCAAAATTGGATGATGCCAATTTCGCGGGCACTAAGAACTCGCTGCAGT
GTACTTTGATCTTAACGGAAGGAGATTCAGCCAAATCATTGGCTGTTTCG
GGTTTGGCAGTTATCGGCAGGGATTATTATGGTGTATTTCCACTAAGGGG
AAAATTATTAAATGTCAGAGAAGCAGGTGTAAAGCAATTAACAGAAAATG
CTGAAATCACAAACATCATAAAGATTATTGGCTTGCAATACAGTCAAAAG
TATGAATTACCGGAATCATTGAAGACTTTGCGATATGGAAAACTAATGAT
AATGACAGATCAGGATCAAGACGGATCTCACATAAAGGGCCTGTTGATAA
ATTTCATTCATTCAAAATGGCCCAATTTATTAAAACACAATTTCGTCGAA
CAATTCATCACACCAATAGTAAAAGCATTCAAAAACAACCAAGTATTATC
TTTCTATAGCATTCCTGAGCTTGTCGAATGGCAAAGAAATACTCCAGACT
CTAATAAATGGCGATTGAAGTATTACAAGGGGTTGGGTACATCCACTAGT
AAGGAAGCAAAGGAATATTTCAGTGACATGGAACGGCATTTGATTAAGTT
TCGATACAGTGGCGAAGAGGATGGTAAAAGTATAGTTTTGGCATTTTCAA
AAACTAAAGCTGATGAGCGTAAAGAATGGTTGACAAATTGGATGGAAGAC
TGTAAACGCCGCCGAGAGCTTGGAATGGACGAGGTTTATTTGTACGGAAA
GGGCACAAAATACATCACGTTTGAAAACTTCATTAATCAGGAGTTGATTT
TATTCAGCAATACGGATAATGAGAGAAGCATTCCATGTTTAATGGACGGG
TTCAAGCCAGGTCAAAGAAAAGTGTTATTTGCCTGCTTGAAAAGGAATTT
AGTGAAAGAATTAAAAGTTGCACAATTAGCTGGATCCGTGGCTGAACTAT
CCGCATATCACCACGGTGAAGCATCCTTGATGTCAACTATCATTAATTTG
GCTCAGGATTTCGTCGGCAGCAATAACATCAATCTATTGATGCCAAACGG
CCAATTCGGTACTCGGCTAGCTGGGGGCAAAGATAGCGCTTCACCTCGTT
ACATATGTACTCAATTGAGTAAATTGACGAAATTGATTTTCCACCACGAC
GACGAGGCGGTATTGAAATATTTGCTGGATGACAATCAATCTATCGAACC
AGAATGGTATGCACCAATTATTCCGATGGTATTAATTAACGGGTGTGACG
GTATCGGAACTGGGTGGAGTAGTAAAATTCCTAATTTCAACCCGAAAGAT
GTTATAGATAATTTGAAACGAATGATTAATGGTGGAACTCCCGTGAAAAT
GCATCCATGGTATCGTAATTTCACCGGAACAATCGTTGAGGTGTGTGAAA
ACAAGTATGTGGTTAATGGGGAAATAAATCAACTCGATGGAACCACTTTG
GAAATAACCGAGTTACCCGTTCGAGTTTGGACTAATTCTTACAAAGAGAG
TGTAATGGAAATTTATCGTCATGGAAACGATAAAACTCCAGCATTTATCA
CCGATTACAAAGAGTACAATACGGATAAAACAGTTCGATTCCTCGTGGAA
ATGAATCCAGCCAAATACGCAGAAGCAGAAGCGGCGGGTTTCCACAAATT
TTTCAAATTGCAGACACCTTTGACGTTGAGCAACATGATATTGTTTGATG
AATGCGGAGTCATCAGAAAATATAATAACGGAATAGAAATATTAGAGAGC
TTTTTTAAAGTGCGCTTGGAAATTTATATCAAACGGAAAAATTATTTATT
GGGCATTTTATCAGCTCAGGCGTCCAAGTTGCAAAACCAAGCGAGATTTA
TTTTAGAGAAAATTAATGGAAAAGTTATTTGTGAAAATGTGAAAATTGCC
GTTTTGATTGATAAATTGGTGGCAGCAAAATATGATTCCGATCCTGTTAA
AGCTTGGATGAAATTCAATGCGAACAAACTGACAATTGAAAAGGCTGAAG
ATGAGGAGGACGAAGAAGCTATTGAGGATTCTGGAAAGCCAGATTTTGGA
TATTTAACCCAGATGCAAATCTTAACTTTAACAGCAGAAAAGAAAGAAGC
CTTATTAAAGGAGAGAGATGAGAAGTTGGAAGAATTAATGAGAATAAAGA
ATAAATCTCCAGAACAAATGTGGCTAGATGACTTAGAAATACTGGAAAAG
GAAATAAATGTGGTTTATAATCAAGATACTTCGGAACCAGGGGAAATAGT
GAATACCGTTGTGAAGAAGCCTGGTAAAAGAGGTGGAAAAGCTATAAAAA
TAGCAGCAGAAACCGCTCCGTCGAAATTCAGTCGCCGTATTGAACCGAAA
ATAGAAGAGGAATATTTGAAAAAGTTAACAACTGAAACTGAGAAGAAAAA
GAAAAAAATTGAAACTAAAAAACAAAACCAAATAATTGTCAAAGAAAACG
GTGATATTGTGACAACAAACTCCCGTGATAATATTGATTCGGTAGATTAT
GAAGAAGCGCCTTTAGCACAGCGGCTCAGTAATGCCAATAGCAATGAAGC
CTTTAAAGATCTTGTTAGAAAAATCAAAAAGCCCGTTACGACAAAAGAAT
TAAATAAATTAAAATCCAACAAAAAAAAGAATTCGACAAGTCCAAATAAA
AAGAGGAAAAGAAATTTTGAATCAGACACTGATGACTATGATGATATAAA
TGATGATCTTGAGGAAGATATCGATACGACTCGAGAGTTTGATGCTATTC
CCAGGGAAACGGTTTTGAAACGGAATGCTGCTAAAAATGTGAAGTATAAT
TTAAACGACGATGATGACGACGAGGAAGCGAATGAAATCGATAAGAGTTC
CAAATCATCCCTATCTATCGATGATTTATATGATCCTTCTCTTGAATCAC
CGATTATCTCTAAAGGCAATACTCAACCGGTCGCAATTAATAAAAAAGTT
GAAATTCCAAATAACGATGTATTTTCGATTGATTCCGAGAAAATAGAAGA
CATTTCTAAACCAGCAAAGCGGAAGAAAATCATTAAAGATAAAGATGGGC
CACCTGCTGCTAAGAAACTGAAGACGAATAAACCAAAAACCACAACAAAT
GCCGCTAGTAATAAAAAGAAAGAGAAACAGAAAGTCGATTATAAAACAAA
GAAAGCTAAACCTCCGAGGAAAAAATTCAGTTCTGATGATGAAGCTGATA
GCATTTTTAAACCAGATGATGATTCTGCAAGTGATGCGGAAGTCGGGACA
CAAAGGGCTCGTCGGAAAATACCCCAAAAAGTATACATTGATTCGGACGG
GGACGATGATGAATTTGGCGGAATGGCGGATGATATTTTTTCACAAGACA
AGACAAAGCCAAAGAGAATGAAAGGTGGTGACAGCAGCGGTTCAGAATGA
TGCTTTTACTGCTGCTCATGATGATGTGTCAATATATTGCCATCAAATTG
TTTTTTGTAA
back to top

protein sequence of SMED30010418-orf-1

>SMED30010418-orf-1 ID=SMED30010418-orf-1|Name=SMED30010418-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1564bp
MQSSLLDESLNERVPEDIEKLYQKKTQLEHILLRPDSYVGSIKKEDKLMW
VFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDS
KMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGG
RNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAK
EDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQ
INVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQ
VSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVK
MNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGI
VEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTL
ILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEI
TNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFI
HSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNK
WRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTK
ADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFS
NTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAY
HHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYIC
TQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIG
TGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKY
VVNGEINQLDGTTLEITELPVRVWTNSYKESVMEIYRHGNDKTPAFITDY
KEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECG
VIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILE
KINGKVICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEE
DEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKS
PEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKRGGKAIKIAA
ETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKIETKKQNQIIVKENGDI
VTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNK
LKSNKKKNSTSPNKKRKRNFESDTDDYDDINDDLEEDIDTTREFDAIPRE
TVLKRNAAKNVKYNLNDDDDDEEANEIDKSSKSSLSIDDLYDPSLESPII
SKGNTQPVAINKKVEIPNNDVFSIDSEKIEDISKPAKRKKIIKDKDGPPA
AKKLKTNKPKTTTNAASNKKKEKQKVDYKTKKAKPPRKKFSSDDEADSIF
KPDDDSASDAEVGTQRARRKIPQKVYIDSDGDDDEFGGMADDIFSQDKTK
PKRMKGGDSSGSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001241Topo_IIA
IPR001154TopoII_euk
IPR002205Topo_IIA_A/C
IPR003594HATPase_C
IPR013758Topo_IIA_A/C_ab
IPR024946Arg_repress_C-like
IPR013759Topo_IIA_B_C
IPR013506Topo_IIA_bsu_dom2
IPR031660TOPRIM_C
IPR013757Topo_IIA_A_a_sf
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR006171TOPRIM_domain
IPR018522TopoIIA_CS
IPR013760Topo_IIA-like_dom_sf
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0003918DNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0003916DNA topoisomerase activity
GO:0016853isomerase activity
Vocabulary: biological process
TermDefinition
GO:0006265DNA topological change
GO:0006259DNA metabolic process