5'-3' exoribonuclease 1

Overview
Name5'-3' exoribonuclease 1
Smed IDSMED30010414
Length (bp)4693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5'-3' exoribonuclease 1 (SMED30010414) t-SNE clustered cells

Violin plots show distribution of expression levels for 5'-3' exoribonuclease 1 (SMED30010414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5'-3' exoribonuclease 1 (SMED30010414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5'-3' exoribonuclease 1 (SMED30010414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail stripeSMED30010414SMESG000080199.1 isotig23342be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30010414SMESG000080199.1 isotig23342be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30010414SMESG000080199.1 dd_Smed_v4_3662_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 384.03 bits (985), Expect = 3.576e-135
Identity = 179/267 (67.04%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+ L+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKE 267          

HSP 2 Score: 120.939 bits (302), Expect = 3.576e-135
Identity = 53/103 (51.46%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TY+ + PEL GYIN  G L+L  F KY+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 421.394 bits (1082), Expect = 1.830e-121
Identity = 285/823 (34.63%), Postives = 440/823 (53.46%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETFRIPMSSIVPGLCPK---VLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRI--TPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE---KSKLIVKQS--------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQ------ASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE+ T   N  ++  D + +  +FR YKR YY++K+G+++ +D+ L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI N+S  LK   I F++G+PF PFEQL+AVLPA S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLLEAME+    +   + +RN H   +   +  ++  +     PE F       +   C +   + LD                     C GFPT +H+ H F L+K+GV++F+ S+ G +++L I    ++   ++E++A   + +  FVNWP   E +V+AV +   ++ L E     KL   ++        L + +    A+     S +  RR  I I+ T+ ++   + + G+ Y+I+        V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP  + VF L   YYG  G V+   +  +   I+++   FS P  PN+    I NQ+ ++ +       +    ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV  E     W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D QI++ + +  IE+ ++  +   +N+K  RV +    LY P    HGV PD+ A+F L DRVV + + ++VP+GL+G +IGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIHNIST-LK---IHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKF-----PAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFC-GFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQLLT-GRKYQINQ----NGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVI---FSIPCEPNLDA-LIQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVGSE-----WMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 384.03 bits (985), Expect = 3.606e-135
Identity = 179/267 (67.04%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+ L+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKE 267          

HSP 2 Score: 120.939 bits (302), Expect = 3.606e-135
Identity = 53/103 (51.46%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TY+ + PEL GYIN  G L+L  F KY+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 422.165 bits (1084), Expect = 1.011e-121
Identity = 285/823 (34.63%), Postives = 440/823 (53.46%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETFRIPMSSIVPGLCPK---VLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRI--TPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE---KSKLIVKQS--------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQ------ASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE+ T   N  ++  D + +  +FR YKR YY++K+G+++ +D+ L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI N+S  LK   I F++G+PF PFEQL+AVLPA S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLLEAME+    +   + +RN H   +   +  ++  +     PE F       +   C +   + LD                     C GFPT +H+ H F L+K+GV++F+ S+ G +++L I    ++   ++E++A   + +  FVNWP   E +V+AV +   ++ L E     KL   ++        L + +    A+     S +  RR  I I+ T+ ++   + + G+ Y+I+        V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP  + VF L   YYG  G V+   +  +   I+++   FS P  PN+    I NQ+ ++ +       +    ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV  E     W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D QI++ + +  IE+ ++  +   +N+K  RV +    LY P    HGV PD+ A+F L DRVV + + ++VP+GL+G +IGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIHNIST-LK---IHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKF-----PAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFC-GFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQLLT-GRKYQINQ----NGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVI---FSIPCEPNLDA-LIQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVGSE-----WMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 382.874 bits (982), Expect = 6.886e-134
Identity = 179/267 (67.04%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+ L+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKE 267          

HSP 2 Score: 117.857 bits (294), Expect = 6.886e-134
Identity = 53/103 (51.46%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TY+ + PEL GYIN  G L+L  F KY+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Match: XRN2 (5'-3' exoribonuclease 2 [Source:HGNC Symbol;Acc:HGNC:12836])

HSP 1 Score: 243.432 bits (620), Expect = 3.832e-75
Identity = 134/319 (42.01%), Postives = 190/319 (59.56%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV--------DNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSK-----------------------KKTRRAYIAE-----ETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP + V+         +  +IP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ + ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + VILS    PGEGEHKI ++IR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE   +K                       KK +   +A+     E +F  L L++LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGEFIFLRLNVLREYLEREL 317          

HSP 2 Score: 61.2326 bits (147), Expect = 3.832e-75
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHL 1033
            +L   + +ER IDDW+ M F +GNDF+PHLP+L I  +A+  L   Y NV  +  GY+   G ++L
Sbjct:  321 SLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNL 386          

HSP 3 Score: 148.673 bits (374), Expect = 2.164e-35
Identity = 74/174 (42.53%), Postives = 103/174 (59.20%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIG-RPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  ++  DE   ++    YV  L W+  YY+ G  SW W+YP HYAPF SD   ++ D+     DF+ G +PF P EQLM V PA S   LP  +  LM + +S IIDFYP+ F  DLNGKK  W+ V L+PF++E+RL  A+E     ++P + RRN  G  + F
Sbjct:  516 WKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIA-DMPS---DFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLF 685          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 273.863 bits (699), Expect = 1.817e-74
Identity = 211/676 (31.21%), Postives = 342/676 (50.59%), Query Frame = 2
Query: 1889 ENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETFRIPMSSIVPGLCPK---VLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRI--TPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQS--------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQ------ASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+E RLLEAME+    +   + +RN H   +   +  ++  +     PE F       +   C +   + LD                     C GFPT +H+ H F L+K+GV++F+ S+ G +++L I    ++   ++E++A   + +  FVNWP   E +V+AV +   ++ L E     KL   ++        L + +    A+     S +  RR  I I+ T+ ++   + + G+ Y+I+        V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP  + VF L   YYG  G V+   +  +   I+++   FS P  PN+    I NQ+ ++ +       +    ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV  E     W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D QI++ + +  IE+ ++  +   +N+K  RV +    LY P    HGV PD+ A+F L DRVV + + ++VP+GL+G +IGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:    4 EDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDE-RLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKF-----PAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFC-GFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQLLT-GRKYQINQ----NGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVI---FSIPCEPNLDA-LIQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVGSE-----WMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 643          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Celegans
Match: xrn-1 (5'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;Acc:Q9BHK7])

HSP 1 Score: 431.409 bits (1108), Expect = 0.000e+0
Identity = 324/1031 (31.43%), Postives = 511/1031 (49.56%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGL-NLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEE--NSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS----NSG----LVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSA--------GKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSI--DNFSSNSIKVYSKL--HQLFPKNATVFSLAKKY--YGRKGVVESINN-SSASIKIVLDEFS--------EPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYI-NLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQ---NK-WQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDV-FSKDVLP------QKITELQEYLNNLPYKNLERIS-----NDCQIINESDISLIEQSLKGA---QYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGS-ECRCYRMPPYTLINISFGL 3757
            K +L  EY +ERI+DDWI++  L+GNDF+PHLPN+HIH  ALP L+ TY  V P LDGYIN  G L+L+ F  ++  L++ D+ +F++  ED Q+M  K    +  E   L + +  A              F+ S + D   ++  E +K          D  +   +S++ E  + +  E  S   ++   N+D  L+E +F +    L   G    D         N+ +A   +  N QF+ +K+ YY  KL   N++ + L +QA  YV A+QW   YY+ G  SWSWFYP HYAPFISD+           ++F++  PF PFEQL+AVLP  S++ LP     LM  +   SPI DFYP  F TDLNGK+ EWEAVVLIPFIEEKRLLEA+E+K+S+++  +  RN HG HI+   S    NS      V SEI  ++FRIP S +  GL P V +DV   GFPT +H+ H  +L  A   IF  ++   S+VL++  +     + ++     +E   ++WP     K+ ++     + +     ++IVK  +SE +  +     +  + ++  R AI I        + +  A        G +YE     K  S +K    WSS Q     Q + VL   +  D    NS +V + L   Q +PK + V+    K+  +G  G+V   +N  SA  +I +   S        E +   +   S+  ++M     +    +++  F+RITGT+++ N   E  +  +   +  S+ + GL LK ++ +L +  +  + +  N +   NK W Y+    ++V EYR +FP+V+++++     +   DDV +++D+        ++  EL E+L  LP    E++       D Q+I E ++ L E   K     +Y  +     R EL    ++           D +ADFQ++DRV  ++    VP   +G V+GI   K+D     V FD  F     +RGS E    R+P   L+N++FG+
Sbjct:  275 KDSLPFEYEMERIVDDWILLGLLVGNDFLPHLPNIHIHDDALPLLYSTYKKVLPTLDGYINEAGYLNLSRFEAFLAELALNDKTSFMERLEDEQFMESKRIRVVDPEQQELAEPELVA--------------FESSDVED---EAGAEESKDEAGGAGAEDDEDDAAFVSDHEEDGDDL--EPGSGSDELLLSNLDAQLLEDEFNDELATLALSGMNDAD-------FANDVEACWTKTINNQFKRHKKTYYSDKLRYKNISKQQLREQAEGYVRAIQWNLHYYYHGCVSWSWFYPHHYAPFISDVRGFVG----MRMEFELSEPFHPFEQLLAVLPEASADCLPRPLRELMSSDPAKSPICDFYPANFETDLNGKRNEWEAVVLIPFIEEKRLLEAIEAKRSRLTSEENARNSHGSHIQCISSPEPPNSQGQWRTVRSEIPQDSFRIPRSQVKWGLLPNVKMDVYFPGFPTMKHLSHLGELRFANCNIFGMASRKESMVLKVENERAHTDIIELGSELCDEEVCIDWPILKVAKIDSIWGGDDKIVRKCDDEIIVK-DMSEEEKRQWQAHANQLTEHLMTRFAIEIAAQKDSKGKHIRPAVAWVRKFTGLVYEAQGGGKEPSVLKACKQWSSPQ-----QLMPVLLPLVVKDVLLENS-RVLADLPMKQAYPKQSIVWITDPKFALFGMPGMVNGFSNEKSADCRIEVIGMSTQNKVDKMEALRKKMEQKSL--RWMGGYDCARQCQVDTRLFARITGTMFLWNEPRERVEKGQQISSSDSKINCGLALKYSRRDLCVADYTDRTEHTNQRGVTNKVWFYTNLATRLVSEYRRKFPDVWKYLETIGLTQ--QDDVYYTEDIWSNEKTREKRFGELSEFLGGLPSLEAEQLKCGTVYADRQLITEIEMILAEPDEKKPVMNKYMMAPGALFRYELYNGKVHA----------DPAADFQILDRVALMSSDTKVPKTTQGTVVGIHDDKID-----VFFDKPFDGGQKVRGSNEAAAIRVPQSALLNVTFGI 1249          

HSP 2 Score: 345.895 bits (886), Expect = 0.000e+0
Identity = 165/277 (59.57%), Postives = 208/277 (75.09%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF----------SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RW SERYPCLS  ++ +QIP+FD LYLDMNGIIH CSHP+D +V FRI E +IF N+F YIE L+ +++P+ VFF+AVDGVAPRAKMNQQRARRF SA+ A  +   A+++G  +P E RFDSN ITPGT FM RL + L  ++K K  TDS WQG  +ILSGH  PGEGEHKI +FIR  R+   Y+PNT+HC+YGLDADL++LG+ SHEP+FSLLREEVTF          + KK +R   ++  KF LLHLSLLREY+ +EF  +++
Sbjct:    1 MGVPKFYRWTSERYPCLSEVINESQIPEFDNLYLDMNGIIHNCSHPNDDDVTFRITEDEIFVNIFAYIENLYNLIRPQKVFFMAVDGVAPRAKMNQQRARRFMSARTAHTQLAKALENGEIMPSEARFDSNCITPGTYFMTRLHQKLDDWIKTKSATDSRWQGRKIILSGHNVPGEGEHKIMDFIRTERAGSSYDPNTRHCMYGLDADLIMLGIVSHEPHFSLLREEVTFNTRPRKNDNKATKKPKRT-DSDVKKFHLLHLSLLREYLAWEFADVKD 276          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Celegans
Match: xrn-1 (5'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;Acc:Q9BHK7])

HSP 1 Score: 431.409 bits (1108), Expect = 0.000e+0
Identity = 324/1031 (31.43%), Postives = 511/1031 (49.56%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGL-NLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEE--NSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS----NSG----LVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSA--------GKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSI--DNFSSNSIKVYSKL--HQLFPKNATVFSLAKKY--YGRKGVVESINN-SSASIKIVLDEFS--------EPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYI-NLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQ---NK-WQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDV-FSKDVLP------QKITELQEYLNNLPYKNLERIS-----NDCQIINESDISLIEQSLKGA---QYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGS-ECRCYRMPPYTLINISFGL 3757
            K +L  EY +ERI+DDWI++  L+GNDF+PHLPN+HIH  ALP L+ TY  V P LDGYIN  G L+L+ F  ++  L++ D+ +F++  ED Q+M  K    +  E   L + +  A              F+ S + D   ++  E +K          D  +   +S++ E  + +  E  S   ++   N+D  L+E +F +    L   G    D         N+ +A   +  N QF+ +K+ YY  KL   N++ + L +QA  YV A+QW   YY+ G  SWSWFYP HYAPFISD+           ++F++  PF PFEQL+AVLP  S++ LP     LM  +   SPI DFYP  F TDLNGK+ EWEAVVLIPFIEEKRLLEA+E+K+S+++  +  RN HG HI+   S    NS      V SEI  ++FRIP S +  GL P V +DV   GFPT +H+ H  +L  A   IF  ++   S+VL++  +     + ++     +E   ++WP     K+ ++     + +     ++IVK  +SE +  +     +  + ++  R AI I        + +  A        G +YE     K  S +K    WSS Q     Q + VL   +  D    NS +V + L   Q +PK + V+    K+  +G  G+V   +N  SA  +I +   S        E +   +   S+  ++M     +    +++  F+RITGT+++ N   E  +  +   +  S+ + GL LK ++ +L +  +  + +  N +   NK W Y+    ++V EYR +FP+V+++++     +   DDV +++D+        ++  EL E+L  LP    E++       D Q+I E ++ L E   K     +Y  +     R EL    ++           D +ADFQ++DRV  ++    VP   +G V+GI   K+D     V FD  F     +RGS E    R+P   L+N++FG+
Sbjct:  275 KDSLPFEYEMERIVDDWILLGLLVGNDFLPHLPNIHIHDDALPLLYSTYKKVLPTLDGYINEAGYLNLSRFEAFLAELALNDKTSFMERLEDEQFMESKRIRVVDPEQQELAEPELVA--------------FESSDVED---EAGAEESKDEAGGAGAEDDEDDAAFVSDHEEDGDDL--EPGSGSDELLLSNLDAQLLEDEFNDELATLALSGMNDAD-------FANDVEACWTKTINNQFKRHKKTYYSDKLRYKNISKQQLREQAEGYVRAIQWNLHYYYHGCVSWSWFYPHHYAPFISDVRGFVG----MRMEFELSEPFHPFEQLLAVLPEASADCLPRPLRELMSSDPAKSPICDFYPANFETDLNGKRNEWEAVVLIPFIEEKRLLEAIEAKRSRLTSEENARNSHGSHIQCISSPEPPNSQGQWRTVRSEIPQDSFRIPRSQVKWGLLPNVKMDVYFPGFPTMKHLSHLGELRFANCNIFGMASRKESMVLKVENERAHTDIIELGSELCDEEVCIDWPILKVAKIDSIWGGDDKIVRKCDDEIIVK-DMSEEEKRQWQAHANQLTEHLMTRFAIEIAAQKDSKGKHIRPAVAWVRKFTGLVYEAQGGGKEPSVLKACKQWSSPQ-----QLMPVLLPLVVKDVLLENS-RVLADLPMKQAYPKQSIVWITDPKFALFGMPGMVNGFSNEKSADCRIEVIGMSTQNKVDKMEALRKKMEQKSL--RWMGGYDCARQCQVDTRLFARITGTMFLWNEPRERVEKGQQISSSDSKINCGLALKYSRRDLCVADYTDRTEHTNQRGVTNKVWFYTNLATRLVSEYRRKFPDVWKYLETIGLTQ--QDDVYYTEDIWSNEKTREKRFGELSEFLGGLPSLEAEQLKCGTVYADRQLITEIEMILAEPDEKKPVMNKYMMAPGALFRYELYNGKVHA----------DPAADFQILDRVALMSSDTKVPKTTQGTVVGIHDDKID-----VFFDKPFDGGQKVRGSNEAAAIRVPQSALLNVTFGI 1249          

HSP 2 Score: 345.895 bits (886), Expect = 0.000e+0
Identity = 165/277 (59.57%), Postives = 208/277 (75.09%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF----------SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RW SERYPCLS  ++ +QIP+FD LYLDMNGIIH CSHP+D +V FRI E +IF N+F YIE L+ +++P+ VFF+AVDGVAPRAKMNQQRARRF SA+ A  +   A+++G  +P E RFDSN ITPGT FM RL + L  ++K K  TDS WQG  +ILSGH  PGEGEHKI +FIR  R+   Y+PNT+HC+YGLDADL++LG+ SHEP+FSLLREEVTF          + KK +R   ++  KF LLHLSLLREY+ +EF  +++
Sbjct:    1 MGVPKFYRWTSERYPCLSEVINESQIPEFDNLYLDMNGIIHNCSHPNDDDVTFRITEDEIFVNIFAYIENLYNLIRPQKVFFMAVDGVAPRAKMNQQRARRFMSARTAHTQLAKALENGEIMPSEARFDSNCITPGTYFMTRLHQKLDDWIKTKSATDSRWQGRKIILSGHNVPGEGEHKIMDFIRTERAGSSYDPNTRHCMYGLDADLIMLGIVSHEPHFSLLREEVTFNTRPRKNDNKATKKPKRT-DSDVKKFHLLHLSLLREYLAWEFADVKD 276          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Celegans
Match: xrn-2 (5'-3' exoribonuclease 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9U299])

HSP 1 Score: 233.802 bits (595), Expect = 3.831e-71
Identity = 126/319 (39.50%), Postives = 189/319 (59.25%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV--------DNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAA-------IQSGIEIPDEKR----FDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSK--------------KKTRRA---------YIAEETK---FFLLHLSLLREYIDYEFN 824
            MGVP FFRW++++YP   V+         D N++P           +FD LYLDMNGIIH C+HP+D       NE ++F  +F YI+ ++ IV+P+ + ++A+DGVAPRAKMNQQR+RRF+++KE   +E +        +  GI +P +K+    FDSN ITPGT FM RL  AL  ++ +++  D+ W  +++ILS    PGEGEHKI +++R +R  P ++PNT HCL G DADL++LG+A+HE  F+++REE   ++              K+ R A         Y   E +   F  L + +LREY++ E +
Sbjct:    1 MGVPAFFRWLTKKYPATVVNANEDRQRDQDGNRVPVDCTQPNPNFQEFDNLYLDMNGIIHPCTHPEDRPAP--KNEDEMFALIFEYIDRIYSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEMAEKEASIEEQRNRLMAEGIAVPPKKKEEAHFDSNCITPGTPFMARLADALRYYIHDRVTNDASWANIEIILSDANVPGEGEHKIMDYVRKQRGNPAHDPNTVHCLCGADADLIMLGIATHEANFNIIREEFVPNQPRACDLCGQYGHELKECRGAENETDLGDDYCKPEQREKNFIFLRIPVLREYLEKELS 317          

HSP 2 Score: 56.225 bits (134), Expect = 3.831e-71
Identity = 22/58 (37.93%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCG 1021
            ++ +ER +DDW+ + F +GNDF+PHLP+L I   A+  L + Y  +  ++ GY+   G
Sbjct:  324 KFDVERALDDWVFLCFFVGNDFLPHLPSLEIREGAIDRLIKLYKEMVYQMKGYLTKDG 381          

HSP 3 Score: 142.895 bits (359), Expect = 5.714e-34
Identity = 79/206 (38.35%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 1472 GTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTD-EALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDF-QIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
             ++K   E          D G K+   L    +K  YY +K  +   D E   + A  YV  L W+  YY+ G  SW W++P HYAPF SD   +     E   DF +  +PF P EQLM+V PA S + LP  +  LM +++SPIID YP  FR DLNGKK  W+ V L+PF++E RLL  ++S    ++  + +RN  GP+  F
Sbjct:  510 ASRKRKAEQPLIKPEEEEDEGPKDDIRLYESGWKDRYYRAKFDVGSDDIEFRHRVAWAYVEGLCWVLRYYYQGCASWDWYFPYHYAPFASDFETVG----EFQPDFTRPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMIQDDSPIIDLYPADFRIDLNGKKYAWQGVALLPFVDETRLLATLQSVYPTLTAEEKQRNTRGPNRIF 711          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Fly
Match: pcm (gene:FBgn0020261 transcript:FBtr0302082)

HSP 1 Score: 356.681 bits (914), Expect = 2.666e-120
Identity = 169/266 (63.53%), Postives = 208/266 (78.20%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFR+ISERYPCLS     + IP+FD LYLDMNGI+H CSHPDD N+ F + E  IF  +FNY++ LF ++KP+ +FFL+VDGVAPRAKMNQQR+RRF++A+EA  +E  A Q G E+ + +RFDSN ITPGTEFM RLQ+ L  FLK KI TD LWQ   VILSG E PGEGEHKI ++IRY ++ PDY+PNT+HCLYGLDADL+ILGL +HE +F +LREEV F +   R +   EET+FFLLHL LLREY++ EF+ALR
Sbjct:    1 MGVPKFFRYISERYPCLSELAREHCIPEFDNLYLDMNGIVHNCSHPDDNNIHFHLEEEQIFQEIFNYVDKLFYLIKPQRLFFLSVDGVAPRAKMNQQRSRRFRTAREAEQQEAKAAQRG-ELREHERFDSNCITPGTEFMVRLQEGLRAFLKTKISTDPLWQRCTVILSGQEAPGEGEHKIMDYIRYMKTQPDYDPNTRHCLYGLDADLIILGLCTHELHFVVLREEVKFGRNVKRTS--VEETRFFLLHLGLLREYLELEFDALR 263          

HSP 2 Score: 98.2117 bits (243), Expect = 2.666e-120
Identity = 42/99 (42.42%), Postives = 69/99 (69.70%), Query Frame = 2
Query:  833 RTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKT 1129
            RT + +  + ++IDDW++M FL+GNDF+PHLP LHI ++ALP L+ TYI + P L G IN  GKL+L     ++ AL+  + ++F ++ +D+++M  K+
Sbjct:  263 RTDEHKLDIAQLIDDWVLMGFLVGNDFIPHLPCLHISSNALPLLYRTYIGIYPTLGGNINENGKLNLRRLQIFISALTEVELDHFKEHADDLKYMNNKS 361          

HSP 3 Score: 321.627 bits (823), Expect = 4.725e-89
Identity = 232/775 (29.94%), Postives = 380/775 (49.03%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSG---------------LVISEIAPETFRIPMSSIVPGLC---PKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRM-AEFKSCTSRNIFRRSAISIDPTNFIILETVHS-AGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQ----QLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSI-------DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPN--FEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQ-KKLDGLRLE----------VLFDNQFKSAISIRG-SECRCYRMPPYTLINI 3745
            +F+ YKR++Y +K   +  DE + +  + YV ALQW+  YY+ GV SW W+YP HY PFISD+ N+    ++  I F +G PFLPF+QL+AVLPA S++LLP  YH LM    SP+ +FYP +F +DLNGKK +WEAVVLIPFI+E RLL AM   ++Q+S  +  RN HGP   +++S                  L  +E+A  +  I + ++   +C   P     V   GFPT +H+   F+L    VK+FE  +   +IVL+   + +  ++  +A +Y+ ++  V WP  ++  V+ V     R         +  + ++  D+ R  +E K+     I R   + I   N+ +L  V + AG   E     +    + ++  WSS+ T +  Q     L+V +R   NF +        +   FP  +T+F +   YYG +G V+    +  + +I   + S  + P   +N+        D  Y+   Q      ++     R++GT+++ L       RR      ++ ++GL LK  + N +  G+     C  + N+W YS   + ++  Y  R+P+V +F    N   E +   DVF   V  +++ EL  ++   P+  +ERIS   + +    I L+  ++   +  S   K  ++++    L  P+ +L  V   K    +L DRVV +   Y VP+G KG VIGI      + +RLE          VLFD+   +  +I G +E R Y++P   L+ I
Sbjct:  410 EFQNYKRNFYRNKFKRDPNDELIEELCHHYVNALQWVLDYYYRGVQSWDWYYPFHYTPFISDLKNI----EQVEIAFHMGTPFLPFQQLLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGRLLAAMLPCEAQLSLEERERNRHGPMYVYKYSTVAQGPMPAYPPLRALPVLYCTEVAKWSHEIAV-NLPYSVCIELPNAARTVFFPGFPTMQHLPFDFELRNDRVKVFEQVSRNQNIVLKPRKRQLEDTLTAVASQYLGKVIHVGWPHLVKAIVVRVATRDQR---------VDSEGITLNDSRRFDSECKALQEHFINR---MGIQFANYDVLVYVRTFAGNSTEF----RDKGALMVRDSWSSSVTGYPAQGVVADLTVWERMRKNFLN--------VEHYFPVGSTIFLITDPYYGSEGTVQDPRLAYTNGRI---QVSIMVRPEPKVNAARQLQEERDRDYLSTFQVCNLLRISGRTLGRLSGTVWVVLG-----PRRQKMENVTKHNIGLQLKYPRQNEERAGY-----CFRTNNQWYYSSLAVDLMRNYCQRYPDVIDFFGDSNDRAEFVFEQDVFPNAVGHRRVEELANWVRQQPHMKVERISCGSKTVCRETIELLIAAVDDLR--SLPVKHVKLQVKPHLLIKPNVTLPDVYRSKRP-VRLFDRVVIVRTIYMVPVGTKGTVIGIHPVTDPNPVRLECVHAVDTFCKVLFDSPVPNCNNIHGIAEDRVYKVPEIALVII 1139          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Fly
Match: pcm (gene:FBgn0020261 transcript:FBtr0074784)

HSP 1 Score: 356.681 bits (914), Expect = 2.779e-120
Identity = 169/266 (63.53%), Postives = 208/266 (78.20%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFR+ISERYPCLS     + IP+FD LYLDMNGI+H CSHPDD N+ F + E  IF  +FNY++ LF ++KP+ +FFL+VDGVAPRAKMNQQR+RRF++A+EA  +E  A Q G E+ + +RFDSN ITPGTEFM RLQ+ L  FLK KI TD LWQ   VILSG E PGEGEHKI ++IRY ++ PDY+PNT+HCLYGLDADL+ILGL +HE +F +LREEV F +   R +   EET+FFLLHL LLREY++ EF+ALR
Sbjct:    1 MGVPKFFRYISERYPCLSELAREHCIPEFDNLYLDMNGIVHNCSHPDDNNIHFHLEEEQIFQEIFNYVDKLFYLIKPQRLFFLSVDGVAPRAKMNQQRSRRFRTAREAEQQEAKAAQRG-ELREHERFDSNCITPGTEFMVRLQEGLRAFLKTKISTDPLWQRCTVILSGQEAPGEGEHKIMDYIRYMKTQPDYDPNTRHCLYGLDADLIILGLCTHELHFVVLREEVKFGRNVKRTS--VEETRFFLLHLGLLREYLELEFDALR 263          

HSP 2 Score: 98.2117 bits (243), Expect = 2.779e-120
Identity = 42/99 (42.42%), Postives = 69/99 (69.70%), Query Frame = 2
Query:  833 RTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKT 1129
            RT + +  + ++IDDW++M FL+GNDF+PHLP LHI ++ALP L+ TYI + P L G IN  GKL+L     ++ AL+  + ++F ++ +D+++M  K+
Sbjct:  263 RTDEHKLDIAQLIDDWVLMGFLVGNDFIPHLPCLHISSNALPLLYRTYIGIYPTLGGNINENGKLNLRRLQIFISALTEVELDHFKEHADDLKYMNNKS 361          

HSP 3 Score: 322.013 bits (824), Expect = 4.233e-89
Identity = 232/775 (29.94%), Postives = 380/775 (49.03%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSG---------------LVISEIAPETFRIPMSSIVPGLC---PKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRM-AEFKSCTSRNIFRRSAISIDPTNFIILETVHS-AGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQ----QLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSI-------DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPN--FEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQ-KKLDGLRLE----------VLFDNQFKSAISIRG-SECRCYRMPPYTLINI 3745
            +F+ YKR++Y +K   +  DE + +  + YV ALQW+  YY+ GV SW W+YP HY PFISD+ N+    ++  I F +G PFLPF+QL+AVLPA S++LLP  YH LM    SP+ +FYP +F +DLNGKK +WEAVVLIPFI+E RLL AM   ++Q+S  +  RN HGP   +++S                  L  +E+A  +  I + ++   +C   P     V   GFPT +H+   F+L    VK+FE  +   +IVL+   + +  ++  +A +Y+ ++  V WP  ++  V+ V     R         +  + ++  D+ R  +E K+     I R   + I   N+ +L  V + AG   E     +    + ++  WSS+ T +  Q     L+V +R   NF +        +   FP  +T+F +   YYG +G V+    +  + +I   + S  + P   +N+        D  Y+   Q      ++     R++GT+++ L       RR      ++ ++GL LK  + N +  G+     C  + N+W YS   + ++  Y  R+P+V +F    N   E +   DVF   V  +++ EL  ++   P+  +ERIS   + +    I L+  ++   +  S   K  ++++    L  P+ +L  V   K    +L DRVV +   Y VP+G KG VIGI      + +RLE          VLFD+   +  +I G +E R Y++P   L+ I
Sbjct:  410 EFQNYKRNFYRNKFKRDPNDELIEELCHHYVNALQWVLDYYYRGVQSWDWYYPFHYTPFISDLKNI----EQVEIAFHMGTPFLPFQQLLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGRLLAAMLPCEAQLSLEERERNRHGPMYVYKYSTVAQGPMPAYPPLRALPVLYCTEVAKWSHEIAV-NLPYSVCIELPNAARTVFFPGFPTMQHLPFDFELRNDRVKVFEQVSRNQNIVLKPRKRQLEDTLTAVASQYLGKVIHVGWPHLVKAIVVRVATRDQR---------VDSEGITLNDSRRFDSECKALQEHFINR---MGIQFANYDVLVYVRTFAGNSTEF----RDKGALMVRDSWSSSVTGYPAQGVVADLTVWERMRKNFLN--------VEHYFPVGSTIFLITDPYYGSEGTVQDPRLAYTNGRI---QVSIMVRPEPKVNAARQLQEERDRDYLSTFQVCNLLRISGRTLGRLSGTVWVVLG-----PRRQKMENVTKHNIGLQLKYPRQNEERAGY-----CFRTNNQWYYSSLAVDLMRNYCQRYPDVIDFFGDSNDRAEFVFEQDVFPNAVGHRRVEELANWVRQQPHMKVERISCGSKTVCRETIELLIAAVDDLR--SLPVKHVKLQVKPHLLIKPNVTLPDVYRSKRP-VRLFDRVVIVRTIYMVPVGTKGTVIGIHPVTDPNPVRLECVHAVDTFCKVLFDSPVPNCNNIHGIAEDRVYKVPEIALVII 1139          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Fly
Match: Rat1 (gene:FBgn0031868 transcript:FBtr0079345)

HSP 1 Score: 241.891 bits (616), Expect = 3.437e-76
Identity = 135/317 (42.59%), Postives = 185/317 (58.36%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPD--------------------FDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINR--EIAAIQS-----GIEIPDEK----RFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKK-----------------------TRRAY-----IAEETKFFLLHLSLLREYI 809
            MGVP FFRW+S +YP + +  + N+  D                    FD LYLDMNGIIH C+HP+D       NE ++   +F  I+ LF IV+P+ + ++A+DGVAPRAKMNQQR+RRF++AKE   +  EIA I+      G ++P EK     FDSN ITPGT FMDRL K L  F+ ++   +  W+G+ VILS    PGEGEHKI ++IR +R+ PD++PNT+H L G DADL++LGLA+HEP F+++REE   +K +                       T   +     I  E KF  + LS+LREY+
Sbjct:    1 MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFECIDRLFGIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRAAKETTEKRLEIARIREELLSRGCKLPPEKEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNFTIIREEFLPNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAEVKFIFVRLSVLREYL 315          

HSP 2 Score: 65.855 bits (159), Expect = 3.437e-76
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLN 1036
            EYS ER +DDW+ M F +GNDF+PHLP+L I   A+  L E Y     +  GY+ + G ++L+
Sbjct:  327 EYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDVNLD 389          

HSP 3 Score: 140.969 bits (354), Expect = 2.456e-33
Identity = 71/170 (41.76%), Postives = 101/170 (59.41%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEAL-VQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLS--NDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 2068
            +K  YY SK  +   ++      A +YV  L W+  YY+ G  SW+W++P HYAPF SD  N+   + + E G      +PF P EQLM V PA SS  +P  +  LM +  SPIIDFYP+ F+ DLNGKK  W+ V L+PF++EKRL +A+     Q++  +++RN  G
Sbjct:  495 FKDRYYESKFDVAPGNQQFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPFASDFVNIQGLSTMFEKGT-----KPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRG 659          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Fly
Match: Rat1 (gene:FBgn0031868 transcript:FBtr0332324)

HSP 1 Score: 241.891 bits (616), Expect = 3.437e-76
Identity = 135/317 (42.59%), Postives = 185/317 (58.36%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPD--------------------FDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINR--EIAAIQS-----GIEIPDEK----RFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKK-----------------------TRRAY-----IAEETKFFLLHLSLLREYI 809
            MGVP FFRW+S +YP + +  + N+  D                    FD LYLDMNGIIH C+HP+D       NE ++   +F  I+ LF IV+P+ + ++A+DGVAPRAKMNQQR+RRF++AKE   +  EIA I+      G ++P EK     FDSN ITPGT FMDRL K L  F+ ++   +  W+G+ VILS    PGEGEHKI ++IR +R+ PD++PNT+H L G DADL++LGLA+HEP F+++REE   +K +                       T   +     I  E KF  + LS+LREY+
Sbjct:    1 MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFECIDRLFGIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRAAKETTEKRLEIARIREELLSRGCKLPPEKEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNFTIIREEFLPNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAEVKFIFVRLSVLREYL 315          

HSP 2 Score: 65.855 bits (159), Expect = 3.437e-76
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLN 1036
            EYS ER +DDW+ M F +GNDF+PHLP+L I   A+  L E Y     +  GY+ + G ++L+
Sbjct:  327 EYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDVNLD 389          

HSP 3 Score: 140.969 bits (354), Expect = 2.456e-33
Identity = 71/170 (41.76%), Postives = 101/170 (59.41%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEAL-VQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLS--NDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 2068
            +K  YY SK  +   ++      A +YV  L W+  YY+ G  SW+W++P HYAPF SD  N+   + + E G      +PF P EQLM V PA SS  +P  +  LM +  SPIIDFYP+ F+ DLNGKK  W+ V L+PF++EKRL +A+     Q++  +++RN  G
Sbjct:  495 FKDRYYESKFDVAPGNQQFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPFASDFVNIQGLSTMFEKGT-----KPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRG 659          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 385.956 bits (990), Expect = 1.828e-137
Identity = 181/268 (67.54%), Postives = 217/268 (80.97%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI+E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA  +   A++ G  +P E RFDSN ITPGT+FM RLQ+ L  F+ NK+ TD  WQGV+V LSGHETPGEGEHKI EFIR   + P +NPNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK+++   A EET F LLHLSL+REYIDYEF+ LR+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRISEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEEKIKKALEKGEVLPTEARFDSNCITPGTDFMARLQEQLKYFVHNKLSTDKTWQGVNVYLSGHETPGEGEHKIMEFIRSESTKPGHNPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRITAPEETTFHLLHLSLMREYIDYEFSELRK 268          

HSP 2 Score: 126.331 bits (316), Expect = 1.828e-137
Identity = 54/103 (52.43%), Postives = 75/103 (72.82%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            ++ +  EY LERIIDDW++M FL+GNDF+PHLP+LHI+  ALP L+ TYINV P L GY+N  G L+L +F KY++ LS FDR +F + + D++W   K G +
Sbjct:  267 RKKISFEYDLERIIDDWVLMGFLVGNDFIPHLPHLHINHDALPLLYRTYINVLPSLGGYLNENGHLNLTHFEKYLEKLSDFDREHFSEVFVDLKWFESKVGNK 369          

HSP 3 Score: 402.519 bits (1033), Expect = 2.474e-115
Identity = 263/791 (33.25%), Postives = 421/791 (53.22%), Query Frame = 2
Query: 1526 DAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIP-------MSSIVPGLCPKVLLD-VICQ---------GFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIV--------KQSLSEIDNLRMAEF---KSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASE-YTDMNSLAF-----SRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            D  D + +  +FR YKR YY++K+G+ + +DE L  QA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SD+ N+S       + F + +PF+PFEQL+AVLP+ S +LLP CY  LM   +SPI+++YP+ F+TDLNGK++EWEAVVLIPFI+EK LL AME     ++PS+  RN H     + + +  L     +P+    P         + VP    +V  D V C+         GFPT +H+ H F  +K+GV +F+ S+ G +++L I P +    +E++A   +    FVNWP  +E +V+AV +   ++ L E +   V           +S + +    ++       + +  +R  I+I+ T+ ++   + + G+ Y I    K    V L+  ++     +  Q    + + I  F S S+  +  L +LFP   TVF +   YYG  G V+  ++  S   +++V     EP L  +    I NQ+ ++ + S  Y   + L       SR +G+I+I      + S++N   +  + ++GL+LK NK N ++PG+  + + E     W YS  V +++ EY  RF EVF+ +      + + DD+F   D+ P       +K+ E+Q +L   P  ++ R S D QI++   +  IE+ L+    A    K  RV +    L+ P    HGV PD  +++ L DRVV + + ++VPLGL+G +IGI+    +  +  EV+FD +F   ++IR S  R YR+PP  LIN+S G R
Sbjct:  421 DGEDDDMFETEFRQYKRTYYMTKMGVEVVSDEFLANQAKCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDVRNISG----LSLTFDLAKPFMPFEQLLAVLPSASKDLLPQCYQHLMTSLSSPIVEYYPQDFKTDLNGKQQEWEAVVLIPFIDEKCLLAAMEPYTHNLTPSEKARNRHTECAVYCY-DKDLDYPYNSPDPQIFPNIVHCHARQTPVPMDAWRVSPDHVRCRIDRGALYFCGFPTLQHIRHKFYKKKSGVMVFQQSSRGENMILDILPSHEMVQVEEVAALVLGRSLFVNWPHLMEARVVAVSDGETKFSLEEPAGSQVLYMENNPPPTKVSRVTDKEQKDWVKEVQGLTEHFSKRKGIAINETDVLVYGQLLT-GRKYVIGQNGK----VHLEKQFAKQVLPFPYQ---TIVKDIKAFDS-SLARFKTLEELFPLGTTVFMVGNPYYGAMGEVQDSSDVISEGRVRVVFSVPCEPQLDAL----IQNQHKYSVKYSPGYVLASRLGITGYLVSRFSGSIFIG-----RGSKKNPHGE-QKVNVGLNLKFNKKNEEVPGYTKRTEKE-----WLYSAAVEELIAEYLERFSEVFDHVA-----RNSHDDIFYEDDIWPGEDENGVEKVQEIQGWLKTHPVSSISRASCDLQILDAGIVEKIEEELE-KTKAKKMNKKVRVTVKPHLLFRPLEQQHGVVPDPDSEYHLFDRVVNVRESFSVPLGLRGTIIGIKGADREAEILYEVIFDEEFAGGLTIRCSPGRGYRLPPSALINLSHGSR 1176          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 224.557 bits (571), Expect = 3.072e-88
Identity = 109/169 (64.50%), Postives = 131/169 (77.51%), Query Frame = 3
Query:  333 RRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALRE 836
            RR+ SAKEA  +   A++ G  +P E RFDSN ITPGT+FM RLQ+ L  F+ NK+ TD  WQGV+V LSGHETPGEGEHKI EFIR   + P +NPNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK+++   A EET F LLHLSL+REYIDYEF+ LR+
Sbjct:   11 RRYSSAKEAEEKIKKALEKGEVLPTEARFDSNCITPGTDFMARLQEQLKYFVHNKLSTDKTWQGVNVYLSGHETPGEGEHKIMEFIRSESTKPGHNPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRITAPEETTFHLLHLSLMREYIDYEFSELRK 179          

HSP 2 Score: 123.635 bits (309), Expect = 3.072e-88
Identity = 54/103 (52.43%), Postives = 75/103 (72.82%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            ++ +  EY LERIIDDW++M FL+GNDF+PHLP+LHI+  ALP L+ TYINV P L GY+N  G L+L +F KY++ LS FDR +F + + D++W   K G +
Sbjct:  178 RKKISFEYDLERIIDDWVLMGFLVGNDFIPHLPHLHINHDALPLLYRTYINVLPSLGGYLNENGHLNLTHFEKYLEKLSDFDREHFSEVFVDLKWFESKVGNK 280          

HSP 3 Score: 187.578 bits (475), Expect = 2.752e-50
Identity = 83/156 (53.21%), Postives = 114/156 (73.08%), Query Frame = 2
Query: 1526 DAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIE 1990
            D  D + +  +FR YKR YY++K+G+ + +DE L  QA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SD+ N+S       + F + +PF+PFEQL+AVLP+ S +LLP CY  LM   +SPI+++YP+ F+TDLNGK++EWEAVVLIPFI+
Sbjct:  332 DGEDDDMFETEFRQYKRTYYMTKMGVEVVSDEFLANQAKCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDVRNISG----LSLTFDLAKPFMPFEQLLAVLPSASKDLLPQCYQHLMTSLSSPIVEYYPQDFKTDLNGKQQEWEAVVLIPFID 483          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2874])

HSP 1 Score: 239.965 bits (611), Expect = 6.468e-75
Identity = 134/322 (41.61%), Postives = 185/322 (57.45%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP-----CLS----------VSVDN-----NQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA------------------------------EETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP     CL           + VD      N++ +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + V LS    PGEGEHKI ++IR +R  P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   K R   +                                E +F  + L++LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVHCLEEKAKEYNGVKIPVDTSKPNPNEV-EFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEVIERGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYVADRLTNDPGWRNITVFLSDASVPGEGEHKIMDYIRRQRGQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREE--FKPNKPRPCALCSQMGHEIKDCQGLPREKQGEHDEFADTIPVSEQEFIFIRLAVLREYLEREL 317          

HSP 2 Score: 63.5438 bits (153), Expect = 6.468e-75
Identity = 32/90 (35.56%), Postives = 49/90 (54.44%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +L   +S ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    ED
Sbjct:  321 SLPFPFSFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVGIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKED 410          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2874])

HSP 1 Score: 239.965 bits (611), Expect = 6.468e-75
Identity = 134/322 (41.61%), Postives = 185/322 (57.45%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP-----CLS----------VSVDN-----NQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA------------------------------EETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP     CL           + VD      N++ +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + V LS    PGEGEHKI ++IR +R  P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   K R   +                                E +F  + L++LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVHCLEEKAKEYNGVKIPVDTSKPNPNEV-EFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEVIERGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYVADRLTNDPGWRNITVFLSDASVPGEGEHKIMDYIRRQRGQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREE--FKPNKPRPCALCSQMGHEIKDCQGLPREKQGEHDEFADTIPVSEQEFIFIRLAVLREYLEREL 317          

HSP 2 Score: 63.5438 bits (153), Expect = 6.468e-75
Identity = 32/90 (35.56%), Postives = 49/90 (54.44%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +L   +S ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    ED
Sbjct:  321 SLPFPFSFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVGIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKED 410          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2874])

HSP 1 Score: 238.81 bits (608), Expect = 1.283e-74
Identity = 134/322 (41.61%), Postives = 185/322 (57.45%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP-----CLS----------VSVDN-----NQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA------------------------------EETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP     CL           + VD      N++ +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + V LS    PGEGEHKI ++IR +R  P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   K R   +                                E +F  + L++LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVHCLEEKAKEYNGVKIPVDTSKPNPNEV-EFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEVIERGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYVADRLTNDPGWRNITVFLSDASVPGEGEHKIMDYIRRQRGQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREE--FKPNKPRPCALCSQMGHEIKDCQGLPREKQGEHDEFADTIPVSEQEFIFIRLAVLREYLEREL 317          

HSP 2 Score: 63.5438 bits (153), Expect = 1.283e-74
Identity = 32/90 (35.56%), Postives = 49/90 (54.44%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +L   +S ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    ED
Sbjct:  321 SLPFPFSFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVGIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKED 410          

HSP 3 Score: 149.443 bits (376), Expect = 8.044e-36
Identity = 73/174 (41.95%), Postives = 103/174 (59.20%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIG-RPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  ++ TD+   ++    YV  L W+  YY+ G  SW W++P HYAPF SD      D+K    DF+ G +PF P EQLM V PA S   LP  + +LM +  S IIDFYP  F  DLNGKK  W+ V L+PF++E+RL  A+    + ++P ++RRN  G  + F
Sbjct:  524 WKQRYYKTKFDVDATDDEFRKKVVQSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFK----DIKGMFSDFEKGTKPFKPLEQLMGVFPAASGNFLPTTWRALMSDPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYNDLTPEEVRRNSLGSDVMF 693          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 379.022 bits (972), Expect = 2.219e-134
Identity = 178/267 (66.67%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF-SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV + LSGHETPGEGEHKI EFIR +++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KK  +R    EET F LLHLSL+REYIDYEF++L+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRITEDKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGEVLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVAIYLSGHETPGEGEHKIMEFIRSQKTKPDHDPNTRHCLYGLDADLIMLGLTSHEVHFSLLREEVRFGGKKNQKRVTAPEETTFHLLHLSLMREYIDYEFSSLK 267          

HSP 2 Score: 123.25 bits (308), Expect = 2.219e-134
Identity = 54/97 (55.67%), Postives = 72/97 (74.23%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            EY +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI+V P + GYIN  G L+L NF KY++ LS FDR +F + + D++W   K G +
Sbjct:  273 EYDVERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYISVLPTIGGYINENGYLNLYNFGKYLEKLSDFDREHFNEIFVDLKWFESKVGNK 369          

HSP 3 Score: 405.216 bits (1040), Expect = 6.866e-116
Identity = 271/783 (34.61%), Postives = 419/783 (53.51%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNV--TQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQSLSEID---------NLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +FR YKR YY+SK+G+ + +DE L  QA  YV A+QWI  YY+ GV SWSW+YP HYAP++SDI N+S+ LK   + F +G+PF+PFEQL+AVLPA S +LLP  Y +LM   +SPIID+YP+ F+TDLNGK++EWEAVVLIPFI+EKRLLEAM S    ++  + +RN H   IK+ +          +P   + P           + LD                     C GFPT +H++H + ++KAGV++F+ S+ G +++L I  +    T +++ +A   + +  FVNWP   E +V+ V +   ++ L E+    KL    S+             N+ + E +   S +  RR  + I+ T  ++   + + G+ Y++         V L+  WS     +  Q    + + I  F S S   Y  L +LF   ++VF L   YYG  G V+  ++  S   I+++L    EP    ++ N H  SI  +Y      +    +N    SR TG+I+I      + S++N   +  + ++GL+LK NK N ++PG+  +V  E     W YS     ++ EY  RFPE+F ++ K + E +  +D    D+ P       +K+ E+  +L + P   L R S D QI++ + +  IE+ ++  +  S      RV +    L+ P    HGV PD  A+F+L DRVV + + ++VPLGL+G VIGI+  + D  + LEVLFD  F   ++IR S+ + YR+P   LIN+S G R
Sbjct:  430 EFRQYKRTYYMSKMGVEVVSDEFLADQAKCYVQAIQWILHYYYHGVQSWSWYYPYHYAPYLSDICNISH-LK---LTFNLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYWYEKE-TDFKYFSPWPEKFPSVDRCHARYKLISLDAWLVDVTDNKITKVDKSALYFC-GFPTLKHIKHKYSMKKAGVQVFQQSSRGENMILEIETEGDEDTLNVDTVASAVLGKSVFVNWPHLEEARVVTVTDGDMKFYLEERPGTQKLYTGNSVPPTKVAYVGDKERNIWVKEIQGI-SEHYHRRKGVVINETAVVLYAQLLT-GRRYQLGH----NGEVHLEKQWSKQVLPFVYQ---AVVQDITTFESGSSH-YKTLGELFSPESSVFMLGAPYYGCIGEVQESSDVLSENRIRVLLTIPCEPQLDALIQNQHKFSI--KYNPGYVLASRLGVNGYLVSRFTGSIFIG-----RGSKKNPHGE-QKSNVGLNLKFNKKNEEVPGYTKRVGTE-----WTYSSAAEVLLSEYIERFPELFLYVSKKSQEDVFYED----DIWPGENENGAEKVQEIVSWLKSHPVNMLSRSSCDLQILDAAIVEKIEEEVEKCK--SKKNSKVRVTVKPHLLFKPLEQQHGVVPDPDAEFRLYDRVVNVRENFSVPLGLRGTVIGIKGAERDADVLLEVLFDEVFPGGLTIRCSQFKGYRLPTSALINLSHGNR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 378.252 bits (970), Expect = 4.849e-134
Identity = 178/267 (66.67%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF-SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV + LSGHETPGEGEHKI EFIR +++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KK  +R    EET F LLHLSL+REYIDYEF++L+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRITEDKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGEVLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVAIYLSGHETPGEGEHKIMEFIRSQKTKPDHDPNTRHCLYGLDADLIMLGLTSHEVHFSLLREEVRFGGKKNQKRVTAPEETTFHLLHLSLMREYIDYEFSSLK 267          

HSP 2 Score: 123.25 bits (308), Expect = 4.849e-134
Identity = 54/97 (55.67%), Postives = 72/97 (74.23%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            EY +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI+V P + GYIN  G L+L NF KY++ LS FDR +F + + D++W   K G +
Sbjct:  273 EYDVERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYISVLPTIGGYINENGYLNLYNFGKYLEKLSDFDREHFNEIFVDLKWFESKVGNK 369          

HSP 3 Score: 390.963 bits (1003), Expect = 2.835e-111
Identity = 264/782 (33.76%), Postives = 413/782 (52.81%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNV--TQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQSLSEID---------NLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +FR YKR YY+SK+G+ +  +  +        A+QWI  YY+ GV SWSW+YP HYAP++SDI N+S+ LK   + F +G+PF+PFEQL+AVLPA S +LLP  Y +LM   +SPIID+YP+ F+TDLNGK++EWEAVVLIPFI+EKRLLEAM S    ++  + +RN H   IK+ +          +P   + P           + LD                     C GFPT +H++H + ++KAGV++F+ S+ G +++L I  +    T +++ +A   + +  FVNWP   E +V+ V +   ++ L E+    KL    S+             N+ + E +   S +  RR  + I+ T  ++   + + G+ Y++         V L+  WS     +  Q    + + I  F S S   Y  L +LF   ++VF L   YYG  G V+  ++  S   I+++L    EP    ++ N H  SI  +Y      +    +N    SR TG+I+I      + S++N   +  + ++GL+LK NK N ++PG+  +V  E     W YS     ++ EY  RFPE+F ++ K + E +  +D    D+ P       +K+ E+  +L + P   L R S D QI++ + +  IE+ ++  +  S      RV +    L+ P    HGV PD  A+F+L DRVV + + ++VPLGL+G VIGI+  + D  + LEVLFD  F   ++IR S+ + YR+P   LIN+S G R
Sbjct:  430 EFRQYKRTYYMSKMGVEVVSDCFM--------AIQWILHYYYHGVQSWSWYYPYHYAPYLSDICNISH-LK---LTFNLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYWYEKE-TDFKYFSPWPEKFPSVDRCHARYKLISLDAWLVDVTDNKITKVDKSALYFC-GFPTLKHIKHKYSMKKAGVQVFQQSSRGENMILEIETEGDEDTLNVDTVASAVLGKSVFVNWPHLEEARVVTVTDGDMKFYLEERPGTQKLYTGNSVPPTKVAYVGDKERNIWVKEIQGI-SEHYHRRKGVVINETAVVLYAQLLT-GRRYQLGH----NGEVHLEKQWSKQVLPFVYQ---AVVQDITTFESGSSH-YKTLGELFSPESSVFMLGAPYYGCIGEVQESSDVLSENRIRVLLTIPCEPQLDALIQNQHKFSI--KYNPGYVLASRLGVNGYLVSRFTGSIFIG-----RGSKKNPHGE-QKSNVGLNLKFNKKNEEVPGYTKRVGTE-----WTYSSAAEVLLSEYIERFPELFLYVSKKSQEDVFYED----DIWPGENENGAEKVQEIVSWLKSHPVNMLSRSSCDLQILDAAIVEKIEEEVEKCK--SKKNSKVRVTVKPHLLFKPLEQQHGVVPDPDAEFRLYDRVVNVRENFSVPLGLRGTVIGIKGAERDADVLLEVLFDEVFPGGLTIRCSQFKGYRLPTSALINLSHGNR 1168          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 378.252 bits (970), Expect = 5.775e-134
Identity = 178/267 (66.67%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF-SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV + LSGHETPGEGEHKI EFIR +++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KK  +R    EET F LLHLSL+REYIDYEF++L+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRITEDKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGEVLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVAIYLSGHETPGEGEHKIMEFIRSQKTKPDHDPNTRHCLYGLDADLIMLGLTSHEVHFSLLREEVRFGGKKNQKRVTAPEETTFHLLHLSLMREYIDYEFSSLK 267          

HSP 2 Score: 122.865 bits (307), Expect = 5.775e-134
Identity = 54/97 (55.67%), Postives = 72/97 (74.23%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            EY +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI+V P + GYIN  G L+L NF KY++ LS FDR +F + + D++W   K G +
Sbjct:  273 EYDVERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYISVLPTIGGYINENGYLNLYNFGKYLEKLSDFDREHFNEIFVDLKWFESKVGNK 369          

HSP 3 Score: 390.963 bits (1003), Expect = 2.541e-111
Identity = 264/786 (33.59%), Postives = 414/786 (52.67%), Query Frame = 2
Query: 1544 FWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNV--TQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQSLSEID---------NLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
             +  +FR YKR YY+SK+G+ +  +  +        A+QWI  YY+ GV SWSW+YP HYAP++SDI N+S+ LK   + F +G+PF+PFEQL+AVLPA S +LLP  Y +LM   +SPIID+YP+ F+TDLNGK++EWEAVVLIPFI+EKRLLEAM S    ++  + +RN H   IK+ +          +P   + P           + LD                     C GFPT +H++H + ++KAGV++F+ S+ G +++L I  +    T +++ +A   + +  FVNWP   E +V+ V +   ++ L E+    KL    S+             N+ + E +   S +  RR  + I+ T  ++   + + G+ Y++         V L+  WS     +  Q    + + I  F S S   Y  L +LF   ++VF L   YYG  G V+  ++  S   I+++L    EP    ++ N H  SI  +Y      +    +N    SR TG+I+I      + S++N   +  + ++GL+LK NK N ++PG+  +V  E     W YS     ++ EY  RFPE+F ++ K + E +  +D    D+ P       +K+ E+  +L + P   L R S D QI++ + +  IE+ ++  +  S      RV +    L+ P    HGV PD  A+F+L DRVV + + ++VPLGL+G VIGI+  + D  + LEVLFD  F   ++IR S+ + YR+P   LIN+S G R
Sbjct:  424 LFETEFRQYKRTYYMSKMGVEVVSDCFM--------AIQWILHYYYHGVQSWSWYYPYHYAPYLSDICNISH-LK---LTFNLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYWYEKE-TDFKYFSPWPEKFPSVDRCHARYKLISLDAWLVDVTDNKITKVDKSALYFC-GFPTLKHIKHKYSMKKAGVQVFQQSSRGENMILEIETEGDEDTLNVDTVASAVLGKSVFVNWPHLEEARVVTVTDGDMKFYLEERPGTQKLYTGNSVPPTKVAYVGDKERNIWVKEIQGI-SEHYHRRKGVVINETAVVLYAQLLT-GRRYQLGH----NGEVHLEKQWSKQVLPFVYQ---AVVQDITTFESGSSH-YKTLGELFSPESSVFMLGAPYYGCIGEVQESSDVLSENRIRVLLTIPCEPQLDALIQNQHKFSI--KYNPGYVLASRLGVNGYLVSRFTGSIFIG-----RGSKKNPHGE-QKSNVGLNLKFNKKNEEVPGYTKRVGTE-----WTYSSAAEVLLSEYIERFPELFLYVSKKSQEDVFYED----DIWPGENENGAEKVQEIVSWLKSHPVNMLSRSSCDLQILDAAIVEKIEEEVEKCK--SKKNSKVRVTVKPHLLFKPLEQQHGVVPDPDAEFRLYDRVVNVRENFSVPLGLRGTVIGIKGAERDADVLLEVLFDEVFPGGLTIRCSQFKGYRLPTSALINLSHGNR 1166          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 377.481 bits (968), Expect = 1.087e-133
Identity = 178/267 (66.67%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF-SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV + LSGHETPGEGEHKI EFIR +++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KK  +R    EET F LLHLSL+REYIDYEF++L+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRITEDKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGEVLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVAIYLSGHETPGEGEHKIMEFIRSQKTKPDHDPNTRHCLYGLDADLIMLGLTSHEVHFSLLREEVRFGGKKNQKRVTAPEETTFHLLHLSLMREYIDYEFSSLK 267          

HSP 2 Score: 122.865 bits (307), Expect = 1.087e-133
Identity = 55/103 (53.40%), Postives = 74/103 (71.84%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  EY +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI+V P + GYIN  G L+L NF KY++ LS FDR +F + + D++W   K G +
Sbjct:  267 KNKISFEYDVERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYISVLPTIGGYINENGYLNLYNFGKYLEKLSDFDREHFNEIFVDLKWFESKVGNK 369          

HSP 3 Score: 394.045 bits (1011), Expect = 1.111e-112
Identity = 266/796 (33.42%), Postives = 419/796 (52.64%), Query Frame = 2
Query: 1514 NNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNV--TQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQSLSEID---------NLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            N+  D  + + +  +FR YKR YY+SK+G+ +  +  +        A+QWI  YY+ GV SWSW+YP HYAP++SDI N+S+ LK   + F +G+PF+PFEQL+AVLPA S +LLP  Y +LM   +SPIID+YP+ F+TDLNGK++EWEAVVLIPFI+EKRLLEAM S    ++  + +RN H   IK+ +          +P   + P           + LD                     C GFPT +H++H + ++KAGV++F+ S+ G +++L I  +    T +++ +A   + +  FVNWP   E +V+ V +   ++ L E+    KL    S+             N+ + E +   S +  RR  + I+ T  ++   + + G+ Y++         V L+  WS     +  Q    + + I  F S S   Y  L +LF   ++VF L   YYG  G V+  ++  S   I+++L    EP    ++ N H  SI  +Y      +    +N    SR TG+I+I      + S++N   +  + ++GL+LK NK N ++PG+  +V  E     W YS     ++ EY  RFPE+F ++ K + E +  +D    D+ P       +K+ E+  +L + P   L R S D QI++ + +  IE+ ++  +  S      RV +    L+ P    HGV PD  A+F+L DRVV + + ++VPLGL+G VIGI+  + D  + LEVLFD  F   ++IR S+ + YR+P   LIN+S G R
Sbjct:  409 NSEYDENEDDLFETEFRQYKRTYYMSKMGVEVVSDCFM--------AIQWILHYYYHGVQSWSWYYPYHYAPYLSDICNISH-LK---LTFNLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYWYEKE-TDFKYFSPWPEKFPSVDRCHARYKLISLDAWLVDVTDNKITKVDKSALYFC-GFPTLKHIKHKYSMKKAGVQVFQQSSRGENMILEIETEGDEDTLNVDTVASAVLGKSVFVNWPHLEEARVVTVTDGDMKFYLEERPGTQKLYTGNSVPPTKVAYVGDKERNIWVKEIQGI-SEHYHRRKGVVINETAVVLYAQLLT-GRRYQLGH----NGEVHLEKQWSKQVLPFVYQ---AVVQDITTFESGSSH-YKTLGELFSPESSVFMLGAPYYGCIGEVQESSDVLSENRIRVLLTIPCEPQLDALIQNQHKFSI--KYNPGYVLASRLGVNGYLVSRFTGSIFIG-----RGSKKNPHGE-QKSNVGLNLKFNKKNEEVPGYTKRVGTE-----WTYSSAAEVLLSEYIERFPELFLYVSKKSQEDVFYED----DIWPGENENGAEKVQEIVSWLKSHPVNMLSRSSCDLQILDAAIVEKIEEEVEKCK--SKKNSKVRVTVKPHLLFKPLEQQHGVVPDPDAEFRLYDRVVNVRENFSVPLGLRGTVIGIKGAERDADVLLEVLFDEVFPGGLTIRCSQFKGYRLPTSALINLSHGNR 1161          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 377.481 bits (968), Expect = 1.232e-133
Identity = 178/267 (66.67%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTF-SKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV + LSGHETPGEGEHKI EFIR +++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KK  +R    EET F LLHLSL+REYIDYEF++L+
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRITEDKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGEVLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVAIYLSGHETPGEGEHKIMEFIRSQKTKPDHDPNTRHCLYGLDADLIMLGLTSHEVHFSLLREEVRFGGKKNQKRVTAPEETTFHLLHLSLMREYIDYEFSSLK 267          

HSP 2 Score: 122.479 bits (306), Expect = 1.232e-133
Identity = 55/103 (53.40%), Postives = 74/103 (71.84%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  EY +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI+V P + GYIN  G L+L NF KY++ LS FDR +F + + D++W   K G +
Sbjct:  267 KNKISFEYDVERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYISVLPTIGGYINENGYLNLYNFGKYLEKLSDFDREHFNEIFVDLKWFESKVGNK 369          

HSP 3 Score: 389.037 bits (998), Expect = 1.821e-111
Identity = 260/782 (33.25%), Postives = 406/782 (51.92%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNV--TQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQSLSEID---------NLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +FR YKR YY+SK+G+ +  +  +  A  YV A+QWI  YY+ GV SWSW+YP HYAP++SDI N+S+ LK   + F +G+PF+PFEQL+AVLPA S +LLP  Y +LM   +SPIID+YP+ F+TDLNGK++EWEAVVLIPFI+EKRLLEAM S    ++  + +RN H   IK+ +          +P   + P           + LD                     C GFPT +H++H + ++KAGV++F+ S+ G +++L I  +    T +++ +A   + +  FVNWP   E +V+ V +   ++ L E+    KL    S+             N+ + E +  + +       + I+ T  ++   + + G+ Y++         V L+  WS     +  Q    + + I  F S S   Y  L +LF   ++VF L   YYG  G V+  ++  S   I+++L    EP    ++ N H  SI  +Y      +    +N    SR TG+I+I      + S++N   +  + ++GL+LK NK N ++PG+  +V  E     W YS     ++ EY  RFPE+F ++ K + E +  +D    D+ P       +K+ E+  +L + P   L R S D QI++ + +                 + C+V         P    HGV PD  A+F+L DRVV + + ++VPLGL+G VIGI+  + D  + LEVLFD  F   ++IR S+ + YR+P   LIN+S G R
Sbjct:  428 EFRQYKRTYYMSKMGVEVVSDCFM--AKCYVQAIQWILHYYYHGVQSWSWYYPYHYAPYLSDICNISH-LK---LTFNLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYWYEKE-TDFKYFSPWPEKFPSVDRCHARYKLISLDAWLVDVTDNKITKVDKSALYFC-GFPTLKHIKHKYSMKKAGVQVFQQSSRGENMILEIETEGDEDTLNVDTVASAVLGKSVFVNWPHLEEARVVTVTDGDMKFYLEERPGTQKLYTGNSVPPTKVAYVGDKERNIWVKEIQGISEQETCPSLGVVINETAVVLYAQLLT-GRRYQLGH----NGEVHLEKQWSKQVLPFVYQ---AVVQDITTFESGSSH-YKTLGELFSPESSVFMLGAPYYGCIGEVQESSDVLSENRIRVLLTIPCEPQLDALIQNQHKFSI--KYNPGYVLASRLGVNGYLVSRFTGSIFIG-----RGSKKNPHGE-QKSNVGLNLKFNKKNEEVPGYTKRVGTE-----WTYSSAAEVLLSEYIERFPELFLYVSKKSQEDVFYED----DIWPGENENGAEKVQEIVSWLKSHPVNMLSRSSCDLQILDAAIVEK----------IEEEVEKCKVGNLVLSYCQPLEQQHGVVPDPDAEFRLYDRVVNVRENFSVPLGLRGTVIGIKGAERDADVLLEVLFDEVFPGGLTIRCSQFKGYRLPTSALINLSHGNR 1165          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 386.726 bits (992), Expect = 1.568e-135
Identity = 180/267 (67.42%), Postives = 215/267 (80.52%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+AL+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKE 267          

HSP 2 Score: 119.013 bits (297), Expect = 1.568e-135
Identity = 52/103 (50.49%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +E+IIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI + PEL GYIN  G L+L  F +Y+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIEKIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 419.853 bits (1078), Expect = 5.248e-121
Identity = 291/822 (35.40%), Postives = 438/822 (53.28%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETF--------RIPMSSI-----------VPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRIT----PQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE-----KSKLIVKQSLSEIDNLRMAEFKSCT------SRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSI--DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE      N  ++  D + +  +FR YKR YY++K+G+++ +DE L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI ++S  LK   I F++G+PF PFEQL+AVLP+ S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+E RLLEAME+    +   + +RN H   +   +  ++    S   PE F        R  M S+           +  +  K L    C GFPT +H++H F L+K+GV++F+ S+ G +++L I+    P  +   +E+IA   + +  FVNWP   E +V+AV +   ++ + E     K  L      S++  L   E  + T      S    RR  I I+ T+ ++   + + G+ Y+I         V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP    VF L   YYG  G V+   +  +   I++V     EP    ++ N H  SI  +  Y+ AG+      ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV      N+W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D  I++ + +  IE+ ++  +   SN+K  RV +    LY P    HGV PD+ A+F+L DRVV + + ++VP+GL+G VIGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLSWAALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSIST-LK---IHFELGKPFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFTYSSPWPEKFPAIERCCTRYKMISLDAWRVDINKNKITRVDQKALY--FC-GFPTLKHIKHKFFLKKSGVQVFQQSSRGENLMLEISVNAEPDEL--RIENIASAVLGKAVFVNWPHLEEARVVAVSDGETKFYIEEPPGTQKVYLGKTAPPSKVIQLTDKEQSNWTKEIQGISEQYLRRKGIIINETSAVVYAQLLT-GRKYQISQ----NGEVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPPRTMVFMLGTPYYGCTGEVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLG----VSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVG-----NEWMYSSAAEQLLAEYIERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLHILDAAIVEKIEEEVEKCKQRKSNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFRLFDRVVNVRESFSVPVGLRGTVIGIKGASREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 386.726 bits (992), Expect = 1.705e-135
Identity = 180/267 (67.42%), Postives = 215/267 (80.52%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+AL+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKE 267          

HSP 2 Score: 119.013 bits (297), Expect = 1.705e-135
Identity = 52/103 (50.49%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +E+IIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI + PEL GYIN  G L+L  F +Y+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIEKIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 419.853 bits (1078), Expect = 5.637e-121
Identity = 291/822 (35.40%), Postives = 438/822 (53.28%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETF--------RIPMSSI-----------VPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRIT----PQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE-----KSKLIVKQSLSEIDNLRMAEFKSCT------SRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSI--DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE      N  ++  D + +  +FR YKR YY++K+G+++ +DE L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI ++S  LK   I F++G+PF PFEQL+AVLP+ S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+E RLLEAME+    +   + +RN H   +   +  ++    S   PE F        R  M S+           +  +  K L    C GFPT +H++H F L+K+GV++F+ S+ G +++L I+    P  +   +E+IA   + +  FVNWP   E +V+AV +   ++ + E     K  L      S++  L   E  + T      S    RR  I I+ T+ ++   + + G+ Y+I         V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP    VF L   YYG  G V+   +  +   I++V     EP    ++ N H  SI  +  Y+ AG+      ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV      N+W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D  I++ + +  IE+ ++  +   SN+K  RV +    LY P    HGV PD+ A+F+L DRVV + + ++VP+GL+G VIGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLSWAALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSIST-LK---IHFELGKPFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFTYSSPWPEKFPAIERCCTRYKMISLDAWRVDINKNKITRVDQKALY--FC-GFPTLKHIKHKFFLKKSGVQVFQQSSRGENLMLEISVNAEPDEL--RIENIASAVLGKAVFVNWPHLEEARVVAVSDGETKFYIEEPPGTQKVYLGKTAPPSKVIQLTDKEQSNWTKEIQGISEQYLRRKGIIINETSAVVYAQLLT-GRKYQISQ----NGEVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPPRTMVFMLGTPYYGCTGEVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLG----VSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVG-----NEWMYSSAAEQLLAEYIERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLHILDAAIVEKIEEEVEKCKQRKSNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFRLFDRVVNVRESFSVPVGLRGTVIGIKGASREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 384.03 bits (985), Expect = 2.550e-134
Identity = 180/267 (67.42%), Postives = 215/267 (80.52%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+AL+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKE 267          

HSP 2 Score: 117.472 bits (293), Expect = 2.550e-134
Identity = 52/103 (50.49%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +E+IIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI + PEL GYIN  G L+L  F +Y+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIEKIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 216.853 bits (551), Expect = 4.666e-57
Identity = 107/206 (51.94%), Postives = 142/206 (68.93%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVH 2065
            EN L      K +GE      N  ++  D + +  +FR YKR YY++K+G+++ +DE L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI ++S  LK   I F++G+PF PFEQL+AVLP+ S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+E RLLEAME+    +   + +RN H
Sbjct:  394 ENSLSWAALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSIST-LK---IHFELGKPFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQH 595          

HSP 4 Score: 94.7449 bits (234), Expect = 6.512e-19
Identity = 89/306 (29.08%), Postives = 142/306 (46.41%), Query Frame = 2
Query: 2522 SRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSI--DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINES 3394
            S    RR  I I+ T+ ++   + + G+ Y+I         V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP    VF L   YYG  G V+   +  +   I++V     EP    ++ N H  SI  +  Y+ AG+      ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV      N+W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D  I++ +
Sbjct:  670 SEQYLRRKGIIINETSAVVYAQLLT-GRKYQISQ----NGEVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPPRTMVFMLGTPYYGCTGEVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLG----VSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVG-----NEWMYSSAAEQLLAEYIERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLHILDAA 947          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Match: Xrn2 (5'-3' exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:894687])

HSP 1 Score: 243.817 bits (621), Expect = 2.213e-75
Identity = 134/319 (42.01%), Postives = 190/319 (59.56%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV--------DNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSK-----------------------KKTRRAYIAE-----ETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP + V+         +  +IP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ + ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + VILS    PGEGEHKI ++IR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE   +K                       KK +   +A+     E +F  L L++LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCALCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGEFIFLRLNVLREYLEREL 317          

HSP 2 Score: 61.6178 bits (148), Expect = 2.213e-75
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHL 1033
            +L   + +ER IDDW+ M F +GNDF+PHLP+L I   A+  L   Y NV  +  GY+   G ++L
Sbjct:  321 SLPFPFDVERSIDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVNIYKNVVHKTGGYLTESGYVNL 386          

HSP 3 Score: 146.747 bits (369), Expect = 6.600e-35
Identity = 73/174 (41.95%), Postives = 102/174 (58.62%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIG-RPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  ++  DE   ++    YV  L W+  YY+ G  SW W+YP HYAPF SD   +++   E    F+ G +PF P EQLM V PA S   LP  +  LM + +S IIDFYP+ F  DLNGKK  W+ V L+PF++E+RL  A+E     ++P + RRN  G  + F
Sbjct:  516 WKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMSSE----FEKGTKPFKPLEQLMGVFPAASGNFLPPTWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEENRRNSLGGDVLF 685          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 56.225 bits (134), Expect = 1.016e-9
Identity = 26/37 (70.27%), Postives = 31/37 (83.78%), Query Frame = 3
Query:  282 LAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSG 392
            +AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G
Sbjct:    1 MAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKG 37          
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|P22147|XRN1_YEAST (5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=XRN1 PE=1 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.970e-171
Identity = 146/265 (55.09%), Postives = 200/265 (75.47%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNAL 830
            MG+PKFFR+ISER+P +   ++  QIP+FD LYLDMN I+H C+H +D +V  R+ E ++F  +  YI+ LF+ +KPK +F++A+DGVAPRAKMNQQRARRF++A +A      AI++G EIP  + FDSN+ITPGTEFM +L K L  F+ +KI  DS W+ V +I SGHE PGEGEHKI  FIR+ +S  D+N NT+HC+YGLDADL++LGL++H P+F+LLREEVTF ++ + +  + E   F+LLHLSLLREY++ EF  +
Sbjct:    1 MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSILHNCTHGNDDDVTKRLTEEEVFAKICTYIDHLFQTIKPKKIFYMAIDGVAPRAKMNQQRARRFRTAMDAEKALKKAIENGDEIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKISNDSKWREVQIIFSGHEVPGEGEHKIMNFIRHLKSQKDFNQNTRHCIYGLDADLIMLGLSTHGPHFALLREEVTFGRRNSEKKSL-EHQNFYLLHLSLLREYMELEFKEI 264          

HSP 2 Score: 310.071 bits (793), Expect = 1.970e-171
Identity = 280/1010 (27.72%), Postives = 476/1010 (47.13%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFP--DSPEILVLSNNLE-QEESIFN---------EENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQ-ANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDIS-NLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRF---------SNSGLVISEI------APETFRIPM--SSIVPGLCPKVLLDV-ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRIT----PQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLL---NEKSKL-IVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEF---SEPILPNIHINSIDNQ---YMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF----SKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELS---FRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYR 3718
            EY+ ERI+DD+I++ F+IGNDF+P+LP+LH++  A P L +T+       DGYIN  GK++L     +++ LS F+  NF  +  D++W          K+L+N++ +            +         S+     + ++E     +  D+E P  + P+ L + ++LE  +E  F+          + S  ++M+  +I+ D  E +F+   N  I    KK    I     +      +K  +N +F  +K +YY  KL      E  V+  A +YV  LQW+ +YY+ G PSWSW+YP HYAP ISD++  L  D     I+F + +PF PF+QLMAVLP  S  L+P  +  LM +E SPI DFYP + + D NGK  +WEAVVLI F++EKRL+EAM+    ++SP +  RN  G  + + F         S  G + S+I        E   IP+  S I  GL P   L   +  GFPT   +  +  LE     +F+  +   S+VL+IT      NVT  +ED +KR++N++ +  WP   E K++++ +    Y     N+K K   + +     D       K+   R   ++ A+ I P    I       G + + D     G  +K    +S    ++ LQ   V++  ++       +    + + FP N+ V  L    YG +  ++   +S   +KI +++    SEP +    +  +D+Q   Y  +   S+   ++ L  S+IT    I  +T                ++G+ +K    + ++ G+        +   W+YS   + ++ EYR  FP+ F  + K   +   ++D+F    +KD +   +  ++++L  +  K +  +S +   + ++ I+ +E  +   +YA++ E   R +L+      +  P  S   +   +S  F L DRVV I D   VP+  KG V+G        L ++VLFD++  +  +  G   R  R
Sbjct:  271 EYNFERILDDFILVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKEALLHTDGYINEHGKINLKRLGVWLNYLSQFELLNFEKDDIDVEW--------FNKQLENISLEGERKRQRVGKKLLVKQQKKLIGSIKPWLMEQLQEKLSPDLP-DEEIPTLELPKDLDMKDHLEFLKEFAFDLGLFITHSKSKGSYSLKMDLDSINPDETEEEFQNRVNS-IRKTIKKYQNAIIV--EDKEELETEKTIYNERFERWKHEYYHDKLKFTTDSEEKVRDLAKDYVEGLQWVLYYYYRGCPSWSWYYPHHYAPRISDLAKGLDQD-----IEFDLSKPFTPFQQLMAVLPERSKNLIPPAFRPLMYDEQSPIHDFYPAEVQLDKNGKTADWEAVVLISFVDEKRLIEAMQPYLRKLSPEEKTRNQFGKDLIYSFNPQVDNLYKSPLGGIFSDIEHNHCVEKEYITIPLDSSEIRYGLLPNAKLGAEMLAGFPTLLSLPFTSSLEYNETMVFQQPSKQQSMVLQITDIYKTNNVT--LEDFSKRHLNKVIYTRWPYLRESKLVSLTDGKTIYEYQESNDKKKFGFITKPAETQDKKLFNSLKNSMLRMYAKQKAVKIGPME-AIATVFPVTGLVRDSD-----GGYIKT---FSPTPDYYPLQL--VVESVVNEDERYKERGPIPIEEEFPLNSKVIFLGDYAYGGETTIDGY-SSDRRLKITVEKKFLDSEPTIGKERL-QMDHQAVKYYPSYIVSKNMHLHPLFLSKITSKFMITDAT------------GKHINVGIPVKFEARHQKVLGY-----ARRNPRGWEYSNLTLNLLKEYRQTFPDFFFRLSKVGNDIPVLEDLFPDTSTKDAM-NLLDGIKQWLKYVSSKFIA-VSLESDSLTKTSIAAVEDHI--MKYAANIEGHERKQLAKVPREAVLNPRSSFALL---RSQKFDLGDRVVYIQDSGKVPIFSKGTVVGYTTLS-SSLSIQVLFDHEIVAGNNF-GGRLRTNR 1222          
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|P97789|XRN1_MOUSE (5'-3' exoribonuclease 1 OS=Mus musculus OX=10090 GN=Xrn1 PE=1 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 9.831e-135
Identity = 180/267 (67.42%), Postives = 215/267 (80.52%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+AL+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKE 267          

HSP 2 Score: 119.013 bits (297), Expect = 9.831e-135
Identity = 52/103 (50.49%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +E+IIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI + PEL GYIN  G L+L  F +Y+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIEKIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 419.083 bits (1076), Expect = 6.975e-120
Identity = 290/822 (35.28%), Postives = 438/822 (53.28%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETF--------RIPMSSI-----------VPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRIT----PQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE-----KSKLIVKQSLSEIDNLRMAEFKSCT------SRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEP----ILPNIHINSI--DNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE      N  ++  D + +  +FR YKR YY++K+G+++ +DE L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI ++S  LK   I F++G+PF PFEQL+AVLP+ S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+E RLLEAME+    +   + +RN H   +   +  ++    S   PE F        R  M S+           +  +  K L    C GFPT +H++H F L+K+GV++F+ S+ G +++L I+    P  +   +E+IA   + +  FVNWP   E +V+AV +   ++ + E     K  L      S++  L   E  + T      S    RR  I I+ T+ ++   + + G+ Y+I         V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP    VF L   YYG  G V+   +  +   I++V     EP    ++ N H  SI  +  Y+ AG+      ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV      N+W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D  I++ + +  IE+ ++  +   SN+K  RV +    +Y P    HGV PD+ A+F+L DRVV + + ++VP+GL+G VIGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLSWAALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSIST-LK---IHFELGKPFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFTYSSPWPEKFPAIERCCTRYKMISLDAWRVDINKNKITRVDQKALY--FC-GFPTLKHIKHKFFLKKSGVQVFQQSSRGENLMLEISVNAEPDEL--RIENIASAVLGKAVFVNWPHLEEARVVAVSDGETKFYIEEPPGTQKVYLGKTAPPSKVIQLTDKEQSNWTKEIQGISEQYLRRKGIIINETSAVVYAQLLT-GRKYQISQ----NGEVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPPRTMVFMLGTPYYGCTGEVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLG----VSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVG-----NEWMYSSAAEQLLAEYIERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLHILDAAIVEKIEEEVEKCKQRKSNKK-VRVTVKPHLMYRPLEQQHGVIPDRDAEFRLFDRVVNVRESFSVPVGLRGTVIGIKGASREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q8IZH2|XRN1_HUMAN (5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.606e-134
Identity = 179/267 (67.04%), Postives = 214/267 (80.15%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI++  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E RFDSN ITPGTEFM RL + L  F+  KI TD  WQGV +  SGHETPGEGEHKI EFIR  ++ PD++PNT+HCLYGLDADL++LGL SHE +FSLLREEV F  KKT+R    EET F LLHLSL+REYIDYEF+ L+E
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKE 267          

HSP 2 Score: 120.939 bits (302), Expect = 1.606e-134
Identity = 53/103 (51.46%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  +  +Y +ERIIDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TY+ + PEL GYIN  G L+L  F KY+  LS FDR +F + + D++W   K G +
Sbjct:  266 KEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNK 368          

HSP 3 Score: 422.165 bits (1084), Expect = 4.854e-121
Identity = 285/823 (34.63%), Postives = 440/823 (53.46%), Query Frame = 2
Query: 1451 ENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFS-NSGLVISEIAPETFRIPMSSIVPGLCPK---VLLDV-------------------ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRI--TPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNE---KSKLIVKQS--------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQ------ASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            EN L      K +GE+ T   N  ++  D + +  +FR YKR YY++K+G+++ +D+ L  QA  YV A+QWI  YY+ GV SWSW+YP HYAPF+SDI N+S  LK   I F++G+PF PFEQL+AVLPA S  LLP CY  LM  E+SPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLLEAME+    +   + +RN H   +   +  ++  +     PE F       +   C +   + LD                     C GFPT +H+ H F L+K+GV++F+ S+ G +++L I    ++   ++E++A   + +  FVNWP   E +V+AV +   ++ L E     KL   ++        L + +    A+     S +  RR  I I+ T+ ++   + + G+ Y+I+        V+L+  WS     +  Q +    R+ D+  SN IK    L  LFP  + VF L   YYG  G V+   +  +   I+++   FS P  PN+    I NQ+ ++ +       +    ++    SR TG+I+I      + SRRN      + ++GL+LK NK N ++PG+  KV  E     W YS    +++ EY  R PE+F +I K + E +  +D    D+ P       +K+ E+  +L   P   L R S D QI++ + +  IE+ ++  +   +N+K  RV +    LY P    HGV PD+ A+F L DRVV + + ++VP+GL+G +IGI+    +  +  EVLFD +F   ++IR S  R YR+P   L+N+S G R
Sbjct:  394 ENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIHNIST-LK---IHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKF-----PAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFC-GFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQLLT-GRKYQINQ----NGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSN-IKT---LDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVI---FSIPCEPNLDA-LIQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIG-----RGSRRNPHGD-HKANVGLNLKFNKKNEEVPGYTKKVGSE-----WMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYED----DIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKK-VRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSR 1177          
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q5AMG5|XRN2_CANAL (5'-3' exoribonuclease 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAT1 PE=3 SV=4)

HSP 1 Score: 244.202 bits (622), Expect = 7.332e-115
Identity = 134/304 (44.08%), Postives = 184/304 (60.53%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV--------------DNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPD--------------EKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKK------------TRRAYIAEETK--FFLLHLSLLREYIDYEF 821
            MGVP  FRW+S +YP +   V              + N   + D LYLDMNGI+H CSHP+         E ++F ++F Y + +  + +P+ V  +AVDGVAPRAKMNQQRARRF++AK+A   E+ A Q  IE+ +              +K++DSNAITPGT FMDRL +AL  ++  K+ +D  W  + VI+S    PGEGEHK+  FIR +RS P Y+PNTKHC+YGLDADL+ LGLA+HEP+F +LRE+V  S+ K            +    +A+E K  F  LH+++LREY+  E 
Sbjct:    1 MGVPALFRWLSRKYPKIISPVVEEEDHEIGGAKYENPNPNGEIDNLYLDMNGIVHPCSHPEHKKPP--ETEDEMFLDIFKYTDRVLMMARPRKVLMIAVDGVAPRAKMNQQRARRFRAAKDA---ELKAKQLEIEVQERELRGEIINDAIKGKKQWDSNAITPGTPFMDRLAEALRYWVAYKLSSDPGWANLQVIISDATVPGEGEHKLMSFIRSQRSDPQYDPNTKHCIYGLDADLIFLGLATHEPHFRVLREDVFASQDKKFTIKDQIADANSNGDTVAKEDKKPFLWLHVNVLREYLQVEL 299          

HSP 2 Score: 195.282 bits (495), Expect = 7.332e-115
Identity = 129/425 (30.35%), Postives = 210/425 (49.41%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWM--------LGKTGERLGKEL------DNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEE--NENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANE----YVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVH 2065
            + LER IDDW+ + F  GNDF+PHLP+L +  + +  L + +    P L  Y+   GKL+L +    +  L+  +   F + +   Q          L +  ER  K +         +K   +A+ N   +D S  N+   ++L +        +  R I       +S     L   ++ +++        +    S N +    E + EE  ++N L     +K++ E      +    + D + W      Y + YY +K     +DE + Q   +    YV  + W++ YY+ G PSW+W++P HYAPF +D +NL  +L   G+ F++G PF PFEQLM+VLPA S   LP  +  LM   +S IIDFYP++F  D+NGKK  W+ + L+PFI+EKRLL+A++ K   ++P +  RN +
Sbjct:  308 FELERAIDDWVFLCFFAGNDFLPHLPSLDVRDNGIDTLVQCWKRSLPILKDYVTCDGKLNLKSVEVLMSNLAYKESEIFKNKHAAEQRREENNKRRKLAQEQERALKRVYSSQVSKGKDKAPLTADVNMPLMDTSGQNVEGYANLTNSDI-----VQNRAILTKANLANSDAAAELKKLIDSKKTQVTVVQDQIATDSSANSETTTSESELEEIQSDNSL----KRKLEPE-----EDKQTQSDDIKLWEP---GYNKRYYEAKFHCQ-SDEEIEQTKRDVVRHYVEGIAWVALYYYQGCPSWNWYFPYHYAPFAADFTNLE-ELFPEGVKFKLGEPFRPFEQLMSVLPAASGHTLPQVFRDLMSNPDSEIIDFYPEEFEIDMNGKKMSWQGIPLLPFIDEKRLLDAVQKKYELLTPDEKSRNTN 713          
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q2GNZ6|XRN2_CHAGB (5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=RAT1 PE=3 SV=3)

HSP 1 Score: 232.261 bits (591), Expect = 9.103e-114
Identity = 133/327 (40.67%), Postives = 183/327 (55.96%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV---------DNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAV-DGVAPRAKMNQQRARRFKSAKEAINRE---------------IAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYI---------------------------AEETK-FFLLHLSLLREYIDYEFN 824
            MG+P  FRW+S +YP +   V         D   +P           +FD LYLDMNGI+H CSHP+D       +E ++   VF Y E +  +V+P+ +  +AV DGVAPRAKMNQQR+RRF++A++A  +E                 A +  IE   +K FDSN+ITPGT FMD L  +L  +   K+ TD  W  + VI+S    PGEGEHKI EF+R +R+ P+++PNT+H +YGLDADL++LGLA+HEP+F +LRE+V F + K R   +                           AE  K F  LH+S+LREY+  E N
Sbjct:    1 MGIPAAFRWLSTKYPKIISPVVEEKALVMEDGTVVPVDATQPNPNGEEFDNLYLDMNGIVHPCSHPEDRPAPS--DEEEMMVEVFKYTERVVNMVRPRKLLMIAVADGVAPRAKMNQQRSRRFRAAQDAKEKEEDKQQLLKMLQKEKGSTAKEEPIETVVKKAFDSNSITPGTPFMDILAASLRYWCAYKLNTDPAWAKMKVIISDATVPGEGEHKIMEFVRSQRNSPEHDPNTRHVIYGLDADLIMLGLATHEPHFRVLREDVFFQQGKARMCKLCGQKGHDERNCRGEAKEKAGEFDEKDKAEPLKPFIWLHVSILREYLAIELN 325          

HSP 2 Score: 203.371 bits (516), Expect = 9.103e-114
Identity = 135/426 (31.69%), Postives = 196/426 (46.01%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDAL-----SIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEES---IFNEENSLVVQMESMNIDKDLIEFDFE-----------ENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQ-ANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 2068
            + LER IDDW+ M F +GNDF+PHLP L I  + +  L   + +  P + GY+   G + L+     +  L     SIF R    ++  +  +   K   + G      +    S    +     +      +   V      +  I K +I  D        ++V   N+  + +   + ++  SLV Q +      +  E + E           + E I  G  T       T  P   +++ G  +   L    Y   YY  K  ++  D A   + A  YV  L W+  YYF G PSW WFYP HYAPF +D      DL +  I F+ GR   PFEQLM+VLPA S   +P  +H LM +E+SPI+DFYP+ F  DLNGKK  W+ + L+PFIE  RLL+AM++K   +S  D  RN  G
Sbjct:  333 WDLERAIDDWVFMCFFVGNDFLPHLPALEIRENGIETLMAIWKDNLPVMGGYVTKDGHVDLDRAQYILSGLAKQEDSIFRRRKETEDRREAGFKRRKLNNQQGNNRGGAHDSPLSGRGGRKGAPEA------NGPPVGMNLFPVASIPKPVITHD--------MVVNRANVANKSAASVLKSQIQSLVAQTQEKPEGDEPKEENPEAKTPPSALGKRKAELIEEGTATASDAASDTETPATTSSEEGPIDTVRLWEEGYADRYYEQKFKVDAKDIAFRHKVARAYVEGLAWVLMYYFQGCPSWEWFYPYHYAPFAADFV----DLGKMKISFEKGRISRPFEQLMSVLPAASRHAIPEVFHDLMTQEDSPILDFYPEDFEIDLNGKKMSWQGIALLPFIEMPRLLDAMKTKSHLLSAEDKARNAPG 740          
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Match: A0A2J7QVF6 (5'-3' exoribonuclease 1 OS=Cryptotermes secundus OX=105785 GN=B7P43_G00347 PE=4 SV=1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 346/1019 (33.95%), Postives = 530/1019 (52.01%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEF--DFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLN-LTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETF------------------RIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQ-SLSEIDNLRMAEF---KSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVV--ESINNSSASIKIVLDEFSEPILPNIHINSIDN--QYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCS----MGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLPQK-------ITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            K TL   + +E+IIDDW++M FL+GNDF+P LP++HI   ALP L+E YI+V P L GY+N  G L+L  F KY++ LS FD   F + Y D+++  GKTG RLG      +K++HS  N  S          ++  L++  + +    TK ++N D        +  L    EQE  +   E   V   +  +  +D  E+  D E N N L                            ++L+FR +K+DYY++KL  + + ++ L  QA+ YV A+QW   YY+ GV SWSWFYP HYAP+ISDI N S  L    + F IG PFLPF+QL+AVLPA S +LLP  Y  LM EE+SPI  FYP +F+TDLNGKK+EWEA+VLIPFI+E+ LL+AM     Q++  + +RN HGP + + ++ + L + E AP+ F                   +  S +V GLCP V LDV   GFPT +H+ H+  L+K+ VK+FE ++ GS+++LRI  Q+   ++ D+A   +    +V WP  +E KV+AV N+  RY L E S L   + ++ E+     A++   +     +   R  + I  T+ ++  T    G+ Y    I      + ++  W    T + L Q +V   ++ +    +   Y  L ++FP  +  F L   +YG  G V   S +  S  +K+ +   +EP L ++     D+   YM    A++   ++S   SR+TGTIYI            D+N  ++      +GL+LK NK N +IPG+  K         WQYS K + +V  Y ++FPE+F+++      K T +D+F   DV P         +T + E+L   PY  +ER     +I+    +  +E+ +          K+  +++    LY P      + PD SA+ QL DR+V +   YTVPLGLKG +IGI + +++  L  +V+FD  F   + +  S  R YR+    ++N+S+G R
Sbjct:  267 KTTLPFPFDIEKIIDDWVLMGFLVGNDFIPPLPDMHIINGALPTLYEAYIDVLPTLGGYVNEGGTLNLERFKKYMERLSAFDFEQFRETYADLKYFQGKTGRRLG------SKERHSYRNTGSK---------ENGELIEENSST----TKPVMNAD--------LKALIQITEQELQV---ELGFVSDEDEDDDTEDWEEYESDEEANANAL----------------------------FHLEFRQHKKDYYMNKLEYDTVNNDVLRSQADGYVRAIQWNLHYYYNGVCSWSWFYPHHYAPYISDICNFSETLD---LSFDIGEPFLPFQQLLAVLPAASKKLLPLPYQQLMDEEDSPIFHFYPSEFKTDLNGKKQEWEAIVLIPFIDEESLLKAMAPCDKQLTEEECKRNSHGPMLIYTYTENDLGLYE-APQFFPPLKNNHAAVCKKTRDEINVDRSRLVKGLCPNVRLDVYFPGFPTLKHIPHTASLQKSKVKVFEQASQGSNMILRILDQS-KANIRDVATELLGRSIYVGWPHLVEAKVVAVSNKEFRYGLQEDSGLKPPRLNVEELKGPCAAQWMLQQKGIQEHYANRMGVDIGKTDILVHATA-MIGRKY----IFGQTGKITMEKQWCDVLTAYAL-QTTVKDIAVHD---KTFVQYRTLQEVFPLKSVCFMLGHPHYGAMGEVVDGSTSVKSGRVKVSMSVTTEPNLDSVRRKYHDSNIHYMPGNMAAQRLGVSSHLVSRVTGTIYI---------VSGDKNAVTESGNKVNVGLNLKFNKHNEEIPGYTRK-----EGTVWQYSYKAVNLVQNYMLQFPELFDYLA-----KHTGNDIFYESDVFPTANKKGVNHLTAITEWLKKQPYTKVERHVCGSKILEAELVQAVEKEVDDFLQHGCRGKTVIMQVKPHLLYRPELQGGNIPPDPSANHQLFDRIVNVRGSYTVPLGLKGTIIGIHRTEIETELMYDVVFDKPFPGGLPLNCSANRGYRLSRPAILNLSYGQR 1194          

HSP 2 Score: 371.703 bits (953), Expect = 0.000e+0
Identity = 173/267 (64.79%), Postives = 211/267 (79.03%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKK-KTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFRWISERYPCLS  +   Q+P+FD LYLDMNGIIH CSHP+D +  FRI E  I  ++F+YIE LF++++P+ +FF+AVDGVAPRAKMNQQR RRF+SAKEA   E  A + G  +P E RFDSN ITPGTEFM +L + L  F+  K+ TD+LWQ V VILSGHETPGEGEHKI ++IRY +S PDY+ NT+HCLYGLDADL++LGL SHEP+FSLLREEV + +K K +R    EETKFFLLHLSL+REY++ EF  L+
Sbjct:    1 MGVPKFFRWISERYPCLSEVIKEYQVPEFDNLYLDMNGIIHTCSHPNDFDPHFRITEEKILKDIFHYIEVLFRMIRPQKLFFMAVDGVAPRAKMNQQRGRRFRSAKEAEILEQKARERGEALPSEARFDSNCITPGTEFMAQLHEQLKYFVTYKVSTDTLWQNVKVILSGHETPGEGEHKIMDYIRYMKSQPDYDQNTRHCLYGLDADLIMLGLCSHEPHFSLLREEVKYGRKAKQQRTSTPEETKFFLLHLSLMREYLELEFEVLK 267          
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Match: A0A2J7QVG1 (5'-3' exoribonuclease 1 OS=Cryptotermes secundus OX=105785 GN=B7P43_G00347 PE=3 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 346/1019 (33.95%), Postives = 530/1019 (52.01%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEF--DFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLN-LTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETF------------------RIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQ-SLSEIDNLRMAEF---KSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVV--ESINNSSASIKIVLDEFSEPILPNIHINSIDN--QYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCS----MGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLPQK-------ITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            K TL   + +E+IIDDW++M FL+GNDF+P LP++HI   ALP L+E YI+V P L GY+N  G L+L  F KY++ LS FD   F + Y D+++  GKTG RLG      +K++HS  N  S          ++  L++  + +    TK ++N D        +  L    EQE  +   E   V   +  +  +D  E+  D E N N L                            ++L+FR +K+DYY++KL  + + ++ L  QA+ YV A+QW   YY+ GV SWSWFYP HYAP+ISDI N S  L    + F IG PFLPF+QL+AVLPA S +LLP  Y  LM EE+SPI  FYP +F+TDLNGKK+EWEA+VLIPFI+E+ LL+AM     Q++  + +RN HGP + + ++ + L + E AP+ F                   +  S +V GLCP V LDV   GFPT +H+ H+  L+K+ VK+FE ++ GS+++LRI  Q+   ++ D+A   +    +V WP  +E KV+AV N+  RY L E S L   + ++ E+     A++   +     +   R  + I  T+ ++  T    G+ Y    I      + ++  W    T + L Q +V   ++ +    +   Y  L ++FP  +  F L   +YG  G V   S +  S  +K+ +   +EP L ++     D+   YM    A++   ++S   SR+TGTIYI            D+N  ++      +GL+LK NK N +IPG+  K         WQYS K + +V  Y ++FPE+F+++      K T +D+F   DV P         +T + E+L   PY  +ER     +I+    +  +E+ +          K+  +++    LY P      + PD SA+ QL DR+V +   YTVPLGLKG +IGI + +++  L  +V+FD  F   + +  S  R YR+    ++N+S+G R
Sbjct:  267 KTTLPFPFDIEKIIDDWVLMGFLVGNDFIPPLPDMHIINGALPTLYEAYIDVLPTLGGYVNEGGTLNLERFKKYMERLSAFDFEQFRETYADLKYFQGKTGRRLG------SKERHSYRNTGSK---------ENGELIEENSST----TKPVMNAD--------LKALIQITEQELQV---ELGFVSDEDEDDDTEDWEEYESDEEANANAL----------------------------FHLEFRQHKKDYYMNKLEYDTVNNDVLRSQADGYVRAIQWNLHYYYNGVCSWSWFYPHHYAPYISDICNFSETLD---LSFDIGEPFLPFQQLLAVLPAASKKLLPLPYQQLMDEEDSPIFHFYPSEFKTDLNGKKQEWEAIVLIPFIDEESLLKAMAPCDKQLTEEECKRNSHGPMLIYTYTENDLGLYE-APQFFPPLKNNHAAVCKKTRDEINVDRSRLVKGLCPNVRLDVYFPGFPTLKHIPHTASLQKSKVKVFEQASQGSNMILRILDQS-KANIRDVATELLGRSIYVGWPHLVEAKVVAVSNKEFRYGLQEDSGLKPPRLNVEELKGPCAAQWMLQQKGIQEHYANRMGVDIGKTDILVHATA-MIGRKY----IFGQTGKITMEKQWCDVLTAYAL-QTTVKDIAVHD---KTFVQYRTLQEVFPLKSVCFMLGHPHYGAMGEVVDGSTSVKSGRVKVSMSVTTEPNLDSVRRKYHDSNIHYMPGNMAAQRLGVSSHLVSRVTGTIYI---------VSGDKNAVTESGNKVNVGLNLKFNKHNEEIPGYTRK-----EGTVWQYSYKAVNLVQNYMLQFPELFDYLA-----KHTGNDIFYESDVFPTANKKGVNHLTAITEWLKKQPYTKVERHVCGSKILEAELVQAVEKEVDDFLQHGCRGKTVIMQVKPHLLYRPELQGGNIPPDPSANHQLFDRIVNVRGSYTVPLGLKGTIIGIHRTEIETELMYDVVFDKPFPGGLPLNCSANRGYRLSRPAILNLSYGQR 1194          

HSP 2 Score: 371.318 bits (952), Expect = 0.000e+0
Identity = 173/267 (64.79%), Postives = 211/267 (79.03%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKK-KTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFRWISERYPCLS  +   Q+P+FD LYLDMNGIIH CSHP+D +  FRI E  I  ++F+YIE LF++++P+ +FF+AVDGVAPRAKMNQQR RRF+SAKEA   E  A + G  +P E RFDSN ITPGTEFM +L + L  F+  K+ TD+LWQ V VILSGHETPGEGEHKI ++IRY +S PDY+ NT+HCLYGLDADL++LGL SHEP+FSLLREEV + +K K +R    EETKFFLLHLSL+REY++ EF  L+
Sbjct:    1 MGVPKFFRWISERYPCLSEVIKEYQVPEFDNLYLDMNGIIHTCSHPNDFDPHFRITEEKILKDIFHYIEVLFRMIRPQKLFFMAVDGVAPRAKMNQQRGRRFRSAKEAEILEQKARERGEALPSEARFDSNCITPGTEFMAQLHEQLKYFVTYKVSTDTLWQNVKVILSGHETPGEGEHKIMDYIRYMKSQPDYDQNTRHCLYGLDADLIMLGLCSHEPHFSLLREEVKYGRKAKQQRTSTPEETKFFLLHLSLMREYLELEFEVLK 267          
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Match: A0A067RFP2 (5'-3' exoribonuclease 1 OS=Zootermopsis nevadensis OX=136037 GN=L798_05877 PE=4 SV=1)

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 345/1016 (33.96%), Postives = 521/1016 (51.28%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTD--SIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTD-EALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRF------------------SNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQ-SLSEIDNLRMAEFK---SCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNS--SASIKIVLDEFSEPILPNIHINSIDNQ---YMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            K  L   + +E++IDDW++M FL+GNDF+P LP++HI   ALP L++ Y++V P L GYIN  G L+L  F K+++ LS +D   F D Y D+++   KTG RLG      +K++HS  N  +  +  L     D++   R TD  ++ +IT++ +         PE+  LS + + +   + E  S                 D + + N L                            ++L+FR +K+DYY++KL  +  D + L  QA+ YV A+QW   YY+ GV SWSWFYP HYAP+ISDI N S +L+   ++F +G+PFLPF+QL+AVLP  S  LLP  Y  LM E+ SPI  FYP +F+TDLNGKK+EWEAVVLIPFI+E+ LLEAM   +  ++  + RRN HGP + +++                  SN  LV  +I  E   +  S +V GLCP V LDV   GFPT +H+ H+  L+K  VK+FE  + G++++L+I  Q     ++++A   +    +V WP  +E KV++V N+  RY L E S L   Q S+ E+     A++         +   R  + I  TN ++  T    G+ Y    ++     + +Q  W    T + LQ      R I       +K Y  L ++FP  +  F L    YG  G V     S  S  +K+ +    EP L  +     D+    YM    A++   ++S   SR+TGTIYI    +E K+   D  K  + ++GL+LK NK N +IPG+  K+        WQYS K + +V +Y  +FP +FE     +  K T +DVF   DVL          +T + ++L   PY  +ER     +I+    +  IE+ +   Q      K+  +++    LY P   +  + PD  A+ +L+DR+V I + YTVPLGLKG +IGI + + +  L  +VLFD  F   + +  S  R YR+    ++NIS G R
Sbjct:  267 KTMLSFPFDIEKVIDDWVLMGFLVGNDFIPPLPDMHIINGALPTLYKAYVDVLPTLGGYINEGGTLNLERFQKFMEKLSAYDFEQFRDTYADLKFFQAKTGRRLG------SKERHSYKNTGTKENEELFEEDVDAARPVRNTDVETLVQITEQELR--------PELGTLSEDEDDDVDDWEEYES-----------------DEDAHANAL----------------------------FHLEFRQHKKDYYMTKLEYDTVDSDVLRSQADGYVRAIQWNLHYYYNGVCSWSWFYPHHYAPYISDICNFSKNLE---LNFDMGKPFLPFQQLLAVLPTASKTLLPVPYQQLMSEKESPIFHFYPSEFKTDLNGKKQEWEAVVLIPFIDEESLLEAMAPCEDLLTKEERRRNSHGPMLIYKYTEEDLGQYAAPEYFPPLKSNHALVCKKIRDE-IHVDRSRLVRGLCPGVRLDVYFPGFPTLKHIPHTASLQKCKVKVFEQPSQGTNMILQIVDQG-KPDIKEVATELLGHTIYVGWPHLVEAKVVSVSNKEFRYGLQEDSALKPPQLSIEEVKGTSAAQWTLQLKGIQEHYANRMGVQIGQTNILVHATT-LIGRKY----VYGLTGKITIQKQWCDKPTAYALQ---TTVRDIAVHDRTFVK-YRSLQEMFPPKSVCFMLGHPLYGAMGEVIDGGTSVKSGRVKVSMSVTPEPNLDRVRKKHQDSNIYCYMPGNVAAQRLGVSSYLVSRVTGTIYI---IQEDKNASADSCK--KVNVGLNLKFNKRNEEIPGYTRKLGA-----VWQYSNKAVDLVQKYMEQFPVLFE-----HLAKHTGNDVFYESDVLSPVNEGGVSCLTAITDWLKEQPYTKIERQVCGSEIVEAELVQAIEKEVDEFQQHGCRVKTVVMQVKPHLLYKPELQVGNLAPDLLANHRLLDRIVNIRESYTVPLGLKGTIIGIHRTENEAELMYDVLFDKPFPGGLLLNCSTNRGYRLSQLAILNISHGQR 1194          

HSP 2 Score: 372.089 bits (954), Expect = 0.000e+0
Identity = 174/267 (65.17%), Postives = 213/267 (79.78%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKK-KTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFRWISERYPCLS  +   QIP+FD LYLDMNGIIH+CSHP+D +  FRI E  IF ++F+YIE LF++++P+ +FF+AVDGVAPRAKMNQQR RRF+SAKEA   E  A + G  +P + RFDSN ITPGTEFM RL + L  F+  K+ TD+LWQ V VILSGHETPGEGEHKI ++IRY +S P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV + +K K +R    EETKFFLLHLSL+REY++ EF  L+
Sbjct:    1 MGVPKFFRWISERYPCLSEVIREYQIPEFDNLYLDMNGIIHMCSHPNDFDPHFRITEEKIFKDIFHYIEVLFRMIQPQRLFFMAVDGVAPRAKMNQQRGRRFRSAKEAEILEKKARERGEVLPSDARFDSNCITPGTEFMARLHEQLRYFVTYKVTTDTLWQKVKVILSGHETPGEGEHKIMDYIRYMKSQPGHDPNTRHCLYGLDADLIMLGLCSHEPHFSLLREEVKYGRKAKQQRTSTPEETKFFLLHLSLMREYLELEFGILK 267          
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Match: A0A2J7QVG3 (5'-3' exoribonuclease 1 (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G00347 PE=4 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 332/970 (34.23%), Postives = 503/970 (51.86%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEF--DFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLN-LTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETF------------------RIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKL-IVKQSLSEIDNLRMAEF---KSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVV--ESINNSSASIKIVLDEFSEPILPNIHINSIDN--QYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCS----MGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLPQK-------ITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIG 3616
            K TL   + +E+IIDDW++M FL+GNDF+P LP++HI   ALP L+E YI+V P L GY+N  G L+L  F KY++ LS FD   F + Y D+++  GKTG RLG      +K++HS  N  S          ++  L++  + +    TK ++N D        +  L    EQE  +   E   V   +  +  +D  E+  D E N N L                            ++L+FR +K+DYY++KL  + + ++ L  QA+ YV A+QW   YY+ GV SWSWFYP HYAP+ISDI N S  L    + F IG PFLPF+QL+AVLPA S +LLP  Y  LM EE+SPI  FYP +F+TDLNGKK+EWEA+VLIPFI+E+ LL+AM     Q++  + +RN HGP + + ++ + L + E AP+ F                   +  S +V GLCP V LDV   GFPT +H+ H+  L+K+ VK+FE ++ GS+++LRI  Q+   ++ D+A   +    +V WP  +E KV+AV N+  RY L E S L   + ++ E+     A++   +     +   R  + I  T+ ++  T    G+ Y    I      + ++  W    T + L Q +V   ++ +    +   Y  L ++FP  +  F L   +YG  G V   S +  S  +K+ +   +EP L ++     D+   YM    A++   ++S   SR+TGTIYI            D+N  ++      +GL+LK NK N +IPG+  K         WQYS K + +V  Y ++FPE+F+++      K T +D+F   DV P         +T + E+L   PY  +ER     +I+    +  +E+ +          K+  +++    LY P      + PD SA+ QL DR+V +   YTVPLGLKG +IG
Sbjct:  267 KTTLPFPFDIEKIIDDWVLMGFLVGNDFIPPLPDMHIINGALPTLYEAYIDVLPTLGGYVNEGGTLNLERFKKYMERLSAFDFEQFRETYADLKYFQGKTGRRLG------SKERHSYRNTGSK---------ENGELIEENSST----TKPVMNAD--------LKALIQITEQELQV---ELGFVSDEDEDDDTEDWEEYESDEEANANAL----------------------------FHLEFRQHKKDYYMNKLEYDTVNNDVLRSQADGYVRAIQWNLHYYYNGVCSWSWFYPHHYAPYISDICNFSETLD---LSFDIGEPFLPFQQLLAVLPAASKKLLPLPYQQLMDEEDSPIFHFYPSEFKTDLNGKKQEWEAIVLIPFIDEESLLKAMAPCDKQLTEEECKRNSHGPMLIYTYTENDLGLYE-APQFFPPLKNNHAAVCKKTRDEINVDRSRLVKGLCPNVRLDVYFPGFPTLKHIPHTASLQKSKVKVFEQASQGSNMILRILDQS-KANIRDVATELLGRSIYVGWPHLVEAKVVAVSNKEFRYGLQEDSGLKPPRLNVEELKGPCAAQWMLQQKGIQEHYANRMGVDIGKTDILVHATA-MIGRKY----IFGQTGKITMEKQWCDVLTAYAL-QTTVKDIAVHD---KTFVQYRTLQEVFPLKSVCFMLGHPHYGAMGEVVDGSTSVKSGRVKVSMSVTTEPNLDSVRRKYHDSNIHYMPGNMAAQRLGVSSHLVSRVTGTIYI---------VSGDKNAVTESGNKVNVGLNLKFNKHNEEIPGYTRK-----EGTVWQYSYKAVNLVQNYMLQFPELFDYLA-----KHTGNDIFYESDVFPTANKKGVNHLTAITEWLKKQPYTKVERHVCGSKILEAELVQAVEKEVDDFLQHGCRGKTVIMQVKPHLLYRPELQGGNIPPDPSANHQLFDRIVNVRGSYTVPLGLKGTIIG 1145          

HSP 2 Score: 370.933 bits (951), Expect = 0.000e+0
Identity = 173/267 (64.79%), Postives = 211/267 (79.03%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKK-KTRRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKFFRWISERYPCLS  +   Q+P+FD LYLDMNGIIH CSHP+D +  FRI E  I  ++F+YIE LF++++P+ +FF+AVDGVAPRAKMNQQR RRF+SAKEA   E  A + G  +P E RFDSN ITPGTEFM +L + L  F+  K+ TD+LWQ V VILSGHETPGEGEHKI ++IRY +S PDY+ NT+HCLYGLDADL++LGL SHEP+FSLLREEV + +K K +R    EETKFFLLHLSL+REY++ EF  L+
Sbjct:    1 MGVPKFFRWISERYPCLSEVIKEYQVPEFDNLYLDMNGIIHTCSHPNDFDPHFRITEEKILKDIFHYIEVLFRMIRPQKLFFMAVDGVAPRAKMNQQRGRRFRSAKEAEILEQKARERGEALPSEARFDSNCITPGTEFMAQLHEQLKYFVTYKVSTDTLWQNVKVILSGHETPGEGEHKIMDYIRYMKSQPDYDQNTRHCLYGLDADLIMLGLCSHEPHFSLLREEVKYGRKAKQQRTSTPEETKFFLLHLSLMREYLELEFEVLK 267          
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Match: A0A154PBK2 (5'-3' exoribonuclease 1 OS=Dufourea novaeangliae OX=178035 GN=WN55_00957 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 0.000e+0
Identity = 336/1014 (33.14%), Postives = 517/1014 (50.99%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGL-NLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFR-----------------IPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFK--SCTSRNIFRRS-------AISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKL--QHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKG-VVES-INNSSASIKIVLDEFSEPILPNIHI--NSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSL-KGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKK--LDGLRLEVLFDNQFKSAISIRGSEC-RCYRMPPYTLINISFGLR 3760
            K  L   Y +E+IIDDWI+MSFLIGNDF+PHLPNLHI+  A+  L + YI+V P LDGYIN  G L L+ F K+++ LS FD   F +    ++++  KTG R+                  ++ D  +C   D+S                     +E P SP+             + ++E   +++  +   D  L  FD +E             DG           D  D E  NL+F  +KRDYY++KL   N+ ++ L  QA  YV A+QW   YY+ G  SWSW+YP HYAP+ISDI     D K+  ++F+ G PF PF+QL+AVL   S +LLP  +H+L+ +E+SPIID+YP  F+TDLNGK++EWEAVVL+PFI+EKRLL+AM     +++P +  RN HGP   + ++   + + + APE F                  +P   +V GLCP V LDV C GFPT R++EH++ LEKA VK+FE  +   +++L + PQ   + +  +A+  I +  FV WP   E +V+ V         ++K  LI  ++    +N+R  E K  S   R + +++        + +D  +  IL           I S +  GS  KL  +  WS +Q  +  Q + V   +   FS+ +   Y  + ++F   +  F L   +YG  G V+ES I   S  I++ +   +EP L  I      +  QYM     ++   +++   SR+TGTIY+  S   +    + +     C++GL+LK NK N +I G+  +   EN  N+W YS K ++V+  Y  R PE+FE +       +T +++F K      +T   E+L     + LE      + ++ S +  +E+ + + ++  ++NEK   +++    L+ P   +    PD  A   L+DRV C  D +TVPLG KG V+GI++ +  LD +  +V+FD  F   + + G E  R YR+ P   INIS G R
Sbjct:  265 KEKLSFPYDIEKIIDDWILMSFLIGNDFIPHLPNLHIYQGAICILTQVYIDVLPTLDGYINETGTLRLDRFEKFMERLSRFDFIQFAEYSAVLKYLESKTGRRV------------------AESDRPICKKIDNS---------------------EEVPSSPK------------RVQDKEFDTLLRASA---DMSLGMFDEDE------------YDG-----------DDSDSEMHNLEFIQHKRDYYMNKLDYENIDEDFLRTQAEGYVRAIQWNLNYYYNGCCSWSWYYPHHYAPYISDI----KDFKDLKLEFEFGEPFQPFQQLLAVLSPYSKDLLPPAFHTLLTDEDSPIIDYYPIDFKTDLNGKQQEWEAVVLLPFIDEKRLLDAMAPYYPKLTPEERERNQHGPMCLYSYTEDEMGVQK-APEYFPDIVSHATVQFINYQDIIVPREKLVRGLCPGVKLDVYCPGFPTLRYIEHTWTLEKAKVKVFEKPSFRDNMILHLRPQP-EEDLTTVAEELIGKTVFVGWPHLTEAQVVGVST------FSKKLTLINPETNYSPENIRTEELKGPSFAQRYLQKKTIAAVYKGTMGVDIGDTKILVDARPL-----IGSKYIFGSHGKLYFEKQWSDSQITYAYQMI-VKDIATHCFSAAT---YKTVEEIFVPESVCFMLGHPHYGAMGKVIESEIFKKSGRIRVSVHVSAEPSLEGIKQLHQEVKTQYMQGSIVAQILGISNHLLSRVTGTIYVRPSVPSEFGHEDIK-----CNIGLNLKFNKKNEEIVGYTRR---EN--NQWLYSYKAVEVLRSYMARSPELFERLAVNVANIITEEELFDKGS--GGLTSTMEWLKEQ-LQGLESRPCGAEALDPSLVKKLEEEIDEYSKIQANNEKLVAMQVKPYLLFKPGLHMCNAPPDSKAQTYLLDRVCCTRDNFTVPLGYKGTVVGIQKAENFLDTM-YDVVFDRTFPGGLVVNGCEGFRGYRLSPIDFINISHGER 1166          

HSP 2 Score: 358.992 bits (920), Expect = 0.000e+0
Identity = 166/267 (62.17%), Postives = 215/267 (80.52%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MG+ KFFR+ISERYPC++ ++ + QIP+FD LYLD+NGIIH CSHP+D++  FRI+E  IF N+F+YIE LF++++P+ +FF+A+DGVAPRAK+NQQR+RRF++AK+A   E AA  SGI IP+ K+FDSN ITPGTEFM +L   L  F+ +KI TD LWQ   VILSG + PGEGEHKI ++IRY +S PDYNP+T+HCLYGLDADL+ LG+ +HE +F+LLREEV F KK+T +    EETKF L HLSLLREYID+EF+ L+E
Sbjct:    1 MGIAKFFRYISERYPCITETLKDYQIPEFDNLYLDVNGIIHGCSHPNDSDTTFRISEETIFKNIFHYIEILFRMIQPQKLFFVAIDGVAPRAKINQQRSRRFRAAKDAQMHEAAAKASGILIPEGKKFDSNCITPGTEFMYKLNDQLKYFITHKISTDKLWQKCKVILSGSQVPGEGEHKIMDYIRYMKSQPDYNPDTRHCLYGLDADLITLGMCTHEVHFTLLREEVKFGKKQT-KIQTPEETKFCLFHLSLLREYIDHEFSPLKE 266          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 353.984 bits (907), Expect = 1.042e-123
Identity = 173/267 (64.79%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALR 833
            MGVPKF+RWISERYPCLS  V   QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A++ G  +P E RFDSN ITPGTEFM RLQ+ L  F+            + V LSGHETPGEGEHKI EFIR     P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK ++   A EET F LLHLSL+REYIDYEF+ LR
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEQQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRITEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKALEKGEVLPTEARFDSNCITPGTEFMARLQEQLKYFVH-----------IRVYLSGHETPGEGEHKIMEFIRSEIVKPGHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKNQKRITAPEETTFHLLHLSLMREYIDYEFSPLR 256          

HSP 2 Score: 112.079 bits (279), Expect = 1.042e-123
Identity = 50/98 (51.02%), Postives = 70/98 (71.43%), Query Frame = 2
Query:  848 EYSLERI-IDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            E+S  R+ IDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI V P L GY+N  G L+L +F KY++ L+ FDR +F + + D++W   K G +
Sbjct:  251 EFSPLRVSIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYITVLPTLGGYLNENGNLNLAHFEKYLEKLAEFDREHFSEVFVDLKWFESKVGNK 348          

HSP 3 Score: 390.193 bits (1001), Expect = 2.488e-111
Identity = 261/774 (33.72%), Postives = 399/774 (51.55%), Query Frame = 2
Query: 1613 DEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEE-KRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCP-----------------KVLLDVICQ----------GFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITP-QNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKS---KLIVKQSLSEIDNLRMA---------EFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQAS------EYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDG-LRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +E L  QA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SD+ N++  L+   + F +G+PF+PFEQL+ VLPA S +LLP CY  LM  E SPII++YP  F+TDLNGK++EWEAVVLIPFI+E KRLL AME    Q++ S+  RN H        S   L   +   +    P +S +P L P                 +V LD + +          GFPT +H+ H F  +K+GV +F+ S+ G +++L I+P Q     +ED+A   +    FVNWP   E +V+AV +   ++LL E +   KL    S   +  + ++         E +  T  N  +R  I I+ T+ ++L      G+ Y I        +V L+  W      +  Q    + + I  F S S+  +  L +LFP    VF +   YYG  G V+  ++  +   +++V     EP L  +    I NQ+ ++ + S          + S   SR +G+I+I       +  + + +   + ++GL+LK NK N ++PG+      + ++ +W YS  V +++ EY  RF EVF+++      + + DD+F   D+ P       +K+ E+Q +L   P  +  R S D QI++   +  IE+ L+         K  RV +    L+ P    HGV PD  AD+ L DRVV + + ++VPLGL+G VIGI+    D  +  EVLFD +F   +++R S  R YR+PP  LIN+S G R
Sbjct:  423 NEFLASQARCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDVRNIAG-LR---LTFDLGKPFMPFEQLLGVLPAASKDLLPKCYQHLMTSEGSPIIEYYPLDFKTDLNGKQQEWEAVVLIPFIDEVKRLLAAMELYTDQLNKSEKSRNRH--------SECALYCYD---KQLDYPYTSPLPDLFPNITHCHTRVTPVPVDAWRVSLDYVGRKVDRSSLYFCGFPTLQHIRHKFYKKKSGVMVFQQSSRGENMMLEISPCQQGVPMLEDVAALVLGRSVFVNWPHLEEARVVAVSDGESKFLLEEAAGSQKLYEDGSPPPVKVVYLSDKEQKEWVKEVQGLTEHN-NKRKGIIINETD-VLLHAQLLTGRKYIISH----SGSVHLEKQWGKQVLPFPYQ---TIVKDIKAFDS-SLSRFKTLDELFPVGTAVFMVGNPYYGAMGEVQDSSDVINEGRVRVVFTMPCEPQLDTL----IQNQHKYSVKYSPGYVLASRLGITSYLVSRFSGSIFIG------RGAKKNPHGEQRANVGLNLKFNKKNEEVPGYT-----KRTEKEWLYSAAVEELLAEYLERFSEVFDYV-----SRNSHDDIFYEDDIWPGEDENGAEKVQEIQAWLKTHPVSSSSRASCDLQILDSGIVEKIEEELE-KSKVKKGSKKVRVTVKPHLLFRPLEQQHGVVPDPDADYHLFDRVVNVRENFSVPLGLRGTVIGIKGADRDAEVLFEVLFDEEFAGGLTLRCSPGRGYRLPPCALINLSHGSR 1150          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:103036099])

HSP 1 Score: 240.35 bits (612), Expect = 2.298e-74
Identity = 137/319 (42.95%), Postives = 186/319 (58.31%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP-----CL---SVSVDNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSK-----------------------KKTRRAYIAE-----ETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +Y      CL   S   +  QIP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + V LS    PGEGEHKI +FIR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE   +K                       KK      A+     E +F  + LS+LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYASIIVNCLEEKSKECNGVQIPVDTSKPNPNEVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEIFQRGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLTNDPGWRTITVFLSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPRPCGLCGQIGHELKDCQGVAREKKGEHDEFADTIPVSEQEFIFIRLSVLREYLEREL 317          

HSP 2 Score: 61.2326 bits (147), Expect = 2.298e-74
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +L   ++ ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    +D
Sbjct:  321 SLPFPFNFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVSIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKDD 410          

HSP 3 Score: 143.665 bits (361), Expect = 3.957e-34
Identity = 73/174 (41.95%), Postives = 101/174 (58.05%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGR-PFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  ++ TDE   ++    YV  L W+  YY+ G  SW W++P HYAPF SD  ++ +  KE    F+ G  PF P EQLM V PA S   LP  + +LM   +S IIDFYP  F  DLNGKK  W+ V L+PF++E+RL  A+      ++  +IRRN  G  + F
Sbjct:  527 WKQRYYKNKFDVDETDEEFRKKVVKSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFKDIKDMFKE----FEKGTMPFKPLEQLMGVFPAASGNFLPETWRALMSNPDSSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRGALADVYPDLTTEEIRRNSLGSDVVF 696          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:103036099])

HSP 1 Score: 239.965 bits (611), Expect = 2.316e-74
Identity = 137/319 (42.95%), Postives = 186/319 (58.31%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP-----CL---SVSVDNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSK-----------------------KKTRRAYIAE-----ETKFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +Y      CL   S   +  QIP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE    + G   P+E  +RFDSN ITPGTEFMD L K L  ++ +++  D  W+ + V LS    PGEGEHKI +FIR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE   +K                       KK      A+     E +F  + LS+LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYASIIVNCLEEKSKECNGVQIPVDTSKPNPNEVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEIFQRGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLTNDPGWRTITVFLSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPRPCGLCGQIGHELKDCQGVAREKKGEHDEFADTIPVSEQEFIFIRLSVLREYLEREL 317          

HSP 2 Score: 61.2326 bits (147), Expect = 2.316e-74
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +L   ++ ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    +D
Sbjct:  321 SLPFPFNFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVSIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKDD 410          

HSP 3 Score: 144.05 bits (362), Expect = 3.411e-34
Identity = 73/174 (41.95%), Postives = 101/174 (58.05%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGR-PFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  ++ TDE   ++    YV  L W+  YY+ G  SW W++P HYAPF SD  ++ +  KE    F+ G  PF P EQLM V PA S   LP  + +LM   +S IIDFYP  F  DLNGKK  W+ V L+PF++E+RL  A+      ++  +IRRN  G  + F
Sbjct:  527 WKQRYYKNKFDVDETDEEFRKKVVKSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFKDIKDMFKE----FEKGTMPFKPLEQLMGVFPAASGNFLPETWRALMSNPDSSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRGALADVYPDLTTEEIRRNSLGSDVVF 696          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 182.185 bits (461), Expect = 2.877e-71
Identity = 98/164 (59.76%), Postives = 119/164 (72.56%), Query Frame = 3
Query:  351 KEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQG--VDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALR 833
            KEA ++   A++ G  +P E RFDSN ITPGTEFM RLQ+ L  F+ +K+ TD    G  V V+L   +TPGEGEHKI EFIR     P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK ++   A EET F LLHLSL+REYIDYEF+ LR
Sbjct:   18 KEAEDKIKKALEKGEVLPTEARFDSNCITPGTEFMARLQEQLKYFVHSKLSTDRDVAGSPVCVVL---QTPGEGEHKIMEFIRSEIVKPGHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKNQKRITAPEETTFHLLHLSLMREYIDYEFSPLR 178          

HSP 2 Score: 108.997 bits (271), Expect = 2.877e-71
Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 2
Query:  848 EYSLERI-IDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNL 1162
            E+S  R+ IDDWI+M FL+GNDF+PHLP+LHI+  ALP L+ TYI V P L GY+N  G L+L +F KY++ L+ FDR +F + + D++W   K G +   E   L
Sbjct:  173 EFSPLRVSIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYRTYITVLPTLGGYLNENGNLNLAHFEKYLEKLAEFDREHFSEVFVDLKWFESKVGNKYLNEAAGL 278          

HSP 3 Score: 167.933 bits (424), Expect = 8.110e-44
Identity = 76/130 (58.46%), Postives = 97/130 (74.62%), Query Frame = 2
Query: 1613 DEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRL 2002
            +E L  QA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SD+ N++  L+   + F +G+PF+PFEQL+ VLPA S +LLP CY  LM  E SPII++YP  F+TDLNGK++EWEAVVLIPFI+E  L
Sbjct:  343 NEFLASQARCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDVRNIAG-LR---LTFDLGKPFMPFEQLLGVLPAASKDLLPKCYQHLMTSEGSPIIEYYPLDFKTDLNGKQQEWEAVVLIPFIDEAHL 468          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 165.236 bits (417), Expect = 3.372e-47
Identity = 74/104 (71.15%), Postives = 87/104 (83.65%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKS 347
            MGVPKF+RWISERYPCLS  V   QIP+FD LYLDMNGIIH CSHP+D +V FRI E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+ 
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEQQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRITEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRE 104          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Sea Lamprey
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 330.102 bits (845), Expect = 1.659e-122
Identity = 158/247 (63.97%), Postives = 193/247 (78.14%), Query Frame = 3
Query:  105 NQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKT----RRAYIAEETKFFLLHLSLLREYIDYEFNALR 833
            +QIP+FD LYLDMNGIIH CSHPDDT+V  RI E  IF+++F+YIE LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   AI+ G  +P E+RFDSN ITPGT FM RLQ+ L  F+ +K+ TD LW GV V LSGHETPGEGEHKI EFIR ++   D++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F+        + +   EET F LLHLSL+REY+ YEF  L+
Sbjct:    1 SQIPEFDNLYLDMNGIIHTCSHPDDTDVHLRIPEEKIFSDIFHYIEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGEVLPTEERFDSNCITPGTFFMARLQERLKSFVSDKLDTDRLWHGVTVYLSGHETPGEGEHKIMEFIRAQKIRADHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFATDAKCSILQLSVAPEETTFHLLHLSLMREYLQYEFEELK 247          

HSP 2 Score: 129.798 bits (325), Expect = 1.659e-122
Identity = 59/103 (57.28%), Postives = 74/103 (71.84%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGER 1138
            K  L   +S+E +IDDW++M FL+GNDF+P+LPNLHI   ALP L+ TYI V P LDGYIN  G L+L  F KY+DALS FDR +F + Y D++W  GKTG R
Sbjct:  247 KALLPFPFSVEHVIDDWVLMGFLVGNDFIPNLPNLHIAQDALPLLYRTYIKVLPTLDGYINESGILNLPRFEKYLDALSKFDREHFNEVYVDLKWFEGKTGNR 349          

HSP 3 Score: 304.679 bits (779), Expect = 1.572e-85
Identity = 233/741 (31.44%), Postives = 376/741 (50.74%), Query Frame = 2
Query: 1526 DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANE------YVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSN-DLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSN---SGLVISEI--APETFRIPMSSI-VPGLCPKVLLD---VICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQ---SLSEIDNLR------MAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSK-LHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFS----EPILPNIHINSIDNQYMHAGQASEYTDMNSLA-----FSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVL--------PQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGI 3619
            D    E + L+F  YKR+YY++K+ +    EA+ +Q N        VT+ +W     F G      FYP HYAPF+SD+  +S  +LK N     +G+PFLP++QL+AVLP+ S +LLP  Y SL+ +E SP+ DFYPK F TDLNGK+ EWEAVVL+PFI EKRLLEAM+S +  ++  + +RNVH   +++  SN   S  + + I  A     +PM +  V    P+       +   GFPT + + H F  +KAGV +F+  + G SI+L + P+N   + E++A   +    FVNWP   E  V+AV +   +  +  +  + +K+   S  E  N+R        ++ S  +  ++    + I+        +V   G I+E +        V+    W S         + V   S D  +      +SK L ++FP N+TVF L   +YG +G +    ++++S+ +  D  S     P  P   +  +  Q      +  Y   N LA      SRITGT+ +       K  R       +C++GL+LK N+ N ++ G+  +V     +N+W YS     ++ +Y  RFPE+F+++        +  D+F +D +         +++ E+ ++L +LP  +  R S D Q+++   +  +EQ +  A  A  N+K  ++ +    L+ P  +L  V PD  A FQL DRVV + + ++VPLGL+G +IGI
Sbjct:  456 DRERDELFELEFAHYKRNYYMTKMEV----EAVTEQFNRKQIEGLIVTSQRWSLASVFFGCDYTFRFYPYHYAPFVSDVRGISKLELKLN-----LGQPFLPYQQLLAVLPSLSKQLLPQAYQSLVSDETSPLHDFYPKDFNTDLNGKQHEWEAVVLVPFICEKRLLEAMQSCEHLLTEEERQRNVHSACLEY-LSNRTPSPQMQARIVQANRCVEVPMDAWHVKTRRPQTEYSTPTLFYPGFPTLKQIPHKFYFKKAGVTVFQHKSRGESIILEVLPKNNEMATEELAATLLGRPVFVNWPHLEEALVVAVADFKIKLSVQGEGAVDIKRVQLSKEEEKNVRKDMLAITEQYVSTLAITLY--CMVDIEQARDCAHCSVGFVGNIHEQEGRGGGHLGVRAIVTWPSPNIS---VCVCVPVSSQDICTPEVAASHSKTLEEIFPLNSTVFMLGTPHYGCQGELTWAFSNTSSLWLSHDLISISTKHPQGPGCCLR-LPVQSFAVRYSPGYVLANRLAISGHVLSRITGTLLV------AKGSRKCPKGDQKCNLGLNLKFNRKNEEVSGYTKRV-----ENEWLYSAATELLLGQYVERFPELFKYLASN-----SQSDMFYEDEIWSSEEENSSERVHEVLDWLKSLPASSASRSSCDTQVLDAGVVERLEQEVD-AHKAKKNKKKVKISVKPHLLFRPEEALGYVIPDPQAKFQLFDRVVNVRESFSVPLGLRGTLIGI 1163          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Sea Lamprey
Match: xrn2 (5'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2874])

HSP 1 Score: 130.954 bits (328), Expect = 1.394e-43
Identity = 71/177 (40.11%), Postives = 98/177 (55.37%), Query Frame = 3
Query:  387 SGIEIPDE--KRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYI------------------------------AEETKFFLLHLSLLREYIDYEF 821
             G   P+E  +RFDSN ITPGTEFM  L K L  ++  ++ +D  W+ + VILS    PGEGEHKI +FIR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   + R   +                                E  F  L L++LREY++ E 
Sbjct:    1 GGFLPPEEAKERFDSNCITPGTEFMSNLAKCLRYYVAERLNSDPGWRNIAVILSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPKFTIIREE--FKPNQQRPCALCSQFGHELKDCEGLPREKQGKHDEFADLPPGSEQDFIFLRLNILREYLEREL 175          

HSP 2 Score: 65.4698 bits (158), Expect = 1.394e-43
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  836 TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALS 1066
            +L   + LER IDDW+ M F +GNDF+PHLP+L I   A+  L   Y NV     GY+ N G ++L      ++AL 
Sbjct:  179 SLPFPFDLERSIDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVGIYKNVVHRTGGYLTNSGYVNLERVQLVMEALG 255          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Yeast
Match: XRN1 (Evolutionarily-conserved 5'-3' exonuclease; component of cytoplasmic processing (P) bodies involved in mRNA decay; also enters the nucleus and positively regulates transcription initiation and elongation; plays a role in microtubule-mediated processes, filamentous growth, ribosomal RNA maturation, and telomere maintenance; activated by the scavenger decapping enzyme Dcs1p [Source:SGD;Acc:S000003141])

HSP 1 Score: 318.161 bits (814), Expect = 3.488e-173
Identity = 146/265 (55.09%), Postives = 200/265 (75.47%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNAL 830
            MG+PKFFR+ISER+P +   ++  QIP+FD LYLDMN I+H C+H +D +V  R+ E ++F  +  YI+ LF+ +KPK +F++A+DGVAPRAKMNQQRARRF++A +A      AI++G EIP  + FDSN+ITPGTEFM +L K L  F+ +KI  DS W+ V +I SGHE PGEGEHKI  FIR+ +S  D+N NT+HC+YGLDADL++LGL++H P+F+LLREEVTF ++ + +  + E   F+LLHLSLLREY++ EF  +
Sbjct:    1 MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSILHNCTHGNDDDVTKRLTEEEVFAKICTYIDHLFQTIKPKKIFYMAIDGVAPRAKMNQQRARRFRTAMDAEKALKKAIENGDEIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKISNDSKWREVQIIFSGHEVPGEGEHKIMNFIRHLKSQKDFNQNTRHCIYGLDADLIMLGLSTHGPHFALLREEVTFGRRNSEKKSL-EHQNFYLLHLSLLREYMELEFKEI 264          

HSP 2 Score: 310.071 bits (793), Expect = 3.488e-173
Identity = 280/1010 (27.72%), Postives = 476/1010 (47.13%), Query Frame = 2
Query:  848 EYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFP--DSPEILVLSNNLE-QEESIFN---------EENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQ-ANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDIS-NLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRF---------SNSGLVISEI------APETFRIPM--SSIVPGLCPKVLLDV-ICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRIT----PQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLL---NEKSKL-IVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEF---SEPILPNIHINSIDNQ---YMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF----SKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELS---FRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYR 3718
            EY+ ERI+DD+I++ F+IGNDF+P+LP+LH++  A P L +T+       DGYIN  GK++L     +++ LS F+  NF  +  D++W          K+L+N++ +            +         S+     + ++E     +  D+E P  + P+ L + ++LE  +E  F+          + S  ++M+  +I+ D  E +F+   N  I    KK    I     +      +K  +N +F  +K +YY  KL      E  V+  A +YV  LQW+ +YY+ G PSWSW+YP HYAP ISD++  L  D     I+F + +PF PF+QLMAVLP  S  L+P  +  LM +E SPI DFYP + + D NGK  +WEAVVLI F++EKRL+EAM+    ++SP +  RN  G  + + F         S  G + S+I        E   IP+  S I  GL P   L   +  GFPT   +  +  LE     +F+  +   S+VL+IT      NVT  +ED +KR++N++ +  WP   E K++++ +    Y     N+K K   + +     D       K+   R   ++ A+ I P    I       G + + D     G  +K    +S    ++ LQ   V++  ++       +    + + FP N+ V  L    YG +  ++   +S   +KI +++    SEP +    +  +D+Q   Y  +   S+   ++ L  S+IT    I  +T                ++G+ +K    + ++ G+        +   W+YS   + ++ EYR  FP+ F  + K   +   ++D+F    +KD +   +  ++++L  +  K +  +S +   + ++ I+ +E  +   +YA++ E   R +L+      +  P  S   +   +S  F L DRVV I D   VP+  KG V+G        L ++VLFD++  +  +  G   R  R
Sbjct:  271 EYNFERILDDFILVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKEALLHTDGYINEHGKINLKRLGVWLNYLSQFELLNFEKDDIDVEW--------FNKQLENISLEGERKRQRVGKKLLVKQQKKLIGSIKPWLMEQLQEKLSPDLP-DEEIPTLELPKDLDMKDHLEFLKEFAFDLGLFITHSKSKGSYSLKMDLDSINPDETEEEFQNRVNS-IRKTIKKYQNAIIV--EDKEELETEKTIYNERFERWKHEYYHDKLKFTTDSEEKVRDLAKDYVEGLQWVLYYYYRGCPSWSWYYPHHYAPRISDLAKGLDQD-----IEFDLSKPFTPFQQLMAVLPERSKNLIPPAFRPLMYDEQSPIHDFYPAEVQLDKNGKTADWEAVVLISFVDEKRLIEAMQPYLRKLSPEEKTRNQFGKDLIYSFNPQVDNLYKSPLGGIFSDIEHNHCVEKEYITIPLDSSEIRYGLLPNAKLGAEMLAGFPTLLSLPFTSSLEYNETMVFQQPSKQQSMVLQITDIYKTNNVT--LEDFSKRHLNKVIYTRWPYLRESKLVSLTDGKTIYEYQESNDKKKFGFITKPAETQDKKLFNSLKNSMLRMYAKQKAVKIGPME-AIATVFPVTGLVRDSD-----GGYIKT---FSPTPDYYPLQL--VVESVVNEDERYKERGPIPIEEEFPLNSKVIFLGDYAYGGETTIDGY-SSDRRLKITVEKKFLDSEPTIGKERL-QMDHQAVKYYPSYIVSKNMHLHPLFLSKITSKFMITDAT------------GKHINVGIPVKFEARHQKVLGY-----ARRNPRGWEYSNLTLNLLKEYRQTFPDFFFRLSKVGNDIPVLEDLFPDTSTKDAM-NLLDGIKQWLKYVSSKFIA-VSLESDSLTKTSIAAVEDHI--MKYAANIEGHERKQLAKVPREAVLNPRSSFALL---RSQKFDLGDRVVYIQDSGKVPIFSKGTVVGYTTLS-SSLSIQVLFDHEIVAGNNF-GGRLRTNR 1222          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Yeast
Match: RAT1 (Nuclear 5' to 3' single-stranded RNA exonuclease; involved in RNA metabolism, including rRNA and snoRNA processing, as well as poly (A+) dependent and independent mRNA transcription termination; required for cotranscriptional pre-rRNA cleavage; displaces Cdk1p from elongating transcripts, especially as RNAPII reaches the poly(A) site, negatively regulates phosphorylation of the CTD of RNAPII, and inhibits RNAPII transcriptional elongation [Source:SGD;Acc:S000005574])

HSP 1 Score: 238.81 bits (608), Expect = 4.713e-110
Identity = 136/307 (44.30%), Postives = 180/307 (58.63%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSV--DNNQIPD----------------FDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEA---------INREIAAIQSGIE--IPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAY-----IAEETKFFL-----------LHLSLLREYIDYEF 821
            MGVP FFRW+S +YP +   V  +  QI D                 D LYLDMNGI+H CSHP+  N      E ++   VF Y   +  + +P+ V  +AVDGVAPRAKMNQQRARRF+SA++A         I R+   +   I+  + ++K +DSNAITPGT FMD+L  AL  +   K+ TD  W+ + VI+S    PGEGEHKI  FIR +R+ P+YNPNT HC+YGLDADL+ LGLA+HEP+F +LRE+V     + R        + EE K FL           LH+++LREY+  E 
Sbjct:    1 MGVPSFFRWLSRKYPKIISPVLEEQPQIVDGVILPLDYSASNPNGELDNLYLDMNGIVHPCSHPE--NKPPPETEDEMLLAVFEYTNRVLNMARPRKVLVMAVDGVAPRAKMNQQRARRFRSARDAQIENEAREEIMRQREEVGEIIDDAVRNKKTWDSNAITPGTPFMDKLAAALRYWTAFKLATDPGWKNLQVIISDATVPGEGEHKIMNFIRSQRADPEYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFAQDNRKRNNLKDTINMTEEEKQFLQKQNSEQPFLWLHINVLREYLSAEL 305          

HSP 2 Score: 179.104 bits (453), Expect = 4.713e-110
Identity = 139/461 (30.15%), Postives = 220/461 (47.72%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALS-----IFDRNNFLDNYEDMQWMLGKTGERLGKELDNL---------------NKQKHSANNNQSDL-----DVSLCNIFDDSSL--VDRQTDSIEEITKRIINLDDEFPDSPEILVLSN-NLEQ--EESIFNEENSLVVQMESMNIDKDLIEFDFEENE----------NILIGGGTKKVDGEITTFPLNN------NNDAGDK-------EFWNLQFRTYKRDYYLSKLGLNLTDEALVQQ--ANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 2068
            + LER IDDW+ M F  GNDF+PHLP L +  +++  L + +  V P+L  Y+   G L+L +    +  L      IF   +  +  +   +   K  + + K  D                 N  K S N   SD+     ++ L N  ++ ++  V +Q+D   E+ K I    +E  D+      +N NL +  ++ I N+++ L    E   I KD  +   E+ E          + ++     + + E T    ++      N   G K       EF  L    Y   YY +K  +   D   +++     Y+  + W+  YY+ G  SW+WFYP HYAP  +D    S+ L+   I F+ G PFLP+EQLM+VLPA S   LP  + SLM E +S IIDFYP++F  D+NGKK  W+ + L+PFI++ RLL A+ ++   +S ++  RN+ G
Sbjct:  314 FDLERAIDDWVFMCFFCGNDFLPHLPCLDVRENSIDILLDIWKVVLPKLKTYMTCDGVLNLPSVETLLQHLGSREGDIFKTRHIQEARKKEAFERRKAQKNMSKGQDRHPTVATEQLQMYDTQGNLAKGSWNLTTSDMVRLKKELMLANEGNEEAIAKVKQQSDKNNELMKDISK--EEIDDAVSKANKTNFNLAEVMKQKIINKKHRLEKDNEEEEIAKDSKKVKTEKAESECDLDAEIKDEIVADVNDRENSETTEVSRDSPVHSTVNVSEGPKNGVFDTDEFVKLFEPGYHERYYTAKFHVTPQDIEQLRKDMVKCYIEGVAWVLMYYYQGCASWNWFYPYHYAPLATDFHGFSH-LE---IKFEEGTPFLPYEQLMSVLPAASGHALPKIFRSLMSEPDSEIIDFYPEEFPIDMNGKKMSWQGIALLPFIDQDRLLTAVRAQYPLLSDAERARNIRG 768          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Nematostella
Match: EDO42338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K1])

HSP 1 Score: 181.03 bits (458), Expect = 8.593e-46
Identity = 148/580 (25.52%), Postives = 262/580 (45.17%), Query Frame = 2
Query: 2144 MSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQ--YMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQ-CSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKI-----TELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQ--YASSNEKSCR-----------------------------VELSFRD--LYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            + ++V GL   V L+V   GFPT  H+ H+ +L+KA VK+F+  +   S++L++    +  ++  +A++Y+ E  +V WP  +E  V+AV + T RY   +  K I +  LSE D     + KS     + RR  I +     I+++     G+ +    +  A   V L+ +WS     +  Q    + + I    S S      + +LFP +   F LA  +YG  G V  ++     +++ L    EP + +I     D    Y+ +   ++   ++S    +IT   +I     EQ SR   + + ++   +GL+LK  K N ++ G+  +     +QN W ++     V+ +Y  +FP++F+ +          D V+  D+L   I     T++Q +L +LP +    ++     +++  +  IE+++K  +  Y  + E + R                             V++  R   L+ P   L    PD   + QL DRVV +     VP GL+G V+G    + D   +EVLFD  F  A SIR +    Y   P +LI+++FG R
Sbjct:  166 LENLVKGLLKDVKLEVYFPGFPTLYHIPHTAELKKASVKVFQMHSRSDSMILKLQQSQLEPTIR-VAEKYLGETCYVGWPHMVEALVVAVSDNTFRYSRKKGEKDIQQDILSEEDGWE-KQVKSFAQSQMERR-GIDVGAVE-ILIDACPVIGRRF----LCSAKGQVTLEKEWSPVPKQYAFQ---TVVKDISVHESVSTDSMRTIDELFPVDCVCFMLAMPHYGASGTVLEVDVKQGRVRVQLRVPEEPNIASIAKQREDLSVGYLPSHVVAQKMGISSSLLGKITAKFFI-----EQGSREKSKGQGNKKIDIGLNLKLTKQNKELLGYTRR-----TQNGWMFTQAARNVITQYINKFPKLFDALATLQ----QSDQVYEADMLDHGIDLSVLTDVQNWLKSLPLQKQTVVTCGSDALDDPVLEAIEEAVKKVKVSYLEAIEGAVRKVKHFFTPKNGQLMGVRMAIIKTSLPPKIVKVRVRPYLLFRPSDFLGNTLPDSDTEIQLFDRVVNVKLNSAVPFGLRGTVVGFHIGEDDDELVEVLFDEHFIGAQSIRRTTNGVYLAHPSSLIDLTFGER 720          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Match: xrn1 (5'-3' exoribonuclease 1 [Source:NCBI gene;Acc:101169885])

HSP 1 Score: 381.719 bits (979), Expect = 1.408e-138
Identity = 180/269 (66.91%), Postives = 215/269 (79.93%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALREH 839
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI+E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A+  G  +P E RFDSN ITPGT+FM RLQ+ L  F+ NK+ TD LW  V V LSGHETPGEGEHKI EFIR   S P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK+++   A EET F LLHLSL+REYIDYEF+ L+ H
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRISEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKALDKGEVLPTEARFDSNCITPGTDFMARLQEQLKYFVHNKLSTDKLWHNVKVYLSGHETPGEGEHKIMEFIRSENSKPSHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRITAPEETTFHLLHLSLMREYIDYEFSWLKNH 269          

HSP 2 Score: 134.035 bits (336), Expect = 1.408e-138
Identity = 65/135 (48.15%), Postives = 86/135 (63.70%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSAN---NNQSDLDVSLCNI 1225
            K  L   Y LERIIDDWI+M FL+GNDF+PHLPNLHI+  ALP L++TYI+V P L GY+N  G L+L NF KY++ LS FDR +F + + D++W   K G +   E   L  +K SA    N + D  + L  +
Sbjct:  267 KNHLGSAYDLERIIDDWILMGFLVGNDFIPHLPNLHINHDALPMLYKTYISVLPSLGGYLNENGHLNLKNFEKYMEKLSEFDREHFNEVFVDLKWFESKVGNKYLNESAGLAAEKESAGKKFNKKKDASLGLSAL 401          

HSP 3 Score: 414.461 bits (1064), Expect = 2.935e-119
Identity = 268/785 (34.14%), Postives = 428/785 (54.52%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVH--------GPHIKFRFSNSGLVISEIAPETFRIPMSSI-VPGLCPKVLLDVICQ----------GFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMED-IAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQS---------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASE-YTDMNSLAF-----SRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRL-EVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +FR YKR YY++K+ +++ +DE L QQA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SDI N+S DLK   + F++G PF+PF+QL+AVLPA S  LLP CY  LM  ENSPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLL AME    +++  +  RN H         P I F ++++   + ++ P      +    +P     V  D + +          GFPT +H++H F  +K+GV +F+ S+ G +++L I P    + + D +A + + +  FVNWP   E +++AV +   +++L E     K+  K S         LS+ +     +     +    +R  I I+ T+ ++   + +  K    D        V+L+  W+     +  Q    + + I+ F S S+  +  L +LFP   TVF +   YYG  G V+   +      I++V     EP + ++    I NQ+ ++ + S  Y   + L       SR +G+I+I      + S+RN   +  + ++GL+LK NK N ++PG+      + S+ +W YS  V +++ EY  RF EVF+ +      + + DD+F   D+ P       +++ E+  +L + P  ++ R S D Q+++ + +  IE++++       + K  RV +    L+ P   L GV PD  A+++L DRVV I +G+TVPLGL+G VIGI+  + +   L EVLFD +F   + IR +  R YR+PP+ LIN+S G+R
Sbjct:  429 EFRQYKRTYYMTKMAVDVVSDEFLAQQAKCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRNIS-DLK---LTFELGEPFMPFQQLLAVLPAASMGLLPECYRHLMTSENSPIIEYYPVDFKTDLNGKQQEWEAVVLIPFIDEKRLLAAMEPYNHKLTKEEKDRNGHKECAVYSYDPEIDFTYTST---LPQLFPNIVHCRVRKANIPVDAWHVSSDHVVKHADRSSLYFCGFPTLQHIKHKFYKKKSGVVVFQQSSRGENMMLEILPTQEGEMICDNVAAQVLGKPVFVNWPHLEEARIVAVSDGETKFILEEPPGVQKVYDKPSSPPPTKVTYLSDKEQKDWVKDVQGITEFYLKRKGIVINDTDVVLYGQLLTGRKYVPQDK-----GAVELEKQWAKQVLPFAYQ---AVVKDIEAFYS-SLTSFKSLDELFPPATTVFMVGAPYYGAMGEVQDSQDVLKDGRIRVVFSVPHEPQMDHL----IQNQHKYSVRYSPGYVLASRLGISGYLVSRFSGSIFIG-----RGSKRNPCGE-QKSNVGLNLKFNKKNEEVPGYT-----KRSEKEWLYSAAVEELLAEYLDRFSEVFDAV-----SRNSHDDIFYEDDIWPGVDQNGAERVAEITSWLRSHPVSSISRASCDLQVLDAAIVEKIEEAVE-KTKIKKSTKKVRVTVKPHLLFRPLEQLQGVVPDPDAEYRLFDRVVNIREGFTVPLGLRGTVIGIKGAEREAEVLYEVLFDEEFAGGLIIRCASPRAYRLPPFALINLSHGVR 1176          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Match: xrn1 (5'-3' exoribonuclease 1 [Source:NCBI gene;Acc:101169885])

HSP 1 Score: 381.719 bits (979), Expect = 1.492e-138
Identity = 180/269 (66.91%), Postives = 215/269 (79.93%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALREH 839
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI+E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A+  G  +P E RFDSN ITPGT+FM RLQ+ L  F+ NK+ TD LW  V V LSGHETPGEGEHKI EFIR   S P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK+++   A EET F LLHLSL+REYIDYEF+ L+ H
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRISEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKALDKGEVLPTEARFDSNCITPGTDFMARLQEQLKYFVHNKLSTDKLWHNVKVYLSGHETPGEGEHKIMEFIRSENSKPSHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRITAPEETTFHLLHLSLMREYIDYEFSWLKNH 269          

HSP 2 Score: 134.035 bits (336), Expect = 1.492e-138
Identity = 65/135 (48.15%), Postives = 86/135 (63.70%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSAN---NNQSDLDVSLCNI 1225
            K  L   Y LERIIDDWI+M FL+GNDF+PHLPNLHI+  ALP L++TYI+V P L GY+N  G L+L NF KY++ LS FDR +F + + D++W   K G +   E   L  +K SA    N + D  + L  +
Sbjct:  267 KNHLGSAYDLERIIDDWILMGFLVGNDFIPHLPNLHINHDALPMLYKTYISVLPSLGGYLNENGHLNLKNFEKYMEKLSEFDREHFNEVFVDLKWFESKVGNKYLNESAGLAAEKESAGKKFNKKKDASLGLSAL 401          

HSP 3 Score: 414.846 bits (1065), Expect = 2.057e-119
Identity = 268/785 (34.14%), Postives = 428/785 (54.52%), Query Frame = 2
Query: 1556 QFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVH--------GPHIKFRFSNSGLVISEIAPETFRIPMSSI-VPGLCPKVLLDVICQ----------GFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITP-QNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQS---------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASE-YTDMNSLAF-----SRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRL-EVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
            +FR YKR YY++K+ +++ +DE L QQA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SDI N+S DLK   + F++G PF+PF+QL+AVLPA S  LLP CY  LM  ENSPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLL AME    +++  +  RN H         P I F ++++   + ++ P      +    +P     V  D + +          GFPT +H++H F  +K+GV +F+ S+ G +++L I P Q      +++A + + +  FVNWP   E +++AV +   +++L E     K+  K S         LS+ +     +     +    +R  I I+ T+ ++   + +  K    D        V+L+  W+     +  Q    + + I+ F S S+  +  L +LFP   TVF +   YYG  G V+   +      I++V     EP + ++    I NQ+ ++ + S  Y   + L       SR +G+I+I      + S+RN   +  + ++GL+LK NK N ++PG+      + S+ +W YS  V +++ EY  RF EVF+ +      + + DD+F   D+ P       +++ E+  +L + P  ++ R S D Q+++ + +  IE++++       + K  RV +    L+ P   L GV PD  A+++L DRVV I +G+TVPLGL+G VIGI+  + +   L EVLFD +F   + IR +  R YR+PP+ LIN+S G+R
Sbjct:  429 EFRQYKRTYYMTKMAVDVVSDEFLAQQAKCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRNIS-DLK---LTFELGEPFMPFQQLLAVLPAASMGLLPECYRHLMTSENSPIIEYYPVDFKTDLNGKQQEWEAVVLIPFIDEKRLLAAMEPYNHKLTKEEKDRNGHKECAVYSYDPEIDFTYTST---LPQLFPNIVHCRVRKANIPVDAWHVSSDHVVKHADRSSLYFCGFPTLQHIKHKFYKKKSGVVVFQQSSRGENMMLEILPTQEGEMICDNVAAQVLGKPVFVNWPHLEEARIVAVSDGETKFILEEPPGVQKVYDKPSSPPPTKVTYLSDKEQKDWVKDVQGITEFYLKRKGIVINDTDVVLYGQLLTGRKYVPQDK-----GAVELEKQWAKQVLPFAYQ---AVVKDIEAFYS-SLTSFKSLDELFPPATTVFMVGAPYYGAMGEVQDSQDVLKDGRIRVVFSVPHEPQMDHL----IQNQHKYSVRYSPGYVLASRLGISGYLVSRFSGSIFIG-----RGSKRNPCGE-QKSNVGLNLKFNKKNEEVPGYT-----KRSEKEWLYSAAVEELLAEYLDRFSEVFDAV-----SRNSHDDIFYEDDIWPGVDQNGAERVAEITSWLRSHPVSSISRASCDLQVLDAAIVEKIEEAVE-KTKIKKSTKKVRVTVKPHLLFRPLEQLQGVVPDPDAEYRLFDRVVNIREGFTVPLGLRGTVIGIKGAEREAEVLYEVLFDEEFAGGLIIRCASPRAYRLPPFALINLSHGVR 1176          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Match: xrn1 (5'-3' exoribonuclease 1 [Source:NCBI gene;Acc:101169885])

HSP 1 Score: 381.719 bits (979), Expect = 1.505e-138
Identity = 180/269 (66.91%), Postives = 215/269 (79.93%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIA-EETKFFLLHLSLLREYIDYEFNALREH 839
            MGVPKF+RWISERYPCLS  V  +QIP+FD LYLDMNGIIH CSHP+D +V FRI+E  IF ++F+Y+E LF+I+KP+ VFF+AVDGVAPRAKMNQQR RRF+SAKEA ++   A+  G  +P E RFDSN ITPGT+FM RLQ+ L  F+ NK+ TD LW  V V LSGHETPGEGEHKI EFIR   S P ++PNT+HCLYGLDADL++LGL SHEP+FSLLREEV F  KK+++   A EET F LLHLSL+REYIDYEF+ L+ H
Sbjct:    1 MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDEDVHFRISEEKIFADIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKALDKGEVLPTEARFDSNCITPGTDFMARLQEQLKYFVHNKLSTDKLWHNVKVYLSGHETPGEGEHKIMEFIRSENSKPSHDPNTRHCLYGLDADLIMLGLTSHEPHFSLLREEVRFGGKKSQKRITAPEETTFHLLHLSLMREYIDYEFSWLKNH 269          

HSP 2 Score: 134.035 bits (336), Expect = 1.505e-138
Identity = 65/135 (48.15%), Postives = 86/135 (63.70%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSAN---NNQSDLDVSLCNI 1225
            K  L   Y LERIIDDWI+M FL+GNDF+PHLPNLHI+  ALP L++TYI+V P L GY+N  G L+L NF KY++ LS FDR +F + + D++W   K G +   E   L  +K SA    N + D  + L  +
Sbjct:  267 KNHLGSAYDLERIIDDWILMGFLVGNDFIPHLPNLHINHDALPMLYKTYISVLPSLGGYLNENGHLNLKNFEKYMEKLSEFDREHFNEVFVDLKWFESKVGNKYLNESAGLAAEKESAGKKFNKKKDASLGLSAL 401          

HSP 3 Score: 403.29 bits (1035), Expect = 1.018e-115
Identity = 264/789 (33.46%), Postives = 423/789 (53.61%), Query Frame = 2
Query: 1544 FWNLQFRTYKRDYYLSKLGLNL-TDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVH--------GPHIKFRFSNSGLVISEIAPETFRIPMSSI-VPGLCPKVLLDVICQ----------GFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITP-QNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEK---SKLIVKQS---------LSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINN--SSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASE-YTDMNSLAF-----SRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVF-SKDVLP-------QKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRL-EVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLR 3760
             +  +FR YKR YY++K+ +++ +DE L QQA  YV  +QWI  YY+ GV SWSW+YP HYAPF+SDI N+S DLK   + F++G PF+PF+QL+AVLPA S  LLP CY  LM  ENSPII++YP  F+TDLNGK++EWEAVVLIPFI+EKRLL AME    +++  +  RN H         P I F ++++   + ++ P      +    +P     V  D + +          GFPT +H++H F  +K+GV +F+ S+ G +++L I P Q      +++A + + +  FVNWP   E +++AV +   +++L E     K+  K S         LS+ +     +     +    +R  I I+ T+ ++   + +  K    D        V+L+  W+     +  Q    + + I+ F S S+  +  L +LFP   TVF +   YYG  G V+   +      I++V     EP + ++    I NQ+ ++ + S  Y   + L       SR +G+I+I      + S+RN   +  + ++GL+LK NK N ++PG+      + S+ +W YS  V +++          F  I K    + + DD+F   D+ P       +++ E+  +L + P  ++ R S D Q+++ + +  IE++++       + K  RV +    L+ P   L GV PD  A+++L DRVV I +G+TVPLGL+G VIGI+  + +   L EVLFD +F   + IR +  R YR+PP+ LIN+S G+R
Sbjct:  425 LFETEFRQYKRTYYMTKMAVDVVSDEFLAQQAKCYVEGIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRNIS-DLK---LTFELGEPFMPFQQLLAVLPAASMGLLPECYRHLMTSENSPIIEYYPVDFKTDLNGKQQEWEAVVLIPFIDEKRLLAAMEPYNHKLTKEEKDRNGHKECAVYSYDPEIDFTYTST---LPQLFPNIVHCRVRKANIPVDAWHVSSDHVVKHADRSSLYFCGFPTLQHIKHKFYKKKSGVVVFQQSSRGENMMLEILPTQEGEMICDNVAAQVLGKPVFVNWPHLEEARIVAVSDGETKFILEEPPGVQKVYDKPSSPPPTKVTYLSDKEQKDWVKDVQGITEFYLKRKGIVINDTDVVLYGQLLTGRKYVPQDK-----GAVELEKQWAKQVLPFAYQ---AVVKDIEAFYS-SLTSFKSLDELFPPATTVFMVGAPYYGAMGEVQDSQDVLKDGRIRVVFSVPHEPQMDHL----IQNQHKYSVRYSPGYVLASRLGISGYLVSRFSGSIFIG-----RGSKRNPCGE-QKSNVGLNLKFNKKNEEVPGYT-----KRSEKEWLYSAAVEELLY--------YFAAISKEKMSRNSHDDIFYEDDIWPGVDQNGAERVAEITSWLRSHPVSSISRASCDLQVLDAAIVEKIEEAVE-KTKIKKSTKKVRVTVKPHLLFRPLEQLQGVVPDPDAEYRLFDRVVNIREGFTVPLGLRGTVIGIKGAEREAEVLYEVLFDEEFAGGLIIRCASPRAYRLPPFALINLSHGVR 1173          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:101163131])

HSP 1 Score: 238.039 bits (606), Expect = 2.091e-74
Identity = 135/322 (41.93%), Postives = 183/322 (56.83%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSV--------SVDNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDEK---RFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEET------------------------------KFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP + V          +  +IP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE   IQ G  +P E+   RFDSN ITPGTEFMD L   L  ++  ++  D  W+ V V LS    PGEGEHKI +FIR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   K R   +  +T                              +F  + L +LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVHCVEEKGKECNGVRIPVDTTKPNPNEVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELVDEKQRMRE-EIIQRGGYLPPEEIKERFDSNCITPGTEFMDNLAHCLRYYVAERLSNDPGWKNVVVFLSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREE--FKPNKPRPCSLCGQTGHEMKDCQGVAREKQGQHDEFADTMPVSEQEFIFIRLCVLREYLEREL 317          

HSP 2 Score: 63.929 bits (154), Expect = 2.091e-74
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +  ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    ED
Sbjct:  326 FDFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVNIYKDVVHKTGGYLTQNGYVNLERVEMIMQAVGVAEDNIFKKRKED 410          

HSP 3 Score: 140.969 bits (354), Expect = 2.181e-33
Identity = 72/174 (41.38%), Postives = 100/174 (57.47%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGR-PFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  +++TD    ++    YV  L W+  YY+ G  SW W++P HYAPF SD      D+KE   +F+    PF P EQLM+V PA S   LP  + +LM    S IIDFYP  F  DLNGKK  W+ V L+PF++E+RL  A+      ++P + RRN  G  + F
Sbjct:  527 WKQRYYKNKFDVDVTDSDFRKKVVQSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFK----DIKEMFTEFEKDTMPFKPLEQLMSVFPAASGNFLPPTWRNLMVSPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYPDLTPEEARRNSLGSDVLF 696          
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:101163131])

HSP 1 Score: 237.269 bits (604), Expect = 3.036e-74
Identity = 135/322 (41.93%), Postives = 183/322 (56.83%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSV--------SVDNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAIN--------REIAAIQSGIEIPDEK---RFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEET------------------------------KFFLLHLSLLREYIDYEF 821
            MGVP FFRW+S +YP + V          +  +IP           +FD LYLDMNGIIH C+HP+D       NE ++   +F YI+ LF IV+P+ V ++A+DGVAPRAKMNQQR+RRF+++KE +         RE   IQ G  +P E+   RFDSN ITPGTEFMD L   L  ++  ++  D  W+ V V LS    PGEGEHKI +FIR +R+ P+++PNT HCL G DADL++LGLA+HEP F+++REE  F   K R   +  +T                              +F  + L +LREY++ E 
Sbjct:    1 MGVPAFFRWLSRKYPSIIVHCVEEKGKECNGVRIPVDTTKPNPNEVEFDNLYLDMNGIIHPCTHPEDKPAP--KNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELVDEKQRMRE-EIIQRGGYLPPEEIKERFDSNCITPGTEFMDNLAHCLRYYVAERLSNDPGWKNVVVFLSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREE--FKPNKPRPCSLCGQTGHEMKDCQGVAREKQGQHDEFADTMPVSEQEFIFIRLCVLREYLEREL 317          

HSP 2 Score: 63.5438 bits (153), Expect = 3.036e-74
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYED 1105
            +  ER +DDW+ M F +GNDF+PHLP+L I   A+  L   Y +V  +  GY+   G ++L      + A+ + + N F    ED
Sbjct:  326 FDFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVNIYKDVVHKTGGYLTQNGYVNLERVEMIMQAVGVAEDNIFKKRKED 410          

HSP 3 Score: 140.584 bits (353), Expect = 4.350e-33
Identity = 72/174 (41.38%), Postives = 100/174 (57.47%), Query Frame = 2
Query: 1568 YKRDYYLSKLGLNLTDEALVQQA-NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGR-PFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKF 2083
            +K+ YY +K  +++TD    ++    YV  L W+  YY+ G  SW W++P HYAPF SD      D+KE   +F+    PF P EQLM+V PA S   LP  + +LM    S IIDFYP  F  DLNGKK  W+ V L+PF++E+RL  A+      ++P + RRN  G  + F
Sbjct:  527 WKQRYYKNKFDVDVTDSDFRKKVVQSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFK----DIKEMFTEFEKDTMPFKPLEQLMSVFPAASGNFLPPTWRNLMVSPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYPDLTPEEARRNSLGSDVLF 696          
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 2517.65 bits (6524), Expect = 0.000e+0
Identity = 1250/1265 (98.81%), Postives = 1254/1265 (99.13%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNN-DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLRXXXXXXXXXXXXXXXXXTDCVTEVSPNIVDLSSQYEYQYRTXXXXXXXXXMSKINSQHCKTQKSPNKSVEQQKSINSTPGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVHESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIQQVSNQIKQMSISCFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 4621
            + TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYI VRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLI+FDFEENENILIGGGTKKVDGEITTFPLNNNN DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSL FSRITGTIYINLSTEEQKSRRNDRNKA+QCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVI VV EYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFG+RKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNH QQQNMSKINSQHCKTQKSPNKSVEQQKSINST GFPSIPISSSDFVDKFVNKQKNFIAHCNELFV ESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLI QVSNQIKQMSIS FNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK
Sbjct:  133 RETLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYIKVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIQFDFEENENILIGGGTKKVDGEITTFPLNNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLGFSRITGTIYINLSTEEQKSRRNDRNKAAQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVINVVKEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGMRKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNHHQQQNMSKINSQHCKTQKSPNKSVEQQKSINSTAGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVQESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIHQVSNQIKQMSISYFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 1397          

HSP 2 Score: 278.485 bits (711), Expect = 9.526e-76
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 3
Query:  441 GTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            GTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE
Sbjct:    3 GTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 134          
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 2517.65 bits (6524), Expect = 0.000e+0
Identity = 1250/1265 (98.81%), Postives = 1254/1265 (99.13%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNN-DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLRXXXXXXXXXXXXXXXXXTDCVTEVSPNIVDLSSQYEYQYRTXXXXXXXXXMSKINSQHCKTQKSPNKSVEQQKSINSTPGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVHESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIQQVSNQIKQMSISCFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 4621
            + TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYI VRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLI+FDFEENENILIGGGTKKVDGEITTFPLNNNN DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSL FSRITGTIYINLSTEEQKSRRNDRNKA+QCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVI VV EYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFG+RKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNH QQQNMSKINSQHCKTQKSPNKSVEQQKSINST GFPSIPISSSDFVDKFVNKQKNFIAHCNELFV ESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLI QVSNQIKQMSIS FNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK
Sbjct:  127 RETLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYIKVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIQFDFEENENILIGGGTKKVDGEITTFPLNNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLGFSRITGTIYINLSTEEQKSRRNDRNKAAQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVINVVKEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGMRKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNHHQQQNMSKINSQHCKTQKSPNKSVEQQKSINSTAGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVQESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIHQVSNQIKQMSISYFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 1391          

HSP 2 Score: 269.626 bits (688), Expect = 5.330e-73
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 3
Query:  453 MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE
Sbjct:    1 MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 128          
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 2514.18 bits (6515), Expect = 0.000e+0
Identity = 1250/1265 (98.81%), Postives = 1254/1265 (99.13%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNN-DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLRXXXXXXXXXXXXXXXXXTDCVTEVSPNIVDLSSQYEYQYRTXXXXXXXXXMSKINSQHCKTQKSPNKSVEQQKSINSTPGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVHESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIQQVSNQIKQMSISCFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 4621
            + TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYI VRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLI+FDFEENENILIGGGTKKVDGEITTFPLNNNN DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSL FSRITGTIYINLSTEEQKSRRNDRNKA+QCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVI VV EYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFG+RKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNH QQQNMSKINSQHCKTQKSPNKSVEQQKSINST GFPSIPISSSDFVDKFVNKQKNFIAHCNELFV ESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLI QVSNQIKQMSIS FNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK
Sbjct:  266 RETLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYIKVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIQFDFEENENILIGGGTKKVDGEITTFPLNNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLGFSRITGTIYINLSTEEQKSRRNDRNKAAQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVINVVKEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGMRKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNHHQQQNMSKINSQHCKTQKSPNKSVEQQKSINSTAGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVQESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIHQVSNQIKQMSISYFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 1530          

HSP 2 Score: 560.451 bits (1443), Expect = 1.373e-172
Identity = 267/267 (100.00%), Postives = 267/267 (100.00%), Query Frame = 3
Query:   36 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE
Sbjct:    1 MGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 267          
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 2435.22 bits (6310), Expect = 0.000e+0
Identity = 1218/1265 (96.28%), Postives = 1222/1265 (96.60%), Query Frame = 2
Query:  830 KRTLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNN-DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLAFSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGLRXXXXXXXXXXXXXXXXXTDCVTEVSPNIVDLSSQYEYQYRTXXXXXXXXXMSKINSQHCKTQKSPNKSVEQQKSINSTPGFPSIPISSSDFVDKFVNKQKNFIAHCNELFVHESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIQQVSNQIKQMSISCFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 4621
            + TLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYI VRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLI+FDFEENENILIGGGTKKVDGEITTFPLNNNN DAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSL FSRITGTIYINLSTEEQKSRRNDRNKA+QCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVI VV EYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFG+RKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNH QQQNMSKINSQHCKTQKSPNKSVEQQKSINST                                  ESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLI QVSNQIKQMSIS FNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK
Sbjct:  127 RETLKEEYSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYIKVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLVVQMESMNIDKDLIQFDFEENENILIGGGTKKVDGEITTFPLNNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSFKLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPAFIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIFRRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHWHLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVVESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLGFSRITGTIYINLSTEEQKSRRNDRNKAAQCSMGLDLKNNKSNLQIPGWVVKVKCENSQNKWQYSMKVINVVKEYRMRFPEVFEFIKKPNFEKLTMDDVFSKDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQYASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTVPLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTLINISFGMRKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQNNHHQQQNMSKINSQHCKTQKSPNKSVEQQKSINST----------------------------------ESHPEIVYTVHNCIPDYRDFFIFCLEYGVAEPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIHQVSNQIKQMSISYFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSVYKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK 1357          

HSP 2 Score: 269.626 bits (688), Expect = 4.535e-73
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 3
Query:  453 MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 836
            MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE
Sbjct:    1 MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAYIAEETKFFLLHLSLLREYIDYEFNALRE 128          
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000047308.1 (SMESG000047308.1)

HSP 1 Score: 239.195 bits (609), Expect = 4.120e-111
Identity = 131/316 (41.46%), Postives = 185/316 (58.54%), Query Frame = 3
Query:   36 MGVPKFFRWISERYP------------CLSVSVDNNQIP-----------DFDCLYLDMNGIIHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVAPRAKMNQQRARRFKSAKEAINREIAA-------IQSGIEIPDEK----RFDSNAITPGTEFMDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRRSLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREE------------------------VTFSKKKTRRAYIAEETKFFLLHLSLLREYI 809
            MGVP FFRW+S +Y             C+S   D  Q+P           +FD LYLDMNGIIH C+HP+  N     NE ++F  +F YI+ +F +V+P+ + ++AVDGVAPRAKMNQQR+RRF++ KE   + +         +Q G ++P+ K     FDSN ITPGT FM RL   L  ++  K+++D  W+ + V LS    PGEGEHKI ++IR +R+ P ++PNTKHCL G DADL++LGLA+HEPYF+++REE                        +T ++  T       ET+F  +HL++LREY+
Sbjct:    1 MGVPAFFRWLSLKYSQIVSHCIEEKGKCIS---DTEQLPVDTSQPNPNKIEFDNLYLDMNGIIHPCTHPE--NKPAPKNEDEMFYEIFLYIDRIFSVVRPRKLIYMAVDGVAPRAKMNQQRSRRFRAGKETREKHLTMERIRTELLQKGAKLPEPKDPSEHFDSNCITPGTPFMARLALTLQYYVYYKLESDPGWKNIQVFLSDASAPGEGEHKIMDYIRRQRASPTHDPNTKHCLCGADADLIMLGLATHEPYFTIIREEFKPNQPRPCELCGQMNHVMSECTGLTSTEFNTGATNKGAETEFIFIHLNILREYL 311          

HSP 2 Score: 184.496 bits (467), Expect = 4.120e-111
Identity = 137/458 (29.91%), Postives = 219/458 (47.82%), Query Frame = 2
Query:  851 YSLERIIDDWIIMSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLNNFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSANNNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVLSNNLEQEESIFNEENSLV-VQMESMNIDKDLIEFDFEENENILIGGGTKKVDGEITTFPLNNNN-DAGDK-EFWNLQFRTYKRDYYLSKLGLNLTD--EALVQQANEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDFQI-GRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFRFSNSGL-----VISEIAPETFRIPMSSIVPGLCPKVLLDV 2191
            Y  ER IDDW+ M F +GNDF+PHLP+L I   A+  L   Y N   + +G++ + G+++++     +  L++ + +    +  D +    K      +  DN N+ K    N+    +    +  + S+      DSI+                        N+   ES  N  N  V + +E  NI           N N  I  G +K + EI    L N   D  D+ + W   +RT    YY SK G+++ +  E  +  A++Y+  L W+  YY+ G  SW+W+YP HYAPF  D  NLS    +  ++F+   +PF P EQLM V PADS   +P  +  LM +  SP+ID YP  F+ DLNGK+ +W  V L+PF++E RLL+ +  + S ++  +  RN+ GP   F  S+  +     VI E+   T  +   ++  G+  ++  D+
Sbjct:  324 YDFERAIDDWVFMCFFVGNDFLPHLPSLEIREKAIDRLIGIYKNSVQKANGWLTDSGRVNISRVQLIMKDLALLE-DEIFKSRRDNEVSFRK------RNKDNRNRVKRQQLNDNVMFNKHSTDFVNLSTGEKFSRDSIK------------------------NIAIAESKRNATNLPVNIPIEKPNIG----------NSN-FIRPGKRKFE-EIDEEDLKNQELDKRDEVKLWEDGYRTR---YYQSKFGVDVDENPEFCINVAHQYLRGLCWVLAYYYQGCVSWTWYYPYHYAPFAVDFVNLS----DADVEFEKDSKPFNPLEQLMGVFPADSKAHVPPAWQDLMTDHESPVIDLYPTNFKIDLNGKRYDWMGVALLPFVDEVRLLKVLRERHSLLTEEEKERNIIGPDRYFVRSDHPVADVIKVIYELGDTTDSVIDPNLTNGVTGRIWKDL 731          
The following BLAST results are available for this feature:
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XRN13.576e-13567.045'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
XRN13.606e-13567.045'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
XRN16.886e-13467.045'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
XRN23.832e-7542.015'-3' exoribonuclease 2 [Source:HGNC Symbol;Acc:HG... [more]
XRN11.817e-7431.215'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xrn-10.000e+031.435'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;... [more]
xrn-10.000e+031.435'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;... [more]
xrn-23.831e-7139.505'-3' exoribonuclease 2 homolog [Source:UniProtKB... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pcm2.666e-12063.53gene:FBgn0020261 transcript:FBtr0302082[more]
pcm2.779e-12063.53gene:FBgn0020261 transcript:FBtr0074784[more]
Rat13.437e-7642.59gene:FBgn0031868 transcript:FBtr0079345[more]
Rat13.437e-7642.59gene:FBgn0031868 transcript:FBtr0332324[more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xrn11.828e-13767.545'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn13.072e-8864.505'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn26.468e-7541.615'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn26.468e-7541.615'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn21.283e-7441.615'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl292.219e-13466.67ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl294.849e-13466.67ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl295.775e-13466.67ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl291.087e-13366.67ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl291.232e-13366.67ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xrn11.568e-13567.425'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
Xrn11.705e-13567.425'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
Xrn12.550e-13467.425'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
Xrn22.213e-7542.015'-3' exoribonuclease 2 [Source:MGI Symbol;Acc:MGI... [more]
Xrn11.016e-970.275'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22147|XRN1_YEAST1.970e-17155.095'-3' exoribonuclease 1 OS=Saccharomyces cerevisia... [more]
sp|P97789|XRN1_MOUSE9.831e-13567.425'-3' exoribonuclease 1 OS=Mus musculus OX=10090 G... [more]
sp|Q8IZH2|XRN1_HUMAN1.606e-13467.045'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN... [more]
sp|Q5AMG5|XRN2_CANAL7.332e-11544.085'-3' exoribonuclease 2 OS=Candida albicans (strai... [more]
sp|Q2GNZ6|XRN2_CHAGB9.103e-11440.675'-3' exoribonuclease 2 OS=Chaetomium globosum (st... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7QVF60.000e+033.955'-3' exoribonuclease 1 OS=Cryptotermes secundus O... [more]
A0A2J7QVG10.000e+033.955'-3' exoribonuclease 1 OS=Cryptotermes secundus O... [more]
A0A067RFP20.000e+033.965'-3' exoribonuclease 1 OS=Zootermopsis nevadensis... [more]
A0A2J7QVG30.000e+034.235'-3' exoribonuclease 1 (Fragment) OS=Cryptotermes... [more]
A0A154PBK20.000e+033.145'-3' exoribonuclease 1 OS=Dufourea novaeangliae O... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xrn11.042e-12364.795'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn22.298e-7442.955'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1030... [more]
xrn22.316e-7442.955'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1030... [more]
xrn12.877e-7159.765'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn13.372e-4771.155'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
xrn11.659e-12263.975'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn21.394e-4340.115'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
XRN13.488e-17355.09Evolutionarily-conserved 5'-3' exonuclease; compon... [more]
RAT14.713e-11044.30Nuclear 5' to 3' single-stranded RNA exonuclease; ... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423388.593e-4625.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xrn11.408e-13866.915'-3' exoribonuclease 1 [Source:NCBI gene;Acc:1011... [more]
xrn11.492e-13866.915'-3' exoribonuclease 1 [Source:NCBI gene;Acc:1011... [more]
xrn11.505e-13866.915'-3' exoribonuclease 1 [Source:NCBI gene;Acc:1011... [more]
xrn22.091e-7441.935'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1011... [more]
xrn23.036e-7441.935'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of 5'-3' exoribonuclease 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080199.19.526e-7698.81SMESG000080199.1[more]
SMESG000080199.15.330e-7398.81SMESG000080199.1[more]
SMESG000080199.11.373e-17298.81SMESG000080199.1[more]
SMESG000080199.14.535e-7396.28SMESG000080199.1[more]
SMESG000047308.14.120e-11141.46SMESG000047308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010414 ID=SMED30010414|Name=5'-3' exoribonuclease 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4693bp
AATTTTTTAAATTACTTTTTATTTCATTTTTAAAAATGGGAGTGCCGAAA
TTTTTTAGATGGATTAGTGAGCGTTATCCTTGTCTCAGTGTATCTGTTGA
TAATAATCAGATTCCTGATTTCGATTGCTTATATTTGGACATGAATGGAA
TAATACATATATGTTCACATCCTGATGATACTAATGTTCAATTCCGAATA
AACGAATTGGATATATTTAATAATGTTTTTAACTACATTGAATTTTTATT
TAAAATTGTTAAACCTAAAGATGTATTTTTTTTGGCTGTTGACGGAGTTG
CTCCTAGAGCAAAAATGAACCAACAAAGAGCTCGTCGATTCAAATCTGCT
AAAGAAGCTATAAATCGTGAAATCGCTGCTATTCAGAGTGGAATTGAAAT
TCCCGATGAAAAAAGATTTGATTCTAATGCTATTACACCAGGTACTGAAT
TCATGGATCGATTGCAAAAAGCACTCGTGGGTTTTCTTAAGAATAAAATC
CAAACCGATTCTTTATGGCAAGGGGTAGACGTTATTCTTTCGGGACATGA
GACTCCCGGTGAAGGTGAACATAAAATCCAGGAATTTATTAGATACCGCC
GGTCGTTGCCGGACTATAATCCGAACACTAAACATTGTTTATATGGACTT
GATGCCGATTTAATGATTTTGGGTCTCGCCAGCCACGAACCGTATTTTTC
ATTGCTCAGAGAAGAAGTTACTTTTTCGAAAAAGAAAACGAGAAGAGCTT
ATATTGCAGAAGAAACAAAATTCTTTTTACTTCATCTTTCCTTGCTGCGA
GAATACATCGATTATGAATTTAACGCTCTAAGAGAACATTGAAAGAGGAA
TATAGCTTAGAACGTATTATTGATGATTGGATAATAATGAGCTTTCTGAT
TGGAAACGATTTCGTTCCCCATTTACCGAATCTCCATATTCACACTAGTG
CTCTTCCGTTTCTTTGGGAGACATATATCAATGTTCGACCGGAATTAGAT
GGCTACATAAACAATTGTGGAAAACTCCATCTGAATAATTTCCTAAAATA
CGTTGATGCGTTGTCGATATTTGATAGGAATAATTTCCTTGACAATTATG
AAGATATGCAATGGATGCTCGGTAAAACCGGTGAGAGACTGGGCAAAGAA
TTAGACAACCTTAATAAACAGAAACATTCGGCTAATAATAACCAATCGGA
TCTTGATGTTTCATTATGCAATATTTTCGATGATTCGTCATTGGTTGATA
GACAAACCGATTCAATTGAAGAAATAACCAAAAGAATCATTAATTTGGAT
GACGAATTTCCCGACTCTCCGGAAATCCTTGTTTTGTCGAATAATTTAGA
ACAGGAAGAATCGATTTTTAATGAAGAAAACAGCTTAGTAGTTCAAATGG
AGTCCATGAACATCGATAAAGATTTGATCGAGTTTGATTTTGAAGAAAAT
GAAAACATTTTGATTGGAGGAGGCACAAAAAAAGTGGATGGAGAAATAAC
AACGTTTCCCTTAAATAATAATAATGATGCCGGTGATAAGGAGTTTTGGA
ATCTTCAGTTTCGTACTTATAAACGAGATTATTACCTATCAAAACTCGGA
TTGAACTTAACCGATGAAGCTTTAGTTCAACAGGCAAATGAATACGTAAC
CGCTCTCCAGTGGATAAGTTTCTATTATTTTTGCGGTGTTCCCTCGTGGA
GTTGGTTTTATCCCCAACATTATGCACCGTTCATTTCCGATATTTCCAAT
CTCAGTAACGATTTAAAGGAGAACGGTATCGATTTTCAAATCGGTCGACC
TTTTTTACCATTTGAACAATTGATGGCGGTTTTACCGGCCGACAGTTCGG
AATTGTTGCCGTTCTGTTATCATTCATTGATGAAGGAGGAAAATTCTCCG
ATTATTGATTTTTATCCGAAAAAGTTCCGGACCGATTTGAACGGTAAAAA
GAAAGAATGGGAAGCAGTTGTTCTAATTCCATTTATCGAAGAAAAACGAC
TCCTAGAAGCAATGGAATCGAAACAGAGTCAAATTTCCCCCAGCGACATT
CGACGCAATGTCCATGGGCCACACATAAAATTTCGATTTTCCAATTCCGG
TTTGGTAATTTCGGAAATCGCCCCGGAAACTTTCCGAATTCCAATGAGTT
CCATTGTGCCGGGTCTTTGTCCTAAAGTTCTATTGGATGTTATTTGTCAG
GGATTTCCGACTTTCCGTCACGTTGAGCACTCGTTTAAACTGGAAAAGGC
AGGTGTGAAGATATTCGAGTTCTCTGCCAACGGTTCGAGCATTGTTTTGA
GAATTACCCCCCAAAATGTTACTCAATCGATGGAGGATATCGCAAAACGC
TATATCAATGAAATTGCGTTTGTCAATTGGCCGGCCTTTATCGAGGTGAA
AGTAATCGCCGTTCTCAATGAGACTCATCGATATTTACTGAACGAGAAAA
GCAAACTCATTGTTAAGCAGTCTCTCAGTGAAATCGATAATCTAAGAATG
GCGGAATTCAAATCTTGCACTTCGAGAAATATCTTTCGTCGAAGTGCAAT
TTCGATCGATCCGACGAATTTCATTATTCTCGAAACGGTTCATTCGGCAG
GGAAAATCTATGAAATCGACAGCATTCACAAAGCCGGATCGACTGTGAAA
CTGCAGCATGATTGGAGTTCCAATCAAACCCATTGGCATTTGCAACAGTT
ATCGGTGTTGAAGAGATCTATCGATAATTTCTCATCAAATTCGATAAAAG
TCTATAGTAAACTCCATCAACTTTTCCCGAAAAATGCAACTGTTTTCTCA
TTGGCTAAAAAATACTACGGTCGCAAAGGAGTTGTTGAATCGATTAATAA
TTCTTCGGCATCGATTAAAATCGTTTTGGATGAATTTTCCGAACCGATCC
TGCCCAATATCCACATCAACAGTATCGATAATCAATATATGCACGCTGGA
CAGGCATCCGAATATACCGATATGAATTCGTTGGCTTTTTCCAGAATTAC
CGGCACTATCTACATCAATCTATCGACTGAGGAGCAGAAATCGAGACGAA
ACGATCGAAACAAAGCATCCCAGTGTTCGATGGGGTTGGATTTGAAAAAT
AACAAGTCGAATTTGCAAATTCCCGGCTGGGTTGTCAAAGTGAAATGTGA
GAACTCTCAGAATAAATGGCAGTACTCAATGAAGGTGATCAAAGTTGTCA
TAGAGTACCGAATGAGGTTCCCGGAAGTGTTTGAATTTATTAAGAAGCCC
AATTTTGAAAAACTCACTATGGACGATGTTTTTAGCAAAGATGTTCTGCC
ACAAAAAATCACAGAACTCCAGGAATATTTAAATAATTTGCCCTATAAGA
ATTTAGAGAGAATCAGCAATGACTGTCAGATTATTAATGAATCTGACATT
TCACTTATTGAGCAGTCACTAAAAGGTGCTCAGTATGCATCATCCAATGA
GAAATCTTGTCGCGTTGAGCTATCATTTCGTGATCTCTACACACCTCATT
ATTCTCTGCACGGTGTCACACCCGATAAGTCTGCTGATTTTCAGTTGATG
GATCGAGTTGTGTGCATTACCGACGGTTACACTGTTCCGCTCGGTTTGAA
AGGTGTTGTTATCGGTATTGAGCAGAAAAAACTCGATGGGCTTCGCCTTG
AAGTACTGTTCGATAATCAATTCAAGTCCGCCATAAGCATTCGTGGCAGC
GAATGTCGATGTTATCGAATGCCACCTTACACTCTGATTAATATTAGCTT
CGGATTGAGAAAGTCTAATAGCAACAGTAAAGAGTCATCTGTATCGATTA
ATAACAAAAAGACCGACTGTGTAACGGAAGTGTCTCCTAATATCGTTGAC
TTATCTTCGCAATATGAATACCAATATAGAACACAGAATAACCACCAACA
ACAACAAAACATGTCCAAGATTAATAGTCAACATTGTAAAACTCAAAAAT
CCCCGAACAAAAGTGTCGAACAACAAAAATCGATAAATTCCACGCCAGGT
TTTCCTTCGATTCCAATTTCGTCGAGTGATTTTGTAGATAAATTCGTTAA
TAAGCAAAAAAATTTCATTGCCCATTGTAATGAGCTTTTTGTCCACGAAT
CCCACCCGGAAATTGTGTACACAGTTCACAACTGCATTCCCGATTATCGG
GATTTTTTCATATTTTGCCTGGAATATGGGGTTGCAGAGCCGACAGTGAT
CGAAAATGAAGCCAACGGTCATTTTCACTTGATTTTTACCAGTAGTTTTA
TTTCCCTTCCGGAATTCAAAGATGTCAATATTATCAGAGCTCGTCAGAAT
TTAATCCAACAAGTGTCCAATCAGATCAAGCAAATGTCAATTTCATGCTT
TAACGGCTATTCGAAACCTATTAGGCACTTGTACACACCCGAGCAGTTCA
TCAATAATCCATTTCTCGACTTGACCCCACAATTAATGAATAACAACACA
CAGAAATCCCGACAGAACCACAGCTTTACTTCGGTATATAAGGCTCCGTT
GTTGTCACCAGCGCCACCGTCGGTAGGTAAAGTGGCAGTCGATTTGAAAA
AGGAAGGCAAATCCAGTGGTAGAAAGAAATTTATTACCCGCCCAAAACCG
AGAAATCATCTATTTGAGAAATAACGAAATGAATTTATCCGACTTAAGAG
AATAATTTGTTTGGTGTCTTAAAATATAATTGGCTATTTATGA
back to top

protein sequence of SMED30010414-orf-1

>SMED30010414-orf-1 ID=SMED30010414-orf-1|Name=SMED30010414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1246bp
MSFLIGNDFVPHLPNLHIHTSALPFLWETYINVRPELDGYINNCGKLHLN
NFLKYVDALSIFDRNNFLDNYEDMQWMLGKTGERLGKELDNLNKQKHSAN
NNQSDLDVSLCNIFDDSSLVDRQTDSIEEITKRIINLDDEFPDSPEILVL
SNNLEQEESIFNEENSLVVQMESMNIDKDLIEFDFEENENILIGGGTKKV
DGEITTFPLNNNNDAGDKEFWNLQFRTYKRDYYLSKLGLNLTDEALVQQA
NEYVTALQWISFYYFCGVPSWSWFYPQHYAPFISDISNLSNDLKENGIDF
QIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTD
LNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHGPHIKFR
FSNSGLVISEIAPETFRIPMSSIVPGLCPKVLLDVICQGFPTFRHVEHSF
KLEKAGVKIFEFSANGSSIVLRITPQNVTQSMEDIAKRYINEIAFVNWPA
FIEVKVIAVLNETHRYLLNEKSKLIVKQSLSEIDNLRMAEFKSCTSRNIF
RRSAISIDPTNFIILETVHSAGKIYEIDSIHKAGSTVKLQHDWSSNQTHW
HLQQLSVLKRSIDNFSSNSIKVYSKLHQLFPKNATVFSLAKKYYGRKGVV
ESINNSSASIKIVLDEFSEPILPNIHINSIDNQYMHAGQASEYTDMNSLA
FSRITGTIYINLSTEEQKSRRNDRNKASQCSMGLDLKNNKSNLQIPGWVV
KVKCENSQNKWQYSMKVIKVVIEYRMRFPEVFEFIKKPNFEKLTMDDVFS
KDVLPQKITELQEYLNNLPYKNLERISNDCQIINESDISLIEQSLKGAQY
ASSNEKSCRVELSFRDLYTPHYSLHGVTPDKSADFQLMDRVVCITDGYTV
PLGLKGVVIGIEQKKLDGLRLEVLFDNQFKSAISIRGSECRCYRMPPYTL
INISFGLRKSNSNSKESSVSINNKKTDCVTEVSPNIVDLSSQYEYQYRTQ
NNHQQQQNMSKINSQHCKTQKSPNKSVEQQKSINSTPGFPSIPISSSDFV
DKFVNKQKNFIAHCNELFVHESHPEIVYTVHNCIPDYRDFFIFCLEYGVA
EPTVIENEANGHFHLIFTSSFISLPEFKDVNIIRARQNLIQQVSNQIKQM
SISCFNGYSKPIRHLYTPEQFINNPFLDLTPQLMNNNTQKSRQNHSFTSV
YKAPLLSPAPPSVGKVAVDLKKEGKSSGRKKFITRPKPRNHLFEK*
back to top

protein sequence of SMED30010414-orf-2

>SMED30010414-orf-2 ID=SMED30010414-orf-2|Name=SMED30010414-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=280bp
FFKLLFISFLKMGVPKFFRWISERYPCLSVSVDNNQIPDFDCLYLDMNGI
IHICSHPDDTNVQFRINELDIFNNVFNYIEFLFKIVKPKDVFFLAVDGVA
PRAKMNQQRARRFKSAKEAINREIAAIQSGIEIPDEKRFDSNAITPGTEF
MDRLQKALVGFLKNKIQTDSLWQGVDVILSGHETPGEGEHKIQEFIRYRR
SLPDYNPNTKHCLYGLDADLMILGLASHEPYFSLLREEVTFSKKKTRRAY
IAEETKFFLLHLSLLREYIDYEFNALREH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000422tail stripe
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR0270735_3_exoribonuclease
IPR0164945_3_exoribonuclease_1
IPR004859Put_53exo
Vocabulary: molecular function
TermDefinition
GO:0004527exonuclease activity
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004518nuclease activity
GO:00084095'-3' exonuclease activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000956nuclear-transcribed mRNA catabolic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004859Putative 5-3 exonucleasePFAMPF03159XRN_Ncoord: 12..238
e-value: 2.2E-90
score: 302.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.12390coord: 141..280
e-value: 9.9E-54
score: 184.6
coord: 12..139
e-value: 2.4E-46
score: 160.4
NoneNo IPR availableCDDcd18673PIN_XRN1-2-likecoord: 43..269
e-value: 1.1872E-128
score: 363.053
IPR0270735'-3' exoribonucleasePANTHERPTHR123415'->3' EXORIBONUCLEASEcoord: 12..277
IPR0164945'-3' exoribonuclease 1PANTHERPTHR12341:SF75'-3' EXORIBONUCLEASE 1coord: 12..277