Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30010386
Length (bp)1834
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30010386) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30010386) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30010386) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30010386) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010386

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30010386SMESG000024811.1 SMESG000024808.1 dd_Smed_v4_9935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010386SMESG000024811.1 SMESG000024808.1 dd_Smed_v4_9935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30010386SMESG000024811.1 SMESG000024808.1 dd_Smed_v4_9935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010386SMESG000024811.1 SMESG000024808.1 dd_Smed_v4_9935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010386SMESG000024811.1 SMESG000024808.1 dd_Smed_v4_9935_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 167.933 bits (424), Expect = 2.170e-45
Identity = 99/268 (36.94%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   24 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 168.318 bits (425), Expect = 2.406e-45
Identity = 99/268 (36.94%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   36 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 164.851 bits (416), Expect = 1.579e-44
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKN--------NPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 164.851 bits (416), Expect = 2.185e-44
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPK--------NNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK25 (serine/threonine kinase 25 [Source:HGNC Symbol;Acc:HGNC:11404])

HSP 1 Score: 160.614 bits (405), Expect = 8.715e-43
Identity = 95/262 (36.26%), Postives = 149/262 (56.87%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +++    V A+K I L + E+           + + D+ +I +YFGS  ++ K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SDL  ++++F I +    T + ++  S+    F+   L+  P  R TA ELLK    ++  KK
Sbjct:   20 FTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLK---PGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQH--SKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKK 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 161.384 bits (407), Expect = 4.788e-42
Identity = 99/271 (36.53%), Postives = 156/271 (57.56%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP--------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K +++R  RV A+K I L   E+  + I+  I   + + D++++ KYFGS  +  K++I MEYL GGS  +L  +   D  H   I++    IL+GL+YLH    IHRD+K AN+L+ E+ D K+ DFG++ +L E+     TF G+ ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I          KNPP        S+    F+   L+  P +R +A  LLK   F K  KK
Sbjct:   19 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQ-VLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILR---EILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLI---------PKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQ-FIKRAKK 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 160.999 bits (406), Expect = 5.359e-42
Identity = 99/271 (36.53%), Postives = 156/271 (57.56%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP--------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K +++R  RV A+K I L   E+  + I+  I   + + D++++ KYFGS  +  K++I MEYL GGS  +L  +   D  H   I++    IL+GL+YLH    IHRD+K AN+L+ E+ D K+ DFG++ +L E+     TF G+ ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I          KNPP        S+    F+   L+  P +R +A  LLK   F K  KK
Sbjct:   14 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQ-VLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILR---EILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLI---------PKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQ-FIKRAKK 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 161.384 bits (407), Expect = 5.701e-42
Identity = 99/271 (36.53%), Postives = 156/271 (57.56%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP--------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K +++R  RV A+K I L   E+  + I+  I   + + D++++ KYFGS  +  K++I MEYL GGS  +L  +   D  H   I++    IL+GL+YLH    IHRD+K AN+L+ E+ D K+ DFG++ +L E+     TF G+ ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I          KNPP        S+    F+   L+  P +R +A  LLK   F K  KK
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQ-VLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILR---EILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLI---------PKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQ-FIKRAKK 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 160.614 bits (405), Expect = 2.471e-41
Identity = 99/271 (36.53%), Postives = 156/271 (57.56%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP--------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K +++R  RV A+K I L   E+  + I+  I   + + D++++ KYFGS  +  K++I MEYL GGS  +L  +   D  H   I++    IL+GL+YLH    IHRD+K AN+L+ E+ D K+ DFG++ +L E+     TF G+ ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I          KNPP        S+    F+   L+  P +R +A  LLK   F K  KK
Sbjct:  184 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQ-VLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILR---EILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLI---------PKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQ-FIKRAKK 440          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.147 bits (396), Expect = 1.300e-40
Identity = 98/271 (36.16%), Postives = 157/271 (57.93%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLD-ENDDCKLIDFGLSRLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP--------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K +++R  RV A+K I L   E+  + I+  I   + + D++++ KYFGS  +  K++I MEYL GGS  +L  +   D  H   I++    IL+GL+YLH    IHRD+K AN+LLD +    K+ D+G+++ +++   + TF GT ++M+PE++  E YS  +DIWS+G T +E+  G+PP+SDL  ++++F I          KNPP        S+    F+   L+  P +R +A  LLK   F K  KK
Sbjct:   14 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQ-VLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILR---EILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANTFVGTPFFMAPEVVKGE-YSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLI---------PKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQ-FIKRAKK 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 162.925 bits (411), Expect = 1.798e-42
Identity = 96/269 (35.69%), Postives = 155/269 (57.62%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVEN-TKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIE--SGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +VFK +++R  +V A+K I L + E+    I+  I   + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     + +H   I++    +L+GLDYLH    +HRD+K AN+LL E  D KL DFG++  +   +   +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP S+L  ++++F I +         NPP      +++   F+   L+  P +R TA ELLK   F K  KK
Sbjct:   13 FTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIM-VLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGSFEEMHIGIILR---EVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPK--------NNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYP-FIKKAKK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 156.762 bits (395), Expect = 2.928e-40
Identity = 92/255 (36.08%), Postives = 143/255 (56.08%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVK 1295
            L  GS+  V+K V    + + A+K + +    +  + E +I   M++ D+ ++V+Y+GS  + Y ++I MEY   GS+S+ I+      L  D+I       LQGL YLH    IHRD+K ANILL+     KL DFG++  +       +T  GT ++M+PE+I E  Y C +DIWS+G T +EM  GKPPY ++  ++ IF I Q+   +++  +  S     F++K L   P DR TA ELL+ + F +N K
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISI---MQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSD-IMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHE-FIRNAK 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 156.762 bits (395), Expect = 2.928e-40
Identity = 92/255 (36.08%), Postives = 143/255 (56.08%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVK 1295
            L  GS+  V+K V    + + A+K + +    +  + E +I   M++ D+ ++V+Y+GS  + Y ++I MEY   GS+S+ I+      L  D+I       LQGL YLH    IHRD+K ANILL+     KL DFG++  +       +T  GT ++M+PE+I E  Y C +DIWS+G T +EM  GKPPY ++  ++ IF I Q+   +++  +  S     F++K L   P DR TA ELL+ + F +N K
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISI---MQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSD-IMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHE-FIRNAK 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 135.576 bits (340), Expect = 9.784e-33
Identity = 91/275 (33.09%), Postives = 150/275 (54.55%), Query Frame = 3
Query:  504 FTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEF-PDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDE-NDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEIINE--EPYSCTSDIWSVGATVVEMLTGKPPYSDL-SQIQIIFKIVQEKKITYKAKNPPSE---TLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            +  +E +++  L  G++  V+   + +     A+K++  ++ ++ + +   I     +L +++IV+Y GS  EN    IFME +PGGS+S+L+ T++ P   +   +  YS+ IL+GL YLH+  I+HRD+K  N+L++  +   K+ DFG S+ +    P   TF GTL YM+PE+I++    Y   +DIWS G T VEM TGKPP+ +L S    +FK+   K    K  N P E       FI +  +    DR +A +LL+        +K
Sbjct:  413 YDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIK-LHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYK----KHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRK 682          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 135.191 bits (339), Expect = 1.164e-32
Identity = 91/275 (33.09%), Postives = 150/275 (54.55%), Query Frame = 3
Query:  504 FTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEF-PDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDE-NDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEIINE--EPYSCTSDIWSVGATVVEMLTGKPPYSDL-SQIQIIFKIVQEKKITYKAKNPPSE---TLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            +  +E +++  L  G++  V+   + +     A+K++  ++ ++ + +   I     +L +++IV+Y GS  EN    IFME +PGGS+S+L+ T++ P   +   +  YS+ IL+GL YLH+  I+HRD+K  N+L++  +   K+ DFG S+ +    P   TF GTL YM+PE+I++    Y   +DIWS G T VEM TGKPP+ +L S    +FK+   K    K  N P E       FI +  +    DR +A +LL+        +K
Sbjct:  580 YDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIK-LHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYK----KHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRK 849          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24a (serine/threonine kinase 24a (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070424-52])

HSP 1 Score: 171.014 bits (432), Expect = 9.513e-47
Identity = 103/269 (38.29%), Postives = 157/269 (58.36%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVEN-TKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+  + I+  I   + + D+  I KYFGS  ++ K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +E        NPP+      + L  F+   L+  P+ R TA ELLK  +  +  KK
Sbjct:   17 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEVEDIQQEIT-VLSQCDSLFITKYFGSYLKDTKLWIIMEYLGGGSALDLL---GPGALDETHIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSEYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKE--------NPPTLEGNYNKALKEFVDACLNKDPNFRPTAKELLKHKLIVRYSKK 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 164.851 bits (416), Expect = 1.480e-44
Identity = 97/268 (36.19%), Postives = 153/268 (57.09%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP+      + L  F+   L+  PS R TA ELLK  +  +  KK
Sbjct:   12 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLE---PGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRFAKK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 164.466 bits (415), Expect = 2.555e-44
Identity = 97/268 (36.19%), Postives = 153/268 (57.09%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP+      + L  F+   L+  PS R TA ELLK  +  +  KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRFAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk25b (serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-GENE-040426-2537])

HSP 1 Score: 160.614 bits (405), Expect = 5.713e-43
Identity = 94/262 (35.88%), Postives = 147/262 (56.11%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K + +R   V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GL+YLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SDL  ++++F I +    T +     S+    F+   L+  P  R TA ELLK    ++  KK
Sbjct:   20 FTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLK---PGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEGSY--SKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKK 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk26 (serine/threonine protein kinase 26 [Source:ZFIN;Acc:ZDB-GENE-080516-5])

HSP 1 Score: 157.147 bits (396), Expect = 8.250e-42
Identity = 94/262 (35.88%), Postives = 145/262 (55.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK ++ +   V A+K I L + E+           + + D+ H+ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++     TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +    T       S+    F+   L+  P+ R TA ELLK     K  KK
Sbjct:   24 FTKLDRIGKGSFGEVFKGIDRQTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPHVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEYQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDF--SKIFKEFVDSCLNKDPAFRPTAKELLKHKFIVKYAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 164.466 bits (415), Expect = 1.327e-44
Identity = 99/268 (36.94%), Postives = 148/268 (55.22%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +E+R   V A+K I L + E+           + + D+ +I +Y+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PPYSDL  ++++F I +         NPP      S+    F+   L+  P  R TA ELLK     +  KK
Sbjct:    7 FTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLK---PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPK--------NNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKK 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: slc39a7 (solute carrier family 39 member 7 [Source:Xenbase;Acc:XB-GENE-492963])

HSP 1 Score: 164.466 bits (415), Expect = 2.201e-44
Identity = 97/268 (36.19%), Postives = 154/268 (57.46%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R +A ELLK     ++ KK
Sbjct:   22 FRKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKGLKEFVEACLNKEPSFRPSAKELLKHKFIMRSAKK 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 164.466 bits (415), Expect = 2.204e-44
Identity = 99/268 (36.94%), Postives = 148/268 (55.22%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +E+R   V A+K I L + E+           + + D+ +I +Y+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PPYSDL  ++++F I +         NPP      S+    F+   L+  P  R TA ELLK     +  KK
Sbjct:    7 FTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLK---PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPK--------NNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKK 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 164.466 bits (415), Expect = 2.352e-44
Identity = 99/268 (36.94%), Postives = 148/268 (55.22%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +E+R   V A+K I L + E+           + + D+ +I +Y+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PPYSDL  ++++F I +         NPP      S+    F+   L+  P  R TA ELLK     +  KK
Sbjct:    7 FTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLK---PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPK--------NNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKK 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 164.081 bits (414), Expect = 2.576e-44
Identity = 99/268 (36.94%), Postives = 148/268 (55.22%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +E+R   V A+K I L + E+           + + D+ +I +Y+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PPYSDL  ++++F I +         NPP      S+    F+   L+  P  R TA ELLK     +  KK
Sbjct:   19 FTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLK---PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPK--------NNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKK 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 167.162 bits (422), Expect = 2.919e-45
Identity = 99/268 (36.94%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   24 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 164.466 bits (415), Expect = 1.467e-44
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKN--------NPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 164.466 bits (415), Expect = 2.131e-44
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPK--------NNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 159.458 bits (402), Expect = 1.558e-42
Identity = 95/262 (36.26%), Postives = 148/262 (56.49%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +V+K +++    V A+K I L + E+           + + D+ +I +YFGS  ++ K++I MEYL GGS  +L+    P  L    I    + IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SDL  ++++F I +    T +  +  S+    F+   L+  P  R TA ELLK    ++  KK
Sbjct:   20 FTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLK---PGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGHH--SKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKK 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 158.688 bits (400), Expect = 1.120e-41
Identity = 93/255 (36.47%), Postives = 145/255 (56.86%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIES-GYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVK 1295
            L  GS+  VFK +     +V A+K++ +       + E +I   M++ D+ ++VKY+GS  +N  ++I MEY   GS+S++I       L  D+I    +  L+GL+YLH    IHRD+K  NILL+     KL DFG++ +L ++    +T  GT ++M+PE+I E  Y+C +DIWS+G T +EM  GKPPY+D+  ++ IF I      T++     S+  + F+ K L   P  R TA +LL+   F KN K
Sbjct:   31 LGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISI---MQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRN-KTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHP-FIKNAK 280          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y6E0|STK24_HUMAN (Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.155e-44
Identity = 99/268 (36.94%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   36 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKK 292          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99KH8|STK24_MOUSE (Serine/threonine-protein kinase 24 OS=Mus musculus OX=10090 GN=Stk24 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.042e-44
Identity = 99/268 (36.94%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   24 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKK 280          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|B0LT89|STK24_RAT (Serine/threonine-protein kinase 24 OS=Rattus norvegicus OX=10116 GN=Stk24 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.305e-44
Identity = 99/268 (36.94%), Postives = 154/268 (57.46%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S  L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   24 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL---EPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGSYSRPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKK 280          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P289|STK26_HUMAN (Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 1.049e-43
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPK--------NNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99JT2|STK26_MOUSE (Serine/threonine-protein kinase 26 OS=Mus musculus OX=10090 GN=Stk26 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.491e-43
Identity = 99/268 (36.94%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +         NPP      +++   FI   L+  PS R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPK--------NNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK 280          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.483e-55
Identity = 147/439 (33.49%), Postives = 225/439 (51.25%), Query Frame = 3
Query:   72 FNRFLDAIKSNDLAAVEADYLPEFID-KSESGGMYPVHLACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSER--STEIKEILEKSN----------------------EN-----------RKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIES-----GYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELL 1265
            F + + AIK   +  V+  Y    ++ K  S    P+  AC     ++ K+ +K KCN++S D +  R +HYA+ S   +IVKLLI S   ++  + LL M   L+ +  + E  ++L ++N                      EN           R+   EM+L C   CNHKFC  SF   +      + +GS+  VF   ES  +R FAVKKI  +++   + IE NIN+F   L ++ IVK+FG+  +    +IFMEYL       L   ++      D ++ +++ IL+ L +LH+  IIHRD+KP N+LLD + + KL DFGLS L+ S           CGT  Y +PEI+N E Y+C+ DIWS+GAT++++ TG+PPY +L    II  I   ++I YK      + +S  I  +L      R +A +LL
Sbjct:  507 FGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL-----DTLQKKKYQKKSPGDLLL-FAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.657e-45
Identity = 96/253 (37.94%), Postives = 152/253 (60.08%), Query Frame = 3
Query:  534 FLETGSFSKVFKVVESRKNRVFAVKKIILRDV-----ENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPST----FCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELL 1265
             L +G+F +V+   +    R  A+K + L  +     +  + +EN I+  ++  +++ IV YFG  ++   ++IFMEYLPGGS+ + I T++   L  +   KY++ +L+GL YLHK++I+HRD+K ANIL D N + KL DFG S+ +++   +T      GT Y+M+PE+IN E Y   +DIWSVG T+VEMLT KPP+++   +  ++KI  EK+  +   N  SE     ++K     PS R TA +LL
Sbjct:   69 LLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSKEVRALENEIH-LLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEI-TKY-GSLTENVSRKYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRLQTIVSATGLHSVVGTPYWMAPEVINGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFTLPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3Q2SY34 (Serine/threonine kinase 24 OS=Fundulus heteroclitus OX=8078 GN=STK24 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.525e-44
Identity = 101/269 (37.55%), Postives = 156/269 (57.99%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVEN-TKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +VFK ++ R  +V A+K I L + E+  + I+  I   + + D+  I KY GS  +  K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK    +++ KK
Sbjct:   18 FTKQERIGKGSFGEVFKGIDRRTQKVVAIKIIDLEEAEDDIEDIQQEIT-VLSQCDSPFITKYHGSYLKGTKLWIIMEYLGGGSALDLLE---PGALDESQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVESCLNKEPSFRPTAKELLKHKFIARHAKK 274          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4W5NXP5 (Protein kinase domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 5.430e-44
Identity = 99/268 (36.94%), Postives = 154/268 (57.46%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PPYS+L  ++++F I +         NPP+      + L  FI   L+  PS R TA ELLK  +  ++ KK
Sbjct:   20 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLQDAKLWIIMEYLGGGSALDLLE---PGALDETQIATILREILRGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPYSELHPMKVLFLIPK--------NNPPTLEGNYCKPLKEFIEACLNKEPSFRPTAKELLKHKLIIRHAKK 276          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1U7S8M2 (serine/threonine-protein kinase 24 isoform X4 OS=Alligator sinensis OX=38654 GN=STK24 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.341e-44
Identity = 99/268 (36.94%), Postives = 154/268 (57.46%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+ ++ KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GLDYLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK     +N KK
Sbjct:   12 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLE---PGSLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNFSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 167.162 bits (422), Expect = 2.289e-45
Identity = 98/268 (36.57%), Postives = 153/268 (57.09%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  +  K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK  +  ++ KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLL---EPGALDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRHAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 165.236 bits (417), Expect = 7.522e-45
Identity = 96/259 (37.07%), Postives = 149/259 (57.53%), Query Frame = 3
Query:  546 GSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  +  K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP      S+ L  F+   L+  PS R TA ELLK  +  ++ KK
Sbjct:    6 GSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLL---EPGALDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRHAKK 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000008518.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:14507502:14520436:1 gene:ENSAMXG00000008289.2 transcript:ENSAMXT00000008518.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 2.096e-44
Identity = 97/268 (36.19%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  +  K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+S+L  ++++F I +         NPP+      + L  F+   L+  PS R TA ELLK  +  +  KK
Sbjct:   21 FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLE---PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPK--------NNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKK 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 163.696 bits (413), Expect = 3.201e-44
Identity = 96/262 (36.64%), Postives = 147/262 (56.11%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK ++ R   V A+K I L + E+           + + D+ H+ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++     TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +    T       S++   F+   L+  P+ R TA ELLK     KN KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDRRTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPHVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDECQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDF--SKSFKEFVDSCLNKDPTFRPTAKELLKHKFIVKNAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 163.31 bits (412), Expect = 9.451e-44
Identity = 96/262 (36.64%), Postives = 147/262 (56.11%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYPS-TFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK ++ R   V A+K I L + E+           + + D+ H+ KY+GS  +  K++I MEYL GGS  +L+     D      ++K    IL+GLDYLH    IHRD+K AN+LL E+ + KL DFG++ +L ++     TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SD+  ++++F I +    T       S++   F+   L+  P+ R TA ELLK     KN KK
Sbjct:   45 FTKLERIGKGSFGEVFKGIDRRTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPHVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDECQIATMLK---EILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDF--SKSFKEFVDSCLNKDPTFRPTAKELLKHKFIVKNAKK 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 159.844 bits (403), Expect = 2.107e-43
Identity = 96/264 (36.36%), Postives = 148/264 (56.06%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVK--PANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +VFK +++R   V A+K I L + E+           + + D+ ++  YFGS  +  K++I MEYL GGS  +LI    P  L   +I    + IL+GLDYLH    IHRD+K   AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP S+L  ++++F I +    T +     S+    F+   L+  P  R TA ELLK     ++ KK
Sbjct:   26 FTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIK---PGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNY--SKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKK 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 157.532 bits (397), Expect = 2.713e-41
Identity = 94/249 (37.75%), Postives = 140/249 (56.22%), Query Frame = 3
Query:  444 GVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIIL--RDVENTK---LIENNINNFMKKLDNKHIVKYFGSLRENYK--MFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIES-----GYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQE 1154
            GV  EL  N D +          N + +   L  G+F +V+   ++   R  AVK++      VE +K    +E  I   +K L ++ IV+YFG LR+  +  + IFMEY+PGGSI + +       L  +   KY++ IL+G+ +LH ++I+HRD+K ANIL D   + KL DFG S+ +++         +  GT Y+MSPE+IN E Y   +DIWSVG TVVEMLT KPP+++   +  IFKI  +
Sbjct:  335 GVGGELAENADVSPPSRSPRAPTN-WQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQ-LLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAY--GALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 579          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.241e-31
Identity = 81/276 (29.35%), Postives = 135/276 (48.91%), Query Frame = 3
Query:  516 EFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINN-------FMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSL----IIHRDVKPANILLDE-NDDCKLIDFGLS-RLIESG-----YPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYS---DLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIF 1280
            E+ +   +  G+FS  F+  +     + AVK++    V NT   ++ +          M +LD+ +I++  G+  E     +F+E++ GGS++NL+    P   H   +I Y + +L+GL YLH +     +IHRD+K AN+L+D      ++ DFG + RL   G     +     GT+ +M+PE++    Y  + DIWSVG  ++EM   KPP++     + + +IFKI                 L     + L   PSDR  A +LLK  +F
Sbjct:   23 EWLRGQQIGLGAFSSCFQAQDIGTGTLMAVKQVTY--VRNTASEQDEVVQTLREEIRMMSRLDHPNIIRMLGATCEKSNYNLFIEWMAGGSVANLLNKYGP--FHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGLQYGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPT-LCPGLRDVALRCLELQPSDRPVARDLLKHPVF 293          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 120.939 bits (302), Expect = 7.720e-31
Identity = 66/225 (29.33%), Postives = 118/225 (52.44%), Query Frame = 3
Query:  525 KEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINN-----------FMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLI-------ESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKI 1145
            K + L  G+F  VF  + + + ++ AVK++ LRD ++    +                 +  L + ++V+Y G+  E  +  IFME++PGG+++  +    P  L       Y   + +GL YLH   ++H DVK +N ++      KLIDFG ++ +       E+G   +  GT Y+M+PE+IN   Y+  +D+WS+G T+ EM  G+PP++D++ +  +  I
Sbjct:   17 KGNRLGKGAFGTVFLGL-TNQGKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGP--LGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHI 238          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 127.102 bits (318), Expect = 1.080e-30
Identity = 83/264 (31.44%), Postives = 141/264 (53.41%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKL------DNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS----RLIESGYPSTFCGTLYYMSPEII-----NEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFS 1283
            L  G+F KV+K  +++++ V A  K+I      TK  E  + ++M ++      D+ +IV    +     K++IF+E+ PGG++ + I+ E   GL   +I    + +L+ L+YLH   IIHRD+K  NILL    D KL DFG+S    R ++     +F GT Y+M+PE++      + PY   +DIWS+G T++E+   +PP  +L+ ++++ KI +    +    +  S   + F+ K L   P  R  A +LL+    S
Sbjct:   39 LGDGAFGKVYKA-QNKESGVLAAAKVI-----ETK-SEEELEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAV-DAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRR--DSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFIS 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 161.77 bits (408), Expect = 2.776e-42
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 3
Query:  546 GSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLK 1268
            GS+  V+K +    ++V A+K+++  + E    I   I+  +K L++ +IVKY G +R++Y+++I +EY   GS+  LI +    GL  ++   Y    L GL YLH   +IHRD+K ANILL  ++  KL DFG+S ++ S    T  GTL +M+PEI+     S  SDIWS+GATVVEMLT  PPY +L+   I + +  +   TY   +  SE L  F++K        R TAD+LLK
Sbjct:   34 GSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEIS-LLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSS-ALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND---TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 140.584 bits (353), Expect = 2.221e-36
Identity = 91/262 (34.73%), Postives = 143/262 (54.58%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDV-ENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYP-STFCGTLYYMSPEII--NEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNV 1292
            +S +  +  G+F  V+K V+     + A+K + L    E+ +L+   I  F+ +L +  I  Y  ++ E+  M+I MEY  GGS S+L+   + +GL  +K+      +  GL YLH+   IHRD+K ANILL+E    KL DFG+S  I S     TF GT Y+M+PE++    + Y+  +DIWS+G T  E+L G PP S    ++++  + + K    K + P S+    F+A  L   P+DR +A  LL  + F KN+
Sbjct:   18 YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIF-FLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPP--KLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFE-FVKNI 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 140.584 bits (353), Expect = 1.618e-35
Identity = 67/166 (40.36%), Postives = 107/166 (64.46%), Query Frame = 3
Query:  663 NFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLI-----ESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKI 1145
            N +K+L +++IV Y+G+ +E   + IF+EY+PGGS+S+++    P       I  +++ IL G+ YLHK  IIHRD+K ANIL+D     K+ DFG+S+ +     +    ++  G++++MSPE++ +   +  +DIWS G  V+EM TGK P+ D SQ+Q IFKI
Sbjct:  506 NLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGP--FEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKI 669          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 131.724 bits (330), Expect = 4.214e-34
Identity = 73/225 (32.44%), Postives = 129/225 (57.33%), Query Frame = 3
Query:  504 FTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIE--NNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLIL--TEFPDGLHHDKIIK-YSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKI 1163
            +TL++F     L TGSF +V  V      R +A+K +  + V   K +E  N+    +K +++  +++ +G+ ++   +F+ M+Y+ GG + +L+     FP+      + K Y+  ++  L+YLH   II+RD+KP NILLD N   K+ DFG ++ +++    T CGT  Y++PE+I  +PY+ + D WS+G  + EML G  P+ D + ++   KI+Q K +
Sbjct:   65 YTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPN-----PVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT-VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVV 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 128.642 bits (322), Expect = 3.873e-32
Identity = 76/198 (38.38%), Postives = 115/198 (58.08%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKI--ILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLR--ENYKMFIFMEYLPGGSISNLI--LTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYS 1112
            L  G+   V K      +++FA+K I  +  D E  K I   +  F +   +++IV+Y+G     EN  ++I MEY+ G S+  +   L E    +    + K ++ +L+GL YLH+  +IHRD+KP NILL+EN   KL DFG+S    +   +TF GT +YM+PE I  +PYS TSD+WS+G T++E+  GK P S
Sbjct:  227 LGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQ-FNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 163.696 bits (413), Expect = 3.171e-46
Identity = 99/263 (37.64%), Postives = 146/263 (55.51%), Query Frame = 3
Query:  510 LNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENT-----KLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIES-----GYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLK 1268
            +N + K   L  G+F +V+   +    R  AVK+I    + ++     K +E  I  FMK   N+ IV+Y+G   ++  ++IFMEYLPGGSI   I       L+     KYS+ IL+G+ YLH + I+HRD+K ANIL D   + KL DFG S+ +++     G+ S   GT Y+M+PE+IN E Y   +D+WSVG TVVEMLT KPP++D   +  +FKI  +        +   + +  F+   L      R +ADELL+
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIE-FMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQH--GALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH-GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVE-FVRSTLRMNSKSRPSADELLR 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 159.458 bits (402), Expect = 4.911e-44
Identity = 89/246 (36.18%), Postives = 143/246 (58.13%), Query Frame = 3
Query:  537 LETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLK 1268
            L  GS+  VFK +     +V A+K++ + D +  ++I+    + M++ D+ ++VKY+GS  +N  ++I MEY   GS+S+L+       L  ++I    ++ L+GL+YLH    IHRD+K  NILL+     KL DFG++  +       +T  GT ++M+PE+I E  Y C +DIWS+G T +EM  GKPPY+D+  ++ IF I  +   T++     SE    F++K L   P +R TA ELL+
Sbjct:   30 LGEGSYGSVFKAMHKESGQVVAIKQVPV-DTDLQEIIKEI--SMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIR-NKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQ 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 159.844 bits (403), Expect = 1.732e-43
Identity = 98/268 (36.57%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIES-GYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            FSK   +  GSF +VFK +++R N V A+K I L + E+           + + D+ ++ KY GS  +  K++I MEYL GGS  +L+     +  +   I++    +L+GLDYLH    +HRD+K AN+L+ E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SDL  ++++F I +         NPP      S+    F++  L+  P+DR TA ELLK   F K  KK
Sbjct:   11 FSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKAGNIEEFYIATILR---EVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKN--------NPPELTGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHR-FIKTAKK 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 134.806 bits (338), Expect = 1.047e-35
Identity = 90/274 (32.85%), Postives = 145/274 (52.92%), Query Frame = 3
Query:  516 EFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNIN------NFMKKLDNKHIVKYFGSLRENYK--MFIFMEYLPGGSISNLILTEFPDGLHHDKIIK-YSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLI--------ESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSK 1286
            E+ K + L  G+F  VF  + +    + AVK++ L    N    E            +K L +K+IV+Y G+  ++ +  + IFME++PGGSI+   L  F  G   + + + Y++ IL G+ YLH + +IHRD+K  NI+L  N   KLIDFG ++ I        +S    +  GT Y+M+PE+I E  +   SDIWS+G TV EM TG+PP+S++  +  IF I     +    ++  +  +  F+   ++     R +ADELL+ D   +
Sbjct:    4 EWQKGNVLGKGAFGTVFLGLVN-TGELIAVKQVELHP-NNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQA-LKRF--GAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVPRLDESFSAAAID-FVTSCMTRDQDTRPSADELLRHDFLQE 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO48741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM4])

HSP 1 Score: 138.658 bits (348), Expect = 3.381e-34
Identity = 80/254 (31.50%), Postives = 142/254 (55.91%), Query Frame = 3
Query:  546 GSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLD------NKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYP--STFCGTLYYMSPEII-----NEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLK 1268
            GSF KV+K     ++ + A K II+ D       EN + +FM ++D      +K++V  F +   + K+++ +E+  GG++ +L+L E   GL+  +I   ++ + +GL +LH   +IHRD+K  N+LL  + + K+ DFG+S   +      STF GT Y+M+PE++      ++PY   +DIWS G T++E+    PP  ++  ++++FKI +    T+   N  S  L+ F+A  +   P  R +A E++K
Sbjct:   31 GSFGKVYKAQHKTESSLSAAKIIIVND-------ENELEDFMVEIDILSECKHKNLVGLFETFLHDGKLWMMLEFCSGGALDDLML-ELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLLLASDGNVKMADFGVSAKNKKTLQKRSTFIGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNHNMHPMRVLFKIPKSDPPTFDNPNKWSNDLNDFLASCVVKNPDMRASATEMIK 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk24b (serine/threonine kinase 24 [Source:NCBI gene;Acc:101160144])

HSP 1 Score: 164.466 bits (415), Expect = 2.655e-44
Identity = 97/268 (36.19%), Postives = 153/268 (57.09%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPS------ETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + + D+  + KY+GS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP+      + L  F+   L+  PS R TA ELLK  +  +  KK
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLM---EPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGSYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022068.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 163.696 bits (413), Expect = 2.793e-44
Identity = 100/268 (37.31%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + +  +  I KYFGS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP      S+ L  FI   L+  PS R TA ELLK     K+ K+
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSALDLLE---PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKR 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022064.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 163.31 bits (412), Expect = 5.081e-44
Identity = 100/268 (37.31%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + +  +  I KYFGS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP      S+ L  FI   L+  PS R TA ELLK     K+ K+
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSALDLLE---PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKR 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022066.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 163.31 bits (412), Expect = 5.081e-44
Identity = 100/268 (37.31%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPP------SETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K   +  GSF +VFK +++R  +V A+K I L + E+           + +  +  I KYFGS  ++ K++I MEYL GGS  +L+    P  L   +I    + IL+GL+YLH    IHRD+K AN+LL E  + KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP+SDL  ++++F I +         NPP      S+ L  FI   L+  PS R TA ELLK     K+ K+
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSALDLLE---PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPK--------NNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKR 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 163.31 bits (412), Expect = 5.392e-44
Identity = 95/262 (36.26%), Postives = 148/262 (56.49%), Query Frame = 3
Query:  519 FSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS-RLIESGYP-STFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            F+K+  +  GSF +V+K + +R   V A+K I L + E+           + + D+ ++ KY+GS  +  K++I MEYL GGS  +L+    P  L    I    + IL+GL+YLH    IHRD+K AN+LL E  D KL DFG++ +L ++    +TF GT ++M+PE+I +  Y   +DIWS+G T +E+  G+PP SDL  ++++F I +    T +   P S+    F+   L+  P  R TA ELLK    ++  KK
Sbjct:   20 FTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLR---PGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEG--PYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKK 276          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024811.1 (SMESG000024811.1)

HSP 1 Score: 470.315 bits (1209), Expect = 6.103e-165
Identity = 231/235 (98.30%), Postives = 234/235 (99.57%), Query Frame = 3
Query:   57 MSEKNFNRFLDAIKSNDLAAVEADYLPEFIDKSESGGMYPVHLACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPG 761
            MSEKNFNRFLDAIKSNDLAAVEADYLPEF+DKSESGGMYPVH ACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKI+LRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRE+YKMFIFMEYLPG
Sbjct:    1 MSEKNFNRFLDAIKSNDLAAVEADYLPEFLDKSESGGMYPVHFACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIVLRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRESYKMFIFMEYLPG 235          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024811.1 (SMESG000024811.1)

HSP 1 Score: 468.389 bits (1204), Expect = 4.435e-164
Identity = 230/235 (97.87%), Postives = 233/235 (99.15%), Query Frame = 3
Query:   57 MSEKNFNRFLDAIKSNDLAAVEADYLPEFIDKSESGGMYPVHLACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPG 761
            MSEKNFNRFLDAIKSNDLAAVEADYLPEF+DKSESGGMYPVH ACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEH LETGSFSKVFKVVESRKNRVFAVKKI+LRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRE+YKMFIFMEYLPG
Sbjct:    1 MSEKNFNRFLDAIKSNDLAAVEADYLPEFLDKSESGGMYPVHFACSKKSFEVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYNDLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISFTLNEFSKEHLLETGSFSKVFKVVESRKNRVFAVKKIVLRDVENTKLIENNINNFMKKLDNKHIVKYFGSLRESYKMFIFMEYLPG 235          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024808.1 (SMESG000024808.1)

HSP 1 Score: 372.474 bits (955), Expect = 2.026e-126
Identity = 182/196 (92.86%), Postives = 186/196 (94.90%), Query Frame = 3
Query:  711 SLRENYKMFIFMEYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            S     +M + +EY+ G SISNLI TEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK
Sbjct:   49 SFSSGRQMLLIVEYIEG-SISNLIRTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 243          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024808.1 (SMESG000024808.1)

HSP 1 Score: 370.548 bits (950), Expect = 1.564e-125
Identity = 184/198 (92.93%), Postives = 187/198 (94.44%), Query Frame = 3
Query:  723 NYKMFIFM------EYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            N + FIF+      EY+ G SISNLI TEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK
Sbjct:   61 NLRFFIFLILDEVVEYIEG-SISNLIRTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 257          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024808.1 (SMESG000024808.1)

HSP 1 Score: 370.548 bits (950), Expect = 2.644e-125
Identity = 184/198 (92.93%), Postives = 187/198 (94.44%), Query Frame = 3
Query:  723 NYKMFIFM------EYLPGGSISNLILTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 1298
            N + FIF+      EY+ G SISNLI TEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK
Sbjct:   71 NLRFFIFLILDEVVEYIEG-SISNLIRTEFPDGLHHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLSRLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPPYSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTADELLKSDIFSKNVKK 267          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK242.170e-4536.94serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
STK242.406e-4536.94serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
STK261.579e-4436.94serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK262.185e-4436.94serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK258.715e-4336.26serine/threonine kinase 25 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-14.788e-4236.53Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-15.359e-4236.53Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-15.701e-4236.53Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.471e-4136.53Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.300e-4036.16Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GckIII1.798e-4235.69gene:FBgn0266465 transcript:FBtr0083399[more]
hpo2.928e-4036.08gene:FBgn0261456 transcript:FBtr0331920[more]
hpo2.928e-4036.08gene:FBgn0261456 transcript:FBtr0086500[more]
Ask19.784e-3333.09gene:FBgn0014006 transcript:FBtr0083819[more]
Ask11.164e-3233.09gene:FBgn0014006 transcript:FBtr0300256[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24a9.513e-4738.29serine/threonine kinase 24a (STE20 homolog, yeast)... [more]
stk24b1.480e-4436.19serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk24b2.555e-4436.19serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk25b5.713e-4335.88serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-G... [more]
stk268.250e-4235.88serine/threonine protein kinase 26 [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk251.327e-4436.94serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
slc39a72.201e-4436.19solute carrier family 39 member 7 [Source:Xenbase;... [more]
stk252.204e-4436.94serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk252.352e-4436.94serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk252.576e-4436.94serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk242.919e-4536.94serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
Stk261.467e-4436.94serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk262.131e-4436.94serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk251.558e-4236.26serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
Stk31.120e-4136.47serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6E0|STK24_HUMAN1.155e-4436.94Serine/threonine-protein kinase 24 OS=Homo sapiens... [more]
sp|Q99KH8|STK24_MOUSE2.042e-4436.94Serine/threonine-protein kinase 24 OS=Mus musculus... [more]
sp|B0LT89|STK24_RAT3.305e-4436.94Serine/threonine-protein kinase 24 OS=Rattus norve... [more]
sp|Q9P289|STK26_HUMAN1.049e-4336.94Serine/threonine-protein kinase 26 OS=Homo sapiens... [more]
sp|Q99JT2|STK26_MOUSE1.491e-4336.94Serine/threonine-protein kinase 26 OS=Mus musculus... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG21.483e-5533.49Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
K1PKP14.657e-4537.94Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A3Q2SY341.525e-4437.55Serine/threonine kinase 24 OS=Fundulus heteroclitu... [more]
A0A4W5NXP55.430e-4436.94Protein kinase domain-containing protein OS=Hucho ... [more]
A0A1U7S8M26.341e-4436.94serine/threonine-protein kinase 24 isoform X4 OS=A... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24b2.289e-4536.57serine/threonine-protein kinase 24-like [Source:NC... [more]
stk24b7.522e-4537.07serine/threonine-protein kinase 24-like [Source:NC... [more]
ENSAMXT00000008518.22.096e-4436.19pep primary_assembly:Astyanax_mexicanus-2.0:19:145... [more]
stk263.201e-4436.64serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
stk269.451e-4436.64serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25a2.107e-4336.36serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
map3k22.713e-4137.75mitogen-activated protein kinase kinase kinase 2 [... [more]
ENSPMAT00000006402.11.241e-3129.35pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
map3k197.720e-3129.33mitogen-activated protein kinase kinase kinase 19 ... [more]
slka1.080e-3031.44STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC152.776e-4239.00Protein kinase of the Mitotic Exit Network; locali... [more]
SPS12.221e-3634.73Putative protein serine/threonine kinase; localize... [more]
STE111.618e-3540.36Signal transducing MEK kinase; involved in pheromo... [more]
TPK24.214e-3432.44cAMP-dependent protein kinase catalytic subunit; p... [more]
MKK13.873e-3238.38MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414103.171e-4637.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428454.911e-4436.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319341.732e-4336.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478211.047e-3532.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487413.381e-3431.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24b2.655e-4436.19serine/threonine kinase 24 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000022068.22.793e-4437.31serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022064.25.081e-4437.31serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022066.25.081e-4437.31serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
stk25b5.392e-4436.26serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024811.16.103e-16598.30SMESG000024811.1[more]
SMESG000024811.14.435e-16497.87SMESG000024811.1[more]
SMESG000024808.12.026e-12692.86SMESG000024808.1[more]
SMESG000024808.11.564e-12592.93SMESG000024808.1[more]
SMESG000024808.12.644e-12592.93SMESG000024808.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010386 ID=SMED30010386|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1834bp
TGTCTGTTTAACAATTCCGTTTTCTATTTATAACTTATCGATTTTGAAAT
AAATGAATGTCGGAAAAGAATTTTAATCGATTTCTTGATGCCATCAAATC
AAATGATCTGGCAGCAGTTGAAGCAGATTACTTGCCGGAATTTATCGACA
AATCCGAAAGCGGAGGGATGTATCCAGTTCACCTTGCTTGTTCAAAAAAA
TCCTTCGAGGTTTTCAAATTTCTCATGAAAAACAAATGTAACATTGAATC
AGTTGACAATAAAGGTCATCGACCTATCCATTATGCAATTGAAAGTGGTG
CCGAAGAGATTGTGAAATTGCTCATAGGAAGTCTTTGTGACTTATCTGAC
TATAATGATTTGCTTAAAATGGCGGAAAAACTGTCTGAAAGAAGTACTGA
AATAAAAGAGATTCTGGAAAAATCTAATGAAAATAGAAAGACAGGAGTTG
AAATGGAGCTTGACTGTAATGTTGATTGTAATCACAAGTTTTGCTTGATC
TCATTTACTTTAAACGAATTTTCGAAAGAACATTTTCTCGAAACTGGATC
TTTTTCCAAAGTATTTAAAGTTGTGGAGTCCCGAAAAAATCGGGTGTTTG
CCGTGAAAAAAATAATTTTGAGAGATGTAGAAAATACAAAATTGATAGAG
AATAACATCAACAATTTTATGAAAAAACTGGATAACAAACACATTGTGAA
ATATTTCGGCTCGTTACGGGAAAATTACAAAATGTTCATTTTCATGGAAT
ATCTGCCAGGAGGTTCAATTAGCAATCTGATTCTTACGGAATTTCCGGAC
GGACTACACCATGATAAAATTATAAAATACAGTCAGCATATTCTCCAAGG
TTTAGATTACCTCCACAAATCCTTAATAATTCACAGAGATGTCAAACCTG
CAAATATCCTATTAGACGAGAATGACGATTGCAAATTAATAGATTTTGGA
TTAAGCCGCTTGATAGAGTCCGGTTACCCCAGTACATTTTGCGGAACTCT
GTATTACATGTCACCGGAAATTATTAACGAAGAACCATATTCCTGCACGT
CTGATATCTGGTCTGTTGGTGCTACAGTTGTTGAAATGCTGACAGGCAAA
CCGCCATACTCAGATTTATCTCAAATCCAAATTATCTTTAAGATTGTTCA
AGAAAAGAAAATTACATATAAAGCAAAAAATCCACCATCAGAAACATTAT
CCAGGTTCATTGCTAAACTATTAAGTCCGCTTCCAAGTGACCGAGGCACC
GCAGACGAACTATTAAAAAGCGATATATTTTCTAAAAACGTGAAAAAATA
ATGTGAAATTTTGATAAAAAAGAAATTTTCAATAATATTTTGTAAATGAT
TGCAGCAGGTAAATATCTGCTTGCGGGCAAATATATTCTTCAAACGGGAA
GTCACATTGGTTTGCGATAAACTCACTCAGTCTGGTTATTTTACCCAAAG
ATATTGTGATTTTTTATGTTTATTGCAAAATACTTTCTGTCATAAGATGT
TTTGTTAGAAAGTTGAGTTGTTTGTCGATAGAGATTCTGAGCCTCTTTGA
AACATGAGAATTTGTCATTACTATCCTTAGAAAAATTCATAAATTCAAAT
ATGCTCCACAACCGGGTTGATTATACGATATAGAATGAGATTTCAAGTTT
AGAACTAACCCGATTTGTCTTCTGAATCCTTCAAAGGAGCGTTGACTATT
ATTTCGATTTTGCTAAGATCCTTAAATTTTTCTTGTGTCTTTAGGATTAG
GTTACTTACACCTACAATTGTAATAGTTGTACCAAATTCAAAGGATATGT
AGAATTTTGATTCATTGTCGATTTATCTAAAAAC
back to top

protein sequence of SMED30010386-orf-1

>SMED30010386-orf-1 ID=SMED30010386-orf-1|Name=SMED30010386-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=415bp
MSEKNFNRFLDAIKSNDLAAVEADYLPEFIDKSESGGMYPVHLACSKKSF
EVFKFLMKNKCNIESVDNKGHRPIHYAIESGAEEIVKLLIGSLCDLSDYN
DLLKMAEKLSERSTEIKEILEKSNENRKTGVEMELDCNVDCNHKFCLISF
TLNEFSKEHFLETGSFSKVFKVVESRKNRVFAVKKIILRDVENTKLIENN
INNFMKKLDNKHIVKYFGSLRENYKMFIFMEYLPGGSISNLILTEFPDGL
HHDKIIKYSQHILQGLDYLHKSLIIHRDVKPANILLDENDDCKLIDFGLS
RLIESGYPSTFCGTLYYMSPEIINEEPYSCTSDIWSVGATVVEMLTGKPP
YSDLSQIQIIFKIVQEKKITYKAKNPPSETLSRFIAKLLSPLPSDRGTAD
ELLKSDIFSKNVKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0045296cadherin binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0008631intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0030336negative regulation of cell migration
GO:0042542response to hydrogen peroxide
GO:0046777protein autophosphorylation
GO:0048679regulation of axon regeneration
GO:0097194execution phase of apoptosis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane
GO:0070062extracellular exosome