cytochrome c oxidase subunit I

Overview
Namecytochrome c oxidase subunit I (YP_008592428.2)
Smed IDSMED30010375
Length (bp)1545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytochrome c oxidase subunit I (SMED30010375) t-SNE clustered cells

Violin plots show distribution of expression levels for cytochrome c oxidase subunit I (SMED30010375) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytochrome c oxidase subunit I (SMED30010375) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytochrome c oxidase subunit I (SMED30010375) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010375

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010375 dd_Smed_v4_753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010375 Contig47929newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010375 Contig47929uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30010375 dd_Smed_v6_753_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gamma neoblastSMED30010375 dd_Smed_v6_753_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytochrome c oxidase subunit I vs. Ensembl Human
Match: MT-CO1 (mitochondrially encoded cytochrome c oxidase I [Source:HGNC Symbol;Acc:HGNC:7419])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 305/513 (59.45%), Postives = 384/513 (74.85%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIR 1539
            RWLFST+HKDIGT+Y L G   G+LGT +S++IR EL  PG+ LG+ H YN ++TAH  +MIFF VMP+MIGGFGNWLVP+ I +PDM+FPR NNMS  LL  S+ LL  S    +G G+G T+YPPL  + S    S D  + +LHLAG+SSILGAINFI TI+ M        ++PLFVWS+LITA LLLLSLPVLAAG+TMLLTDR+ NT+FFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +  YYSGK+  FG++GM++AM+ IGFLGF+V AHHM+T+G+DVD+RAYFT ATMI+ +PTG+KVF WLATL+GSN     + S  VLW  GFIFLFTVGGLTGI+LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I  GFIHWFPLF+G  L       HF +MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N +S +GS IS+  V+   +++  ++   ++ + +V   S         P   H  E  V+++
Sbjct:    5 RWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSN----MKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAF-ASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMK 512          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Celegans
Match: ctc-1 (Cytochrome c oxidase subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:P24893])

HSP 1 Score: 467.618 bits (1202), Expect = 5.868e-161
Identity = 271/514 (52.72%), Postives = 368/514 (71.60%), Query Frame = 1
Query:    7 WLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLN------YPSVVHFSESSV 1530
            WL S++HKDIGT+YF+ G+  G++GT  S++IR EL+ PG FL +   YN +ITAH ++MIFF VMP MIGGFGNWL+P+ + +PDMSFPR NN+S  LL +S+ L+  + F   G G+  T+YPPL+++     S D  + +LH AG+SSILG INF+ T   +      L    LFVW++ +T FLL+LSLPVLA  +TMLLTDR+ NTSFFDPS GG+P+++QH+FWFFGHPEVYILILP FGI+SQ  +Y +GK+  FG LGM+YA++ IG +G +V AHHMYT+G+D+DSRAYF+ ATM++ VPTG+KVF WLATL+G    +    +  +LWV GFIFLFT+GGLTG++L+N+ +D+ LHDTY+VV+HFHYVLS+GAVF IF G   W+   TG VL   ++ A FI++F+GVN+TFFP H+ GL G PR+  DY D YS  N ++  GSIIS  G+  F Y++L S++  +  I   + +S PE    N      Y S ++FS +S+
Sbjct:   14 WLESSNHKDIGTLYFIFGLWSGMVGTSFSLLIRLELAKPGFFLSNGQLYNSVITAHAILMIFFMVMPTMIGGFGNWLLPLMLGAPDMSFPRLNNLSFWLLPTSMLLILDACFVDMGCGTSWTVYPPLSTMGHPGSSVDLAIFSLHAAGLSSILGGINFMCTTKNLRSSSISLEHMTLFVWTVFVTVFLLVLSLPVLAGAITMLLTDRNLNTSFFDPSTGGNPLIYQHLFWFFGHPEVYILILPAFGIVSQSTLYLTGKKEVFGALGMVYAILSIGLIGCVVWAHHMYTVGMDLDSRAYFSAATMVIAVPTGVKVFSWLATLFG----MKMVFNPLLLWVLGFIFLFTLGGLTGVVLSNSSLDIILHDTYYVVSHFHYVLSLGAVFGIFTGVTLWWSFITGYVLDKLMMSAVFILLFIGVNLTFFPLHFAGLHGFPRKYLDYPDVYSVWNIIASYGSIISTAGLFLFIYVLLESFFSYRLVISDYYSNSSPEYCMSNYVFGHSYQSEIYFSTTSL 523          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Fly
Match: mt:CoI (gene:FBgn0013674 transcript:FBtr0100861)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 308/507 (60.75%), Postives = 392/507 (77.32%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL++ I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L +HFI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFF+I+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Zebrafish
Match: mt-co1 (cytochrome c oxidase subunit I [Source:NCBI gene;Acc:140539])

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 300/514 (58.37%), Postives = 386/514 (75.10%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            RW FST+HKDIGT+Y + G   G++GT +S++IR ELS PG+ LGD   YN ++TAH  +MIFF VMP++IGGFGNWLVP+ I +PDM+FPR NNMS  LL  S  LL  S    +G G+G T+YPPL  +++ +  S D  + +LHLAG+SSILGAINFI T + M        ++PLFVW++L+TA LLLLSLPVLAAG+TMLLTDR+ NT+FFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFGIIS +  YY+GK+  FG++GM++AM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ +PTG+KVF WLATL+G      T    P+LW  GFIFLFTVGGLTGI+LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGF+HWFPLFTG  L++     HF VMF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS+IS+V V+ F +I+  ++   ++ +  V  ++         P   H  E   F+++
Sbjct:    5 RWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPTISQYQTPLFVWAVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGAIKWET----PMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFTGYTLNSVWTKIHFGVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYALWNTVSSIGSLISLVAVIMFLFILWEAF-TAKREVLSVELTATNVEWLHGCPPPYHTFEEPAFVQI 513          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Xenopus
Match: ralgapb (Ral GTPase activating protein, beta subunit (non-catalytic) [Source:Xenbase;Acc:XB-GENE-6039898])

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 381/514 (74.12%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            RWLFST+HKDIGT+Y + G   G++GT +S++IR ELS PG+ LGD   YN ++TAH  IMIFF VMP+MIGGFGNWL+P+ I +PDM+FPR NNMS  LL  S  LL  S    +G G+G T+YPPL  +++ +  S D  + +LHLAG+SSILGAINFI T + M        ++PLFVWS+LITA LLLLSLPVLAAG+TMLLTDR+ NT+FFDP+GGGDP+L+QH+FWFFGHPEVYILILPGFG+IS +  YYSGK+  FG++GM++AM+ IG LGF+V AHHM+T+ L+VD+RAYFT ATMI+ +PTG+KVF WLAT++G       +   P+LW  GFIFLFTVGGLTGI+LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I  GF+HWFPLFTG  L       HF VMF GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS+IS+V V+   +I+  ++   ++ + L   +S         P   H  E   F+++
Sbjct:    5 RWLFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTVDLNVDTRAYFTSATMIIAIPTGVKVFSWLATMHGGT----IKWDAPMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFTGYTLHETWAKIHFGVMFAGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSVGSLISLVAVIMMMFIIWEAF-AAKREVTLTELTSTNIEWLHGCPPPYHTFEEPAFVQI 513          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Mouse
Match: mt-Co1 (mitochondrially encoded cytochrome c oxidase I [Source:MGI Symbol;Acc:MGI:102504])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 307/514 (59.73%), Postives = 389/514 (75.68%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            RWLFST+HKDIGT+Y L G   G++GT +S++IR EL  PG+ LGD   YN ++TAH  +MIFF VMP+MIGGFGNWLVP+ I +PDM+FPR NNMS  LL  S  LL  S    +G G+G T+YPPL  +++ +  S D  + +LHLAG+SSILGAINFI TI+ M        ++PLFVWS+LITA LLLLSLPVLAAG+TMLLTDR+ NT+FFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFGIIS +  YYSGK+  FG++GM++AM+ IGFLGF+V AHHM+T+GLDVD+RAYFT ATMI+ +PTG+KVF WLATL+G N     + S  +LW  GFIFLFTVGGLTGI+L+N+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGF+HWFPLF+G  L +    AHF +MFVGVNMTFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS+  VL   +++  ++   ++ + + + S+  E +    P   H  E   +++V
Sbjct:    5 RWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGN----IKWSPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLH-GCPPPYHTFEEPTYVKV 513          
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Match: sp|Q34345|COX1_DROMA (Cytochrome c oxidase subunit 1 OS=Drosophila mauritiana OX=7226 GN=mt:CoI PE=3 SV=3)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 309/507 (60.95%), Postives = 392/507 (77.32%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL++ I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L +HFI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFFYI+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSTIGSTISLLGILFFFYIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Match: sp|P00400|COX1_DROYA (Cytochrome c oxidase subunit 1 OS=Drosophila yakuba OX=7245 GN=mt:CoI PE=3 SV=2)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 309/507 (60.95%), Postives = 391/507 (77.12%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL+S I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L + FI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFFYI+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSSGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGITLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSQFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSTIGSTISLLGILFFFYIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Match: sp|Q34388|COX1_DROSI (Cytochrome c oxidase subunit 1 OS=Drosophila simulans OX=7240 GN=mt:CoI PE=2 SV=3)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 308/507 (60.75%), Postives = 391/507 (77.12%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL++ I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L + FI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFFYI+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSQFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSTIGSTISLLGILFFFYIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Match: sp|P00399|COX1_DROME (Cytochrome c oxidase subunit 1 OS=Drosophila melanogaster OX=7227 GN=mt:CoI PE=2 SV=2)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 308/507 (60.75%), Postives = 392/507 (77.32%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL++ I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L +HFI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFF+I+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Match: sp|Q34391|COX1_DROSE (Cytochrome c oxidase subunit 1 OS=Drosophila sechellia OX=7238 GN=mt:CoI PE=3 SV=2)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 307/507 (60.55%), Postives = 390/507 (76.92%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PG+ +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  +++LL +S    +G G+G T+YPPL++ I+    S D  + +LHLAGISSILGA+NFI T++ M      L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATL+G+        S  +LW  GF+FLFTVGGLTG++LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGFIHW+PLFTGL L+N  L + FI MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N VS +GS IS++G+LFFF+I+  S    ++ I+ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQ----LSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSQFITMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Match: T1PTD0 (Cytochrome c oxidase subunit 1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX1 PE=3 SV=2)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 504/514 (98.05%), Postives = 504/514 (98.05%), Query Frame = 1
Query:    1 YRWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            YRWLFSTSHKDIGTMYFLLGILMGLLGTGMSMVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMSLLLLFSSIALLFMSLFSGSGLGSG TLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITAFLLLLSLPVLAAGLTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMI IGFLGFLV AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVF WLATLYGSN DLYTQ SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF NNVS LGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSS PE VTLNYPSVVHFSESSVFIRV
Sbjct:   93 YRWLFSTSHKDIGTMYFLLGILMGLLGTGMSMVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMSLLLLFSSIALLFMSLFSGSGLGSGWTLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITAFLLLLSLPVLAAGLTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMISIGFLGFLVWAHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFSWLATLYGSNWDLYTQWSVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSFWNNVSSLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSSPEWVTLNYPSVVHFSESSVFIRV 606          
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Match: A0A0B4VK86 (Cytochrome c oxidase subunit 1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX1 PE=3 SV=1)

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 502/514 (97.67%), Postives = 503/514 (97.86%), Query Frame = 1
Query:    1 YRWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            YRWLFSTSHKDIGTMYFLLGILMGLLGTGMSMVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMSLLLLFSSIALLFMSLFSGSGLGSG TLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITAFLLLLSLPVLAAGLTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMI IGFLGFLV AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVF WLATLYGSN DLYTQ SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFI+MFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF NNVS LGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSS PE VTLNYPSVVH SESSVFIRV
Sbjct:   93 YRWLFSTSHKDIGTMYFLLGILMGLLGTGMSMVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMSLLLLFSSIALLFMSLFSGSGLGSGWTLYPPLTSISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITAFLLLLSLPVLAAGLTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMISIGFLGFLVWAHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFSWLATLYGSNWDLYTQWSVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIIMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSFWNNVSSLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSSPEWVTLNYPSVVHLSESSVFIRV 606          
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Match: A0A0E3UUJ7 (Cytochrome c oxidase subunit 1 OS=Obama sp. MAP-2014 OX=1520506 GN=cox1 PE=3 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 335/510 (65.69%), Postives = 411/510 (80.59%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSV 1530
            RW+FST+HKDIGT Y +LG+LMGL+GT +S++IR EL   G+ +GDS +YN +ITAHGLIMIFF  MPVMIGGFGNWLVP+ +   DM FPR NN SL+L+  S+  + +SL  G G+G+G TLYPPLT +I  S  S DF + ++H+AG+SSILGAINFI TIL M  +  P    PLFVWSI ITAFLLLLSLPVLA GLTMLLTDR+FNTSFFDP GGGDPILFQHIFWFFGHPEVYILILPGFG+IS + ++YSGK+ SFGHLGM+YAM+ IGFLGF+V AHHMYTIGLD+DSRAYFTGATMI+GVPTGIK+F WLAT+YGS+ +++   S+ +LW  GFIFLFTVGGLTGIIL+NA +DV LHDTY+VVAHFHYVLS+GAVFSIFAGFIHW+PLF+G+ ++   L +HF  MF+GVN+TFFPQH+LGLQGMPRR  DYSD+Y F N +S LGSII+++ ++ FFYI+++S     + I +    +  E ++L YP  +H  ES V
Sbjct:   25 RWIFSTNHKDIGTWYLILGVLMGLVGTSLSVLIRIELGSGGNIIGDSIFYNAIITAHGLIMIFFLGMPVMIGGFGNWLVPLLMGIIDMIFPRGNNFSLMLMIPSLLFIIISLLIGGGVGAGWTLYPPLTGNIQHSGISMDFAIFSIHIAGMSSILGAINFITTILNM-KIKIPSSSLPLFVWSINITAFLLLLSLPVLAGGLTMLLTDRNFNTSFFDPCGGGDPILFQHIFWFFGHPEVYILILPGFGLISHIIIFYSGKDFSFGHLGMLYAMLSIGFLGFIVWAHHMYTIGLDLDSRAYFTGATMIIGVPTGIKIFSWLATIYGSSWNIFDN-SISLLWALGFIFLFTVGGLTGIILSNASLDVCLHDTYYVVAHFHYVLSLGAVFSIFAGFIHWWPLFSGVNMNPFFLFSHFCTMFIGVNLTFFPQHFLGLQGMPRRYVDYSDEYIFWNKISSLGSIITLLSLVLFFYILIISLVEENRLISISSGPNSIEWISLVYPGPLHAYESQV 532          
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Match: L0L8P0 (Cytochrome c oxidase subunit 1 (Fragment) OS=Exorista larvarum OX=380514 GN=CO1 PE=3 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 311/507 (61.34%), Postives = 393/507 (77.51%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTS-ISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSE 1521
            +WLFST+HKDIGT+YF+ G   G++GT +S++IR EL  PGS +GD   YN ++TAH  IMIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  S+ LL  S    +G G+G T+YPPL+S I+    S D  + +LHLAGISSILGA+NFI T++ M   +F L R PLFVWS++ITA LLLLSLPVLA  +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +    SGK+ +FG LGMIYAM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIK+F WLATLYG+  +     S  +LW  GF+FLFTVGGLTG++LAN+ ID+ LHDTY+VVAHFHYVLSMGAVF+I AGF+HW+PLFTGL L+N +L   FI+MF+GVN+TFFPQH+LGL GMPRR SDY D Y+  N +S +GS IS++G+L+FFYI+  S  V ++ ++ +  +S  E      P+   +SE
Sbjct:    3 QWLFSTNHKDIGTLYFIFGAWAGMIGTSLSILIRTELGHPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLMLLLTSSMVENGAGTGWTVYPPLSSVIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSANFTLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLYGTQLNY----SPAILWALGFVFLFTVGGLTGVVLANSSIDIILHDTYYVVAHFHYVLSMGAVFAIMAGFVHWYPLFTGLTLNNMMLKTQFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTAWNVISTIGSTISLMGILYFFYIIWESMMVQRQVLYSIQLNSSIEWYQNTPPAEHSYSE 505          
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Match: A0A2R3SK61 (Cytochrome c oxidase subunit 1 OS=Imogine stellae OX=1879306 GN=COX1 PE=3 SV=1)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 318/509 (62.48%), Postives = 400/509 (78.59%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTL-NYPSVVHFSES 1524
            RWL+ST+HKDIGT+Y + GI  GL+GT  S +IR EL+ PGS L D H YN +ITAHGLIMIFFFVMPV+IGGFGNWL+P+Y+ SPDM+FPR NNMS  LL  S  LL  S    +G+G+G T+YPPL+ +I+ S  S D  + +LHLAG+SSILG+INFI TI V   +     + PLF+W++++TA++L+L+LPVLA GLTMLLTDR+FNT+FFDP GGGDPILFQH+FWFFGHPEVYILILPGFG+ISQ+  +YSGK+ +FGH+GM+YA++ IGFLGF+V AHHMYT+GLD+D+RAYFTGATMI+ VPTGIK+F WLAT YG           P LW  GFIFLFT+GGLTG++LA+A +D+SLHDTY+VVAHFHYVLSMGAVFSIFAG +HW+PLFTG VL+  + +A F V+F GVN+TFFPQH+LGL GMPRR  DY D +++ N+VS  GS+IS+VGV+FF  IV  +  V +  +++V  SS+ E +   NYP   H SES
Sbjct:    3 RWLYSTNHKDIGTLYLIFGIWAGLVGTAFSFIIRSELAQPGSILHDPHLYNGIITAHGLIMIFFFVMPVLIGGFGNWLIPLYLTSPDMAFPRLNNMSFWLLPPSFFLLLGSFLIETGVGTGWTVYPPLSGNIAQSGPSVDMAIFSLHLAGVSSILGSINFITTI-VNAKIQVSWGQIPLFLWAVMVTAYMLVLALPVLAGGLTMLLTDRNFNTTFFDPGGGGDPILFQHMFWFFGHPEVYILILPGFGMISQIVTFYSGKDSAFGHMGMVYAILGIGFLGFIVWAHHMYTVGLDIDTRAYFTGATMIIAVPTGIKIFSWLATFYGRPLGQQVDNLGP-LWATGFIFLFTLGGLTGVVLASASLDISLHDTYYVVAHFHYVLSMGAVFSIFAGLVHWWPLFTGTVLNTKMAIAQFWVLFTGVNLTFFPQHFLGLSGMPRRYMDYPDGFAYWNSVSSFGSLISVVGVIFFIVIVWEALVVERLVVYIVSPSSQSEWINADNYPVPFHTSES 509          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Sea Lamprey
Match: COX1 (cytochrome c oxidase subunit I [Source:NCBI gene;Acc:807802])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 296/483 (61.28%), Postives = 377/483 (78.05%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPI 1449
            RWLFST+HKDIGT+Y + G   G++GT +S++IR ELS PG+ LGD   +N ++TAH  +MIFF VMP+MIGGFGNWLVP+ + +PDM+FPR NNMS  LL  S+ LL  S    +G G+G T+YPPL  +++ +  S D  + +LHLAG+SSILGA+NFI TI  M        ++PLFVWS+LITA LLLLSLPVLAA +TMLLTDR+ NTSFFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFGIIS +  YY+GK+  FG++GM++AM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ +PTG+KVF WLATL+G     +T    P+LW  GFIFLFTVGGLTGI+L+N+ +D+ LHDTY+VVAHFHYVLSMGAVF+I AGF+HWFPLFTG  L+     AHFI+MF GVN+TFFPQH+LGL GMPRR SDY D Y+  N +S +GS +S++ V+ F +I+  ++   +K I
Sbjct:    5 RWLFSTNHKDIGTLYLIFGAWAGMVGTALSILIRAELSQPGTLLGDDQIFNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLLLLLASAGVEAGAGTGWTVYPPLAGNLAHTGASVDLTIFSLHLAGVSSILGAVNFITTIFNMKPPTMTQYQTPLFVWSVLITAVLLLLSLPVLAAAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGKIVWHT----PMLWALGFIFLFTVGGLTGIVLSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFTGYTLNETWAKAHFIIMFAGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIISSIGSTVSLIAVMLFMFILWEAFSAKRKAI 483          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Yeast
Match: COX1 (Subunit I of cytochrome c oxidase (Complex IV); Complex IV is the terminal member of the mitochondrial inner membrane electron transport chain; one of three mitochondrially-encoded subunits [Source:SGD;Acc:S000007260])

HSP 1 Score: 446.432 bits (1147), Expect = 3.618e-153
Identity = 266/474 (56.12%), Postives = 345/474 (72.78%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGS--FLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSI-SFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIV 1416
            RWL+ST+ KDI  +YF+L I  G+ GT MS++IR EL+ PGS    G+S  +N L+  H ++MIFF VMP +IGGFGN+L+P+ I + D +FPR NN++  +L   +  L  S    SG G+G T+YPPL+SI + S  S D  + ALHL  ISS+LGAINFIVT L M      + + PLFVWSI ITAFLLLLSLPVL+AG+TMLL DR+FNTSFF+ SGGGDPIL++H+FWFFGHPEVYILI+PGFGIIS +   YS K V FG + M+YAM  IG LGFLV +HHMY +GLD D+RAYFT ATMI+ +PTGIK+F WLAT++G +  L T    P+L+   F+FLFT+GGLTG+ LANA +DV+ HDTY+VV HFHYVLSMGA+FS+FAG+ +W P   GL  +  L    F ++F+G N+ FFP H+LG+ GMPRR+ DY D ++  N V+ +GS I+ + +  F YI+
Sbjct:    4 RWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPV-FGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLAT----PMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYIL 472          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Yeast
Match: AI5_ALPHA (Endonuclease I-SceIV; involved in intron mobility; encoded by a mobile group I intron within the mitochondrial COX1 gene [Source:SGD;Acc:S000007265])

HSP 1 Score: 301.597 bits (771), Expect = 1.055e-95
Identity = 191/322 (59.32%), Postives = 239/322 (74.22%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGS--FLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSI-SFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWL 960
            RWL+ST+ KDI  +YF+L I  G+ GT MS++IR EL+ PGS    G+S  +N L+  H ++MIFF VMP +IGGFGN+L+P+ I + D +FPR NN++  +L   +  L  S    SG G+G T+YPPL+SI + S  S D  + ALHL  ISS+LGAINFIVT L M      + + PLFVWSI ITAFLLLLSLPVL+AG+TMLL DR+FNTSFF+ SGGGDPIL++H+FWFFGHPEVYILI+PGFGIIS +   YS K V FG + M+YAM  IG LGFLV +HHMY +GLD D+RAYFT ATMI+ +PTGIK+F WL
Sbjct:    4 RWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPV-FGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWL 324          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Yeast
Match: AI4 (Endonuclease I-SceII; encoded by a mobile group I intron within the mitochondrial COX1 gene; intron is normally spliced by the BI4p maturase but AI4p can mutate to acquire the same maturase activity [Source:SGD;Acc:S000007264])

HSP 1 Score: 190.66 bits (483), Expect = 1.532e-54
Identity = 136/246 (55.28%), Postives = 176/246 (71.54%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGS--FLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLTSI-SFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILIL 732
            RWL+ST+ KDI  +YF+L I  G+ GT MS++IR EL+ PGS    G+S  +N L+  H ++MIFF VMP +IGGFGN+L+P+ I + D +FPR NN++  +L   +  L  S    SG G+G T+YPPL+SI + S  S D  + ALHL  ISS+LGAINFIVT L M      + + PLFVWSI ITAFLLLLSLPVL+AG+TMLL DR+FNTSFF+ SGGGDPIL++H+FWFFG     I++L
Sbjct:    4 RWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGQTVATIIML 249          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Yeast
Match: AI3 (Endonuclease I-SceIII; encoded by a mobile group I intron within the mitochondrial COX1 gene [Source:SGD;Acc:S000007263])

HSP 1 Score: 66.2402 bits (160), Expect = 3.473e-12
Identity = 42/78 (53.85%), Postives = 56/78 (71.79%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGS--FLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGN 231
            RWL+ST+ KDI  +YF+L I  G+ GT MS++IR EL+ PGS    G+S  +N L+  H ++MIFF VMP +IGGFGN
Sbjct:    4 RWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGN 81          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Nematostella
Match: EDO47640 (Cytochrome c oxidase subunit 1 [Source:UniProtKB/TrEMBL;Acc:A7RLP4])

HSP 1 Score: 268.085 bits (684), Expect = 1.023e-86
Identity = 149/263 (56.65%), Postives = 188/263 (71.48%), Query Frame = 1
Query:  745 IISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHR--SSRP--E*VTLNYPSVVHFSE 1521
            +ISQ+   +S K   FG+LGM+YAMI IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIKVF WLATLYG    L T    P+LW  GF+FLFT+GGLTG+ILAN+ +DV +HDTY+VVAHFHYVLSMGAVF+IFAGF  WF   TG   +      HF +MF+GVN+TFFPQH+LGL G PRR SD++D Y+  N V   GS IS+VGV++F ++V  +Y    K I  V    SS P  E V  + P++  ++E
Sbjct:    1 MISQIIPTFSAKNQIFGYLGMVYAMISIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDT----PMLWAIGFVFLFTIGGLTGVILANSSLDVVMHDTYYVVAHFHYVLSMGAVFAIFAGFYFWFGKITGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVENTGSSWPSLEWVQQSPPALHTYNE 259          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Nematostella
Match: EDO25331 (Cytochrome c oxidase subunit 1 [Source:UniProtKB/TrEMBL;Acc:A8DWS9])

HSP 1 Score: 177.563 bits (449), Expect = 7.416e-54
Identity = 88/132 (66.67%), Postives = 108/132 (81.82%), Query Frame = 1
Query:  754 QLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSM 1149
            ++ ++YS K   FG+LGM+YAMI IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ VPTGIKVF WLATLYG    L T    P+LW  GF+FLFT+GGLTG+ILAN+ +DV +HDTY+VVAHFHYVLSM
Sbjct:    2 KINLHYSAKNQIFGYLGMVYAMISIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDT----PMLWAIGFVFLFTIGGLTGVILANSSLDVVMHDTYYVVAHFHYVLSM 129          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Nematostella
Match: EDO49225 (Cytochrome c oxidase subunit 1 [Source:UniProtKB/TrEMBL;Acc:A7RGS3])

HSP 1 Score: 124.79 bits (312), Expect = 1.036e-33
Identity = 63/110 (57.27%), Postives = 80/110 (72.73%), Query Frame = 1
Query: 1099 LHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSY 1428
            +HDTY+VVAHFHYVLSMGAVF+IFAGF  WF   TG   +      HF +MF+GVN+TFFPQH+LGL G  RR SD++D Y+  N V   GS IS+VGV++F ++V  +Y
Sbjct:    1 MHDTYYVVAHFHYVLSMGAVFAIFAGFYFWFGKITGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFXRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAY 110          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Nematostella
Match: EDO26352 (Cytochrome c oxidase subunit 1 [Source:UniProtKB/TrEMBL;Acc:A8DV65])

HSP 1 Score: 78.1814 bits (191), Expect = 1.667e-17
Identity = 36/64 (56.25%), Postives = 49/64 (76.56%), Query Frame = 1
Query: 1237 HFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSY 1428
            HF +MF+GVN+TFFPQH+LGL G PRR SD++D Y+  N V   GS IS+VGV++F ++V  +Y
Sbjct:   17 HFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAY 80          
BLAST of cytochrome c oxidase subunit I vs. Ensembl Medaka
Match: COX1 (cytochrome c oxidase subunit I [Source:NCBI gene;Acc:805432])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 301/514 (58.56%), Postives = 385/514 (74.90%), Query Frame = 1
Query:    4 RWLFSTSHKDIGTXXXXXXXXXXXXXXXXXXVIRFELSFPGSFLGDSHYYNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMXXXXXXXXXXXXXXXXXXXXXXXXXXTLYPPLT-SISFSDYSADFCVLALHLAGISSILGAINFIVTILVMGCLDFPLIRSPLFVWSILITXXXXXXXXXXXXXXXTMLLTDRHFNTSFFDPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGHLGMIYAMIRIGFLGFLV*AHHMYTIGLDVDSRAYFTGATMIVGVPTGIKVFRWLATLYGSN*DLYTQ*SVPVLWVYGFIFLFTVGGLTGIILANALIDVSLHDTYFVVAHFHYVLSMGAVFSIFAGFIHWFPLFTGLVLSNNLLVAHFIVMFVGVNMTFFPQHYLGLQGMPRRVSDYSDDYSF*NNVSRLGSIISMVGVLFFFYIVLLSYWVIQKPIFLVHRSSRPE*VTLNYPSVVHFSESSVFIRV 1542
            RW FST+HKDIGT+Y + G   G++GT +S++IR ELS PGS LGD   YN ++TAH  +MIFF VMP+MIGGFGNWL+P+ I +PDM+FPR NNMS  LL  S  LL  S    +G G+G T+YPPL+ +++ +  S D  + +LHLAGISSILGAINFI TI+ M        ++PLFVW++LITA LLLLSLPVLAAG+TMLLTDR+ NT+FFDP+GGGDPIL+QH+FWFFGHPEVYILILPGFG+IS +  YYSGK+  FG++GM++AM+ IG LGF+V AHHM+T+G+DVD+RAYFT ATMI+ +PTG+KVF WLATL+G +    T    P+LW  GFIFLFTVGGLTGI+LAN+ +D+ LHDTY+VVAHFHYVLSMGAVF+I   F+HWFPLF+G  L       HF VMFVGVN+TFFPQH+LGL GMPRR SDY D Y+  N +S LGS+IS++ V+ F +I+  ++   ++ +  V  ++         P   H  E   F+++
Sbjct:    5 RWFFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLSGNLAHAGASVDLTIFSLHLAGISSILGAINFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWET----PLLWALGFIFLFTVGGLTGIVLANSSLDIMLHDTYYVVAHFHYVLSMGAVFAIMGAFVHWFPLFSGYTLHGTWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTISSLGSLISLIAVIMFLFILWEAF-AAKREVLSVELTATNVEWLHGCPPPYHTFEEPAFVQI 513          
The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase subunit I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-CO10.000e+059.45mitochondrially encoded cytochrome c oxidase I [So... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctc-15.868e-16152.72Cytochrome c oxidase subunit 1 [Source:UniProtKB/... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:CoI0.000e+060.75gene:FBgn0013674 transcript:FBtr0100861[more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-co10.000e+058.37cytochrome c oxidase subunit I [Source:NCBI gene;A... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ralgapb0.000e+058.17Ral GTPase activating protein, beta subunit (non-c... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Co10.000e+059.73mitochondrially encoded cytochrome c oxidase I [So... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q34345|COX1_DROMA0.000e+060.95Cytochrome c oxidase subunit 1 OS=Drosophila mauri... [more]
sp|P00400|COX1_DROYA0.000e+060.95Cytochrome c oxidase subunit 1 OS=Drosophila yakub... [more]
sp|Q34388|COX1_DROSI0.000e+060.75Cytochrome c oxidase subunit 1 OS=Drosophila simul... [more]
sp|P00399|COX1_DROME0.000e+060.75Cytochrome c oxidase subunit 1 OS=Drosophila melan... [more]
sp|Q34391|COX1_DROSE0.000e+060.55Cytochrome c oxidase subunit 1 OS=Drosophila seche... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PTD00.000e+098.05Cytochrome c oxidase subunit 1 (Fragment) OS=Schmi... [more]
A0A0B4VK860.000e+097.67Cytochrome c oxidase subunit 1 (Fragment) OS=Schmi... [more]
A0A0E3UUJ70.000e+065.69Cytochrome c oxidase subunit 1 OS=Obama sp. MAP-20... [more]
L0L8P00.000e+061.34Cytochrome c oxidase subunit 1 (Fragment) OS=Exori... [more]
A0A2R3SK610.000e+062.48Cytochrome c oxidase subunit 1 OS=Imogine stellae ... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX10.000e+061.28cytochrome c oxidase subunit I [Source:NCBI gene;A... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
COX13.618e-15356.12Subunit I of cytochrome c oxidase (Complex IV); Co... [more]
AI5_ALPHA1.055e-9559.32Endonuclease I-SceIV; involved in intron mobility;... [more]
AI41.532e-5455.28Endonuclease I-SceII; encoded by a mobile group I ... [more]
AI33.473e-1253.85Endonuclease I-SceIII; encoded by a mobile group I... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO476401.023e-8656.65Cytochrome c oxidase subunit 1 [Source:UniProtKB/... [more]
EDO253317.416e-5466.67Cytochrome c oxidase subunit 1 [Source:UniProtKB/... [more]
EDO492251.036e-3357.27Cytochrome c oxidase subunit 1 [Source:UniProtKB/... [more]
EDO263521.667e-1756.25Cytochrome c oxidase subunit 1 [Source:UniProtKB/... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX10.000e+058.56cytochrome c oxidase subunit I [Source:NCBI gene;A... [more]
back to top
BLAST of cytochrome c oxidase subunit I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010375
GenBankYP_008592428.2
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010375 ID=SMED30010375|Name=cytochrome c oxidase subunit I|organism=Schmidtea mediterranea sexual|type=transcript|length=1545bp
tatcgttggctgttttctacttctcataaggatattggtactatgtactt
tttgttaggtattttaatgggtttattgggtactggtatgagtatggtta
ttcgttttgagttgagttttccaggtagctttttgggtgattctcattat
tataattgtttaattacagctcatggtttaattatgattttcttctttgt
aatgcctgttatgattggaggatttggtaattggttagtaccgatttata
tttattctccagatatgtcctttcctcgtgctaataatatgagtctgtta
ttattgttttcttcaattgctttgctatttatgtcgttgttttctgggtc
tggattaggttctggttgaactttgtatcctcctttgacttcaatttctt
ttagtgattattctgctgatttttgtgttttagcgttacatttggctgga
ataagctctattttgggtgctattaattttatagttactattttagtaat
gggttgtttagattttcctttgattcgttctccgttgtttgtgtggtcta
ttttaattactgcctttttgttgcttttatctcttcctgtgttagctgct
gggttaactatgttgttgactgatcgtcactttaatacttctttctttga
cccatctggtggtggtgatcctattctttttcagcatattttttggttct
tcggtcatcctgaggtttatattttgattcttcctgggtttggtattatt
tctcaattggctgtttattacagtggtaaggaggtttcttttggacattt
gggtatgatttatgctatgataagaattggatttttaggtttcttagttt
gagctcatcatatgtatactataggtttagatgttgattctcgtgcttat
ttcacaggagctactatgatagtcggtgttccaactggaataaaggtatt
taggtggttagctactttatatggttctaattgagatttgtacacacagt
gatctgttcctgtattatgggtttatgggtttatcttcttgtttactgtt
ggtggtctgacaggtattattttagctaatgctttgatagatgttagttt
acatgatacttactttgttgtagctcattttcattatgttctttcaatgg
gtgctgtgttttctatatttgctggttttatccattggttccctcttttc
acaggtttagttttaagtaataatttgttagtagctcactttatagtcat
gtttgtaggtgtaaatatgacattttttccccaacattacttaggacttc
aaggaatgcctcgtcgtgtatctgattattctgatgattattctttttga
aacaatgtttctaggttaggctctattatttcaatggttggagtgttatt
ttttttctatatagttttattgtcatattgggttattcaaaagcctatat
ttttagtacatcgttcttctagaccagaatgagttactttaaattatcct
tctgttgttcattttagtgaatcttctgtttttattcgtgtttaa
back to top

protein sequence of SMED30010375-orf-1

>SMED30010375-orf-1 ID=SMED30010375-orf-1|Name=SMED30010375-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MGCLDFPLIRSPLFVWSILITAFLLLLSLPVLAAGLTMLLTDRHFNTSFF
DPSGGGDPILFQHIFWFFGHPEVYILILPGFGIISQLAVYYSGKEVSFGH
LGMIYAMIRIGFLGFLV*
back to top

protein sequence of SMED30010375-orf-2

>SMED30010375-orf-2 ID=SMED30010375-orf-2|Name=SMED30010375-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
YRWLFSTSHKDIGTMYFLLGILMGLLGTGMSMVIRFELSFPGSFLGDSHY
YNCLITAHGLIMIFFFVMPVMIGGFGNWLVPIYIYSPDMSFPRANNMSLL
LLFSSIALLFMSLFSGSGLGSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0009060aerobic respiration
GO:0055114oxidation-reduction process
GO:0006119oxidative phosphorylation
GO:1902600hydrogen ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000883Cyt_C_Oxase_1
IPR023616Cyt_c_oxase-like_su1_dom
Vocabulary: molecular function
TermDefinition
GO:0004129cytochrome-c oxidase activity
GO:0009055electron carrier activity
GO:0005506iron ion binding
GO:0020037heme binding
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0045277respiratory chain complex IV
GO:0070469respiratory chain