Oxidation resistance protein 1

Overview
NameOxidation resistance protein 1
Smed IDSMED30010370
Length (bp)1863
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxidation resistance protein 1 (SMED30010370) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxidation resistance protein 1 (SMED30010370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxidation resistance protein 1 (SMED30010370) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxidation resistance protein 1 (SMED30010370) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010370SMESG000038268.1 SMESG000009764.1 Contig4875GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010370SMESG000038268.1 SMESG000009764.1 SMESG000009763.1 dd_Smed_v4_6537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010370SMESG000038268.1 SMESG000009764.1 SMESG000009763.1 dd_Smed_v4_6537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010370SMESG000038268.1 SMESG000009764.1 SMESG000009763.1 dd_Smed_v4_6537_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Match: TLDC2 (TBC/LysM-associated domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16112])

HSP 1 Score: 123.635 bits (309), Expect = 1.441e-31
Identity = 56/161 (34.78%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L++ ++++L  H P    G  W L++ T RDG+SLQ+LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  LF G +  C TFN+  L + E F I  +E W
Sbjct:   53 SQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRM-EGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212          
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Match: TLDC2 (TBC/LysM-associated domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16112])

HSP 1 Score: 123.635 bits (309), Expect = 1.441e-31
Identity = 56/161 (34.78%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L++ ++++L  H P    G  W L++ T RDG+SLQ+LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  LF G +  C TFN+  L + E F I  +E W
Sbjct:   53 SQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRM-EGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212          
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 110.153 bits (274), Expect = 9.066e-27
Identity = 52/162 (32.10%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +  +++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:   54 SELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWA 214          
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 109.768 bits (273), Expect = 2.045e-26
Identity = 52/162 (32.10%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +  +++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:   81 SELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWA 241          
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 114.005 bits (284), Expect = 1.151e-25
Identity = 92/351 (26.21%), Postives = 158/351 (45.01%), Query Frame = 3
Query:  822 EDLSERESNKSHANTSNDGNHYQLKQLTD------NNYLCVIASPRYRKT-----KAIYQ------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSF---SKINRNDPDHSSFVDAFGLIREKSMDWEIIN----NDFDLLTCQNSIYDDS---QFSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +S++E+   H  TS DG+      L +      + +LC+      RKT      A  Q      K+ EYWF VP   T+ +  +                 +W  E      + +  +  R P F    KI  ++    S   A       + +WEI      N   + T +  +  +S     SD S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +  +++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:  515 QQVSQKEAK--HKITSADGHIESSALLKEKQRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI---------------QWSPEIY----AEDTGEYTREPGFIVVKKIEESETIEDSSNQA------AAREWEITTREDINSKQVATVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWA 837          

HSP 2 Score: 71.2478 bits (173), Expect = 3.351e-12
Identity = 48/179 (26.82%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E +      +  +    S           +S  SE E     + + ++K+N KYIT  +G + G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   +MY +
Sbjct:   93 YTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVVSSTSEEE---EAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKNDPLVQENGCEEYGIMCPMEEVMSAAMYKE 268          
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 92.4337 bits (228), Expect = 3.639e-19
Identity = 103/403 (25.56%), Postives = 176/403 (43.67%), Query Frame = 3
Query:  678 IRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSER---ESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPR--YRKTKAIYQK-EDEYWFIVPASSTETVLNYLSSKTEYDTG---------------ANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNV--FDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFV--------IGSSNCKHAIRINSSLFNGITQACETFNSPPLVK-SESFQISSVEVWS 1790
            +R Q    R+     NH   F C  S DE  +P+ F  V         +++ ER   +SN S A+ S     Y   +LT N      ++    Y +  A   K + E+WF VP +  + + ++L   +    G               +N    K +I   ++   SL  +K       S +NR        V    + R  S+D E+          +  I D +  + S IL+   ++++++ +P  A G  W  IY + + G+SL T+YR +  FD   +  +LI+RD   +VFGA+ ++ IR +  F+G G + L  W    E     +   Y   GD +YFV        IG+ + ++ + +++ L +G +Q CETF++ PL    + F I  +E + 
Sbjct:  453 LRRQTAEARENSAKENHAGVFACATSSDE--APDLFAAV---------DEIMERNRIQSNDSTASQSPILPFYMAVRLTRNKKKKKSSTSSPSYDEDIAFGNKLKREFWFAVPRNQADNIYHFLLQWSPDKYGLDTTTSTTEEPSSVMSNDGQDKGFIVLGSNADESLGGEKSTPLFGSSLLNR----EWELVTVSEMCRRLSLDQEL----------ELPIPDGA--ATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQDFIIQFIEAYG 827          

HSP 2 Score: 57.3806 bits (137), Expect = 2.987e-8
Identity = 43/191 (22.51%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEE---SNTNDKKKIIDSFKVSSPESAD----------FLEQLSISCNSESELFPVHYKDN----------YIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQR 692
            Y +   DT+E VAA    T  +L  +NK++ R +   QK+ V     ++     ++         ++S  E+A+              +     ++++  P+    N          ++K+ VK +T+++G + G LL+TP  L F+P    P+V+E G D + +     +I  VS+Y + + +T  ++++
Sbjct:   14 YTITETDTLERVAASHDCTVGELMKLNKMASRMVFPGQKILVPLANADDVFDPPSSASSLKSSGNQISGIENAEDGIRKGPGGAVPAHVRRGSFTKTQSAPIPRGSNDEADTDCLQRFLKIKVKQVTESDGTVSGTLLVTPNCLMFDPDVSHPLVKENGPDLYGMVANMDEIQSVSVYKEISGLTGDKAEK 204          
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 92.0485 bits (227), Expect = 4.007e-19
Identity = 103/403 (25.56%), Postives = 176/403 (43.67%), Query Frame = 3
Query:  678 IRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSER---ESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPR--YRKTKAIYQK-EDEYWFIVPASSTETVLNYLSSKTEYDTG---------------ANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNV--FDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFV--------IGSSNCKHAIRINSSLFNGITQACETFNSPPLVK-SESFQISSVEVWS 1790
            +R Q    R+     NH   F C  S DE  +P+ F  V         +++ ER   +SN S A+ S     Y   +LT N      ++    Y +  A   K + E+WF VP +  + + ++L   +    G               +N    K +I   ++   SL  +K       S +NR        V    + R  S+D E+          +  I D +  + S IL+   ++++++ +P  A G  W  IY + + G+SL T+YR +  FD   +  +LI+RD   +VFGA+ ++ IR +  F+G G + L  W    E     +   Y   GD +YFV        IG+ + ++ + +++ L +G +Q CETF++ PL    + F I  +E + 
Sbjct:  463 LRRQTAEARENSAKENHAGVFACATSSDE--APDLFAAV---------DEIMERNRIQSNDSTASQSPILPFYMAVRLTRNKKKKKSSTSSPSYDEDIAFGNKLKREFWFAVPRNQADNIYHFLLQWSPDKYGLDTTTSTTEEPSSVMSNDGQDKGFIVLGSNADESLGGEKSTPLFGSSLLNR----EWELVTVSEMCRRLSLDQEL----------ELPIPDGA--ATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQDFIIQFIEAYG 837          

HSP 2 Score: 56.9954 bits (136), Expect = 3.593e-8
Identity = 43/191 (22.51%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEE---SNTNDKKKIIDSFKVSSPESAD----------FLEQLSISCNSESELFPVHYKDN----------YIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQR 692
            Y +   DT+E VAA    T  +L  +NK++ R +   QK+ V     ++     ++         ++S  E+A+              +     ++++  P+    N          ++K+ VK +T+++G + G LL+TP  L F+P    P+V+E G D + +     +I  VS+Y + + +T  ++++
Sbjct:   24 YTITETDTLERVAASHDCTVGELMKLNKMASRMVFPGQKILVPLANADDVFDPPSSASSLKSSGNQISGIENAEDGIRKGPGGAVPAHVRRGSFTKTQSAPIPRGSNDEADTDCLQRFLKIKVKQVTESDGTVSGTLLVTPNCLMFDPDVSHPLVKENGPDLYGMVANMDEIQSVSVYKEISGLTGDKAEK 214          
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 85.8853 bits (211), Expect = 1.525e-17
Identity = 53/173 (30.64%), Postives = 93/173 (53.76%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNV--FDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFV--------IGSSNCKHAIRINSSLFNGITQACETFNSPPLVK-SESFQISSVEVWS 1790
            S IL+   ++++++ +P  A G  W  IY + + G+SL T+YR +  FD   +  +LI+RD   +VFGA+ ++ IR +  F+G G + L  W    E     +   Y   GD +YFV        IG+ + ++ + +++ L +G +Q CETF++ PL    + F I  +E + 
Sbjct:  266 SQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQDFIIQFIEAYG 437          
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 85.8853 bits (211), Expect = 1.525e-17
Identity = 53/173 (30.64%), Postives = 93/173 (53.76%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNV--FDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFV--------IGSSNCKHAIRINSSLFNGITQACETFNSPPLVK-SESFQISSVEVWS 1790
            S IL+   ++++++ +P  A G  W  IY + + G+SL T+YR +  FD   +  +LI+RD   +VFGA+ ++ IR +  F+G G + L  W    E     +   Y   GD +YFV        IG+ + ++ + +++ L +G +Q CETF++ PL    + F I  +E + 
Sbjct:  266 SQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQDFIIQFIEAYG 437          
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 85.8853 bits (211), Expect = 1.525e-17
Identity = 53/173 (30.64%), Postives = 93/173 (53.76%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNV--FDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFV--------IGSSNCKHAIRINSSLFNGITQACETFNSPPLVK-SESFQISSVEVWS 1790
            S IL+   ++++++ +P  A G  W  IY + + G+SL T+YR +  FD   +  +LI+RD   +VFGA+ ++ IR +  F+G G + L  W    E     +   Y   GD +YFV        IG+ + ++ + +++ L +G +Q CETF++ PL    + F I  +E + 
Sbjct:  266 SQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQDFIIQFIEAYG 437          
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078816)

HSP 1 Score: 112.079 bits (279), Expect = 4.709e-28
Identity = 51/162 (31.48%), Postives = 95/162 (58.64%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++IL  E  ++L +H+P  A G  W LI++T + G++L +LYR +     +  ++++ D  HNVFGA+ +  + +S  FYG G ++L+++NP+F+ F     N Y + G+ +   IG+ + +  + ++  L  G +Q C T+ + PL   E F I ++E W+
Sbjct:   30 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKM-ARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWA 190          
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0273430)

HSP 1 Score: 112.079 bits (279), Expect = 4.709e-28
Identity = 51/162 (31.48%), Postives = 95/162 (58.64%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++IL  E  ++L +H+P  A G  W LI++T + G++L +LYR +     +  ++++ D  HNVFGA+ +  + +S  FYG G ++L+++NP+F+ F     N Y + G+ +   IG+ + +  + ++  L  G +Q C T+ + PL   E F I ++E W+
Sbjct:   30 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKM-ARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWA 190          
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078814)

HSP 1 Score: 112.079 bits (279), Expect = 6.880e-28
Identity = 51/162 (31.48%), Postives = 95/162 (58.64%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++IL  E  ++L +H+P  A G  W LI++T + G++L +LYR +     +  ++++ D  HNVFGA+ +  + +S  FYG G ++L+++NP+F+ F     N Y + G+ +   IG+ + +  + ++  L  G +Q C T+ + PL   E F I ++E W+
Sbjct:   51 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKM-ARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWA 211          
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078817)

HSP 1 Score: 112.079 bits (279), Expect = 7.743e-28
Identity = 51/162 (31.48%), Postives = 95/162 (58.64%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++IL  E  ++L +H+P  A G  W LI++T + G++L +LYR +     +  ++++ D  HNVFGA+ +  + +S  FYG G ++L+++NP+F+ F     N Y + G+ +   IG+ + +  + ++  L  G +Q C T+ + PL   E F I ++E W+
Sbjct:   48 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKM-ARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWA 208          
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078815)

HSP 1 Score: 111.694 bits (278), Expect = 3.739e-27
Identity = 51/162 (31.48%), Postives = 95/162 (58.64%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++IL  E  ++L +H+P  A G  W LI++T + G++L +LYR +     +  ++++ D  HNVFGA+ +  + +S  FYG G ++L+++NP+F+ F     N Y + G+ +   IG+ + +  + ++  L  G +Q C T+ + PL   E F I ++E W+
Sbjct:  105 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKM-ARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWA 265          
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 109.768 bits (273), Expect = 7.159e-27
Identity = 49/162 (30.25%), Postives = 93/162 (57.41%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S +L  E +++L  H+P    G  W L ++T + G S+++LYR +  S  +  +++++D +  +FGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD     +G    +  + ++  L++G T +C+TF +P L K+E F +  +E+W+
Sbjct:   51 SVLLQPEHIEKLAKHLPPRTIGYPWSLAFSTSKHGMSMKSLYRAM-QSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPMLSKTEDFFVQDIEIWA 211          
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Match: si:ch211-15d5.11 (si:ch211-15d5.11 [Source:ZFIN;Acc:ZDB-GENE-131121-177])

HSP 1 Score: 116.316 bits (290), Expect = 9.270e-27
Identity = 64/191 (33.51%), Postives = 103/191 (53.93%), Query Frame = 3
Query: 1227 DWEIINNDFDLLTCQNSIYDDSQ---FSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            DWEI++ +   L    S   DS     S S IL+++Q+KE+   +P    G  W L Y+T + G SL+TLYR +  +T +  +++++D N  VFG+  +  +  S +FYG G T LF  +P F+ FK    N++ + GD   F IG  +    + ++  LF G +  C TFN+  L ++  F I  +E W+
Sbjct:  462 DWEIVSAEESALKAPGSTEPDSLSYILSQSVILDAQQVKEISRELPPRTIGYTWQLSYSTDKHGASLKTLYRKL-SATDSPVLILIKDHNQQVFGSFLSHPLHPSDAFYGTGETFLFLSHPRFKCFKWTGENSFFIKGDLDSFAIGGGSGHFGLWVDERLFLGRSSPCFTFNNCSLSETNDFTILDLEAWT 651          
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 111.694 bits (278), Expect = 4.940e-25
Identity = 78/324 (24.07%), Postives = 152/324 (46.91%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT-----------KAIYQKEDEYWFIVPASSTETVLNYLSSKT-----EYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFS------------KINR-NDPDHSSFVDAFGLIREKSMDWEI-INNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +LC+      RKT            A   ++ EYWF VP+  ++ +  +    T     E   G   +P    + +N D   S  Q K V + +F             +I+  N  D  S      +  ++ ++ ++ + +D +  T + ++ + S      +L  E +++L  H+P    G  W L ++T + G S+++LYR    S  +  +++++D +  +FGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD     +G    +  + ++  L++G T +C+TF +P L K+E F +  +E+W+
Sbjct:  523 HKFLCLRVGRAMRKTFVSHASASMQQYAQRDRKHEYWFAVPSERSDHLFGFFVQWTPDVYGEGFGGLTREPGFVVVKKNQDAE-SGEQDKPVPDITFKDWEVVSVAEYYRRIDALNSEDLRSLCKRLQITTKEEVNSKLMVKSDPEPETFRPNLTEPSV-----LLQPEHIEKLAKHLPPRTIGYPWSLAFSTSKHGMSMKSLYR-AMQSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPMLSKTEDFFVQDIEIWA 839          

HSP 2 Score: 65.4698 bits (158), Expect = 1.404e-10
Identity = 48/179 (26.82%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV--------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLS-----ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSM 650
            Y+V   DT+ S+A  F  TP++L  +NKL  R ++  + L V                     +    E++     K +D        S             +S  SE E       + ++K+N KYITD +GI+ G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +M
Sbjct:   99 YVVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGKVLYVPDPEYISSAESSPSLSPISPLSPTSSEADLEKATKGLDHVHRRHSSSTGLAHGPPRPARVVSSTSEEE---EALTEKFLKMNCKYITDGKGIVSGVLLVTPNNIMFDPHKSDRLVQERGCEEYGIMCPLEEVQSAAM 274          
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Match: LO017815.1 (nuclear receptor coactivator 7-like [Source:NCBI gene;Acc:792958])

HSP 1 Score: 100.908 bits (250), Expect = 1.726e-23
Identity = 53/162 (32.72%), Postives = 89/162 (54.94%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S IL    L++L++H+P  A G +W L+Y+T   G SL+TLYR + +  R   ++++RD +  VFGA  +   R+S   YG G T L+ ++P F+ F+    N+Y + G      +G       + +++ L+ G + +C TF + PL     F +  +EVWS
Sbjct:   93 SQILKELHLEQLMSHIPARAQGNQWKLVYSTAVHGTSLRTLYRQMAELDR-PVLMVIRDTDGQVFGAFSSDPFRVSSYCYGTGETFLYSFSPEFQVFRWTGENSYFVRGFLDSLQMGGGGGPFGLWLDADLYRGSSYSCNTFCNRPLSLHHDFTVQELEVWS 253          
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 105.916 bits (263), Expect = 2.781e-23
Identity = 78/328 (23.78%), Postives = 152/328 (46.34%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT-----------KAIYQKEDEYWFIVPASSTETVLNYLSSKT-----EYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFS------------KINR-NDPDHSSFVDAFGLIREKSMDWEI-INNDFDLLTCQNSIYDDSQFSDSDILNSEQLKE----LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +LC+      RKT            A   ++ EYWF VP+  ++ +  +    T     E   G   +P    + +N D   S  Q K V + +F             +I+  N  D  S      +  ++ ++ ++ + +D +  T + ++ + S      +L  E +++    L  H+P    G  W L ++T + G S+++LYR    S  +  +++++D +  +FGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD     +G    +  + ++  L++G T +C+TF +P L K+E F +  +E+W+
Sbjct:  427 HKFLCLRVGRAMRKTFVSHASASMQQYAQRDRKHEYWFAVPSERSDHLFGFFVQWTPDVYGEGFGGLTREPGFVVVKKNQDAE-SGEQDKPVPDITFKDWEVVSVAEYYRRIDALNSEDLRSLCKRLQITTKEEVNSKLMVKSDPEPETFRPNLTEPSV-----LLQPEHIEKASYTLAKHLPPRTIGYPWSLAFSTSKHGMSMKSLYR-AMQSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPMLSKTEDFFVQDIEIWA 747          

HSP 2 Score: 65.855 bits (159), Expect = 1.137e-10
Identity = 48/179 (26.82%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV--------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLS-----ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSM 650
            Y+V   DT+ S+A  F  TP++L  +NKL  R ++  + L V                     +    E++     K +D        S             +S  SE E       + ++K+N KYITD +GI+ G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +M
Sbjct:    3 YVVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGKVLYVPDPEYISSAESSPSLSPISPLSPTSSEADLEKATKGLDHVHRRHSSSTGLAHGPPRPARVVSSTSEEE---EALTEKFLKMNCKYITDGKGIVSGVLLVTPNNIMFDPHKSDRLVQERGCEEYGIMCPLEEVQSAAM 178          
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Match: fbxo10 (F-box protein 10 [Source:Xenbase;Acc:XB-GENE-987647])

HSP 1 Score: 111.694 bits (278), Expect = 2.498e-27
Identity = 54/163 (33.13%), Postives = 91/163 (55.83%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKH-AIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S I  ++ +K+L  H+P    G  W L+Y+T +DG+SL+T+YR + ++  +  +LI++D    VFGA     + +S +FYG G T LF + P  + F+   +N++ + GD      G        + ++  L++G +Q CETFN+  L   E F I  +EVW+
Sbjct:   57 SQIFGADSIKQLCQHLPPRVLGHSWKLLYSTDKDGFSLRTMYRTM-NNVSSPVLLIVKDNEGRVFGAYSTIELHISNTFYGTGETFLFSFTPELKVFRWTGDNSFFVRGDADAITFGGGKTGSIGLWLDGDLYHGRSQRCETFNNQILSSHEQFYIHGLEVWA 218          
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 114.39 bits (285), Expect = 8.280e-26
Identity = 84/318 (26.42%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT--------KAIYQKED--EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE--NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFV---DAFGLIREKSMDWEIINNDFDLLTCQNS-IYDDSQ-------FSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + YLC+      RKT           Y + D  EYWF VP   ++ + ++                 +W  E    +V      ++  R P F  + +N+    S     D+   +      WEI   + D+ + Q + I +D +        SD S +L ++Q+++L  H+P    G  W L+Y+T + G SL+TLYR +        +L+++D +  +FGA+ +   ++S  FYG G T LF + P+FE FK   +N + + GD      G    + A+ ++  L++G +  C+TF +  L K E F +  +E+W+
Sbjct:  548 HRYLCLRVGKPMRKTFVSQASASMQQYAQRDKLEYWFAVPHERSDHLYSFFI---------------QWSPELYAEEV------RESAREPGFVVVKKNEETEGSDCSTNDSAARL------WEITTRE-DVNSKQATNIKNDQEPESFRPNLSDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTML-GLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCILSKKEDFIVQDIEIWA 836          

HSP 2 Score: 74.3294 bits (181), Expect = 3.862e-13
Identity = 49/175 (28.00%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                    +    S    +K  +     SSP  +       +S  SE E     + + ++K+N KYITD +G + G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +MY +
Sbjct:   97 YTVETRDSLNSIALKFDTTPNELVQLNKLFSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEE---EAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDPHKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKE 268          
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 114.39 bits (285), Expect = 8.492e-26
Identity = 84/318 (26.42%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT--------KAIYQKED--EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE--NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFV---DAFGLIREKSMDWEIINNDFDLLTCQNS-IYDDSQ-------FSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + YLC+      RKT           Y + D  EYWF VP   ++ + ++                 +W  E    +V      ++  R P F  + +N+    S     D+   +      WEI   + D+ + Q + I +D +        SD S +L ++Q+++L  H+P    G  W L+Y+T + G SL+TLYR +        +L+++D +  +FGA+ +   ++S  FYG G T LF + P+FE FK   +N + + GD      G    + A+ ++  L++G +  C+TF +  L K E F +  +E+W+
Sbjct:  547 HRYLCLRVGKPMRKTFVSQASASMQQYAQRDKLEYWFAVPHERSDHLYSFFI---------------QWSPELYAEEV------RESAREPGFVVVKKNEETEGSDCSTNDSAARL------WEITTRE-DVNSKQATNIKNDQEPESFRPNLSDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTML-GLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCILSKKEDFIVQDIEIWA 835          

HSP 2 Score: 74.3294 bits (181), Expect = 3.893e-13
Identity = 49/175 (28.00%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                    +    S    +K  +     SSP  +       +S  SE E     + + ++K+N KYITD +G + G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +MY +
Sbjct:   96 YTVETRDSLNSIALKFDTTPNELVQLNKLFSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEE---EAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDPHKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKE 267          
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 114.39 bits (285), Expect = 9.177e-26
Identity = 84/318 (26.42%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT--------KAIYQKED--EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE--NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFV---DAFGLIREKSMDWEIINNDFDLLTCQNS-IYDDSQ-------FSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + YLC+      RKT           Y + D  EYWF VP   ++ + ++                 +W  E    +V      ++  R P F  + +N+    S     D+   +      WEI   + D+ + Q + I +D +        SD S +L ++Q+++L  H+P    G  W L+Y+T + G SL+TLYR +        +L+++D +  +FGA+ +   ++S  FYG G T LF + P+FE FK   +N + + GD      G    + A+ ++  L++G +  C+TF +  L K E F +  +E+W+
Sbjct:  501 HRYLCLRVGKPMRKTFVSQASASMQQYAQRDKLEYWFAVPHERSDHLYSFFI---------------QWSPELYAEEV------RESAREPGFVVVKKNEETEGSDCSTNDSAARL------WEITTRE-DVNSKQATNIKNDQEPESFRPNLSDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTML-GLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCILSKKEDFIVQDIEIWA 789          

HSP 2 Score: 75.8702 bits (185), Expect = 1.105e-13
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD---SNAMTYIRSQRTLC--RQIHPPVNHEI 734
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                    +    S    +K  +     SSP  +       +S  SE E     + + ++K+N KYITD +G + G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +MY +   S     +   R  C  ++I P   H+I
Sbjct:   57 YTVETRDSLNSIALKFDTTPNELVQLNKLFSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEE---EAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDPHKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKEIVNSKLKDSLSCMREFCHLKKISPGNLHDI 258          
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 114.005 bits (284), Expect = 1.008e-25
Identity = 84/318 (26.42%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  909 NNYLCVIASPRYRKT--------KAIYQKED--EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE--NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFV---DAFGLIREKSMDWEIINNDFDLLTCQNS-IYDDSQ-------FSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + YLC+      RKT           Y + D  EYWF VP   ++ + ++                 +W  E    +V      ++  R P F  + +N+    S     D+   +      WEI   + D+ + Q + I +D +        SD S +L ++Q+++L  H+P    G  W L+Y+T + G SL+TLYR +        +L+++D +  +FGA+ +   ++S  FYG G T LF + P+FE FK   +N + + GD      G    + A+ ++  L++G +  C+TF +  L K E F +  +E+W+
Sbjct:  482 HRYLCLRVGKPMRKTFVSQASASMQQYAQRDKLEYWFAVPHERSDHLYSFFI---------------QWSPELYAEEV------RESAREPGFVVVKKNEETEGSDCSTNDSAARL------WEITTRE-DVNSKQATNIKNDQEPESFRPNLSDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTML-GLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCILSKKEDFIVQDIEIWA 770          

HSP 2 Score: 75.8702 bits (185), Expect = 1.015e-13
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD---SNAMTYIRSQRTLC--RQIHPPVNHEI 734
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                    +    S    +K  +     SSP  +       +S  SE E     + + ++K+N KYITD +G + G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +MY +   S     +   R  C  ++I P   H+I
Sbjct:   38 YTVETRDSLNSIALKFDTTPNELVQLNKLFSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEE---EAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDPHKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKEIVNSKLKDSLSCMREFCHLKKISPGNLHDI 239          
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Match: Tldc2 (TBC/LysM associated domain containing 2 [Source:MGI Symbol;Acc:MGI:2686178])

HSP 1 Score: 119.783 bits (299), Expect = 1.245e-30
Identity = 55/161 (34.16%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L + ++K+L  H+P    G  W L++ T RDG+SL+ LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  L++G +  C TFN+  L + E F I  +E W
Sbjct:   36 SQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQM-EGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLARREQFCIKELEAW 195          
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Match: Tldc2 (TBC/LysM associated domain containing 2 [Source:MGI Symbol;Acc:MGI:2686178])

HSP 1 Score: 119.783 bits (299), Expect = 1.935e-30
Identity = 55/161 (34.16%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L + ++K+L  H+P    G  W L++ T RDG+SL+ LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  L++G +  C TFN+  L + E F I  +E W
Sbjct:   50 SQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQM-EGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLARREQFCIKELEAW 209          
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 119.013 bits (297), Expect = 2.039e-27
Identity = 91/347 (26.22%), Postives = 155/347 (44.67%), Query Frame = 3
Query:  822 EDLSERESNKSHANTSNDGNHYQL----KQLTDNNYLCVIASPRYRKT-----KAIYQ------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE-NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN----NDFDLLTCQNSIYDDS---QFSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +S+RES  S A     G    L    ++   + +LC+      RKT      A  Q      K+ EYWF VP   T+ +  +                 +W  E   + SG     +  R P F  + + D   ++   A       + +WEI      N   +   +  +  +S     SD S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:  427 QQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI---------------QWSPEIYAEDSG-----EYTREPGFIVVKKMDESEANEAPAG---EAAAREWEITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWA 749          

HSP 2 Score: 70.4774 bits (171), Expect = 4.472e-12
Identity = 54/186 (29.03%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E    DK    D   V+ P+ A     +S       +S  SE E     + + ++K+N KYIT  +G + G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   +MY +
Sbjct:   12 YTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAE---FDKTTTPD---VAHPKEAPPASTVSGIRPARVVSSTSEEE---EAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKE 188          
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 119.013 bits (297), Expect = 2.039e-27
Identity = 91/347 (26.22%), Postives = 155/347 (44.67%), Query Frame = 3
Query:  822 EDLSERESNKSHANTSNDGNHYQL----KQLTDNNYLCVIASPRYRKT-----KAIYQ------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE-NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN----NDFDLLTCQNSIYDDS---QFSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +S+RES  S A     G    L    ++   + +LC+      RKT      A  Q      K+ EYWF VP   T+ +  +                 +W  E   + SG     +  R P F  + + D   ++   A       + +WEI      N   +   +  +  +S     SD S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:  427 QQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI---------------QWSPEIYAEDSG-----EYTREPGFIVVKKMDESEANEAPAG---EAAAREWEITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWA 749          

HSP 2 Score: 70.4774 bits (171), Expect = 4.472e-12
Identity = 54/186 (29.03%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E    DK    D   V+ P+ A     +S       +S  SE E     + + ++K+N KYIT  +G + G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   +MY +
Sbjct:   12 YTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAE---FDKTTTPD---VAHPKEAPPASTVSGIRPARVVSSTSEEE---EAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKE 188          
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 119.013 bits (297), Expect = 2.039e-27
Identity = 91/347 (26.22%), Postives = 155/347 (44.67%), Query Frame = 3
Query:  822 EDLSERESNKSHANTSNDGNHYQL----KQLTDNNYLCVIASPRYRKT-----KAIYQ------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE-NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN----NDFDLLTCQNSIYDDS---QFSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +S+RES  S A     G    L    ++   + +LC+      RKT      A  Q      K+ EYWF VP   T+ +  +                 +W  E   + SG     +  R P F  + + D   ++   A       + +WEI      N   +   +  +  +S     SD S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:  427 QQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI---------------QWSPEIYAEDSG-----EYTREPGFIVVKKMDESEANEAPAG---EAAAREWEITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWA 749          

HSP 2 Score: 70.4774 bits (171), Expect = 4.472e-12
Identity = 54/186 (29.03%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E    DK    D   V+ P+ A     +S       +S  SE E     + + ++K+N KYIT  +G + G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   +MY +
Sbjct:   12 YTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAE---FDKTTTPD---VAHPKEAPPASTVSGIRPARVVSSTSEEE---EAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKE 188          
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Match: sp|A0PJX2|TLDC2_HUMAN (TLD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TLDC2 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.918e-31
Identity = 56/161 (34.78%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L++ ++++L  H P    G  W L++ T RDG+SLQ+LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  LF G +  C TFN+  L + E F I  +E W
Sbjct:   53 SQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRM-EGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212          
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Match: sp|A2ACG1|TLDC2_MOUSE (TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 8.707e-30
Identity = 55/161 (34.16%), Postives = 95/161 (59.01%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L + ++K+L  H+P    G  W L++ T RDG+SL+ LYR + +      +L+LRD +  +FGA  ++ IR+S+ FYG G T LF ++P  + FK   +N++ + GD    ++GS + +  + ++  L++G +  C TFN+  L + E F I  +E W
Sbjct:   36 SQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQM-EGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLARREQFCIKELEAW 195          
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Match: sp|Q0IID2|TLDC2_BOVIN (TLD domain-containing protein 2 OS=Bos taurus OX=9913 GN=TLDC2 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.131e-29
Identity = 54/161 (33.54%), Postives = 93/161 (57.76%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S +L + ++ +L  H+P    G  W L + T RDG+SLQ+LYR + +      +L+LRD +  +FGA  ++ +R+S+ FYG G T LF ++P  + FK   +N++ + GD    ++G  + +  + ++  L+ G +  C TFN+  L + E F IS +E W
Sbjct:   55 SQVLGASEMSQLSLHLPPRVTGYSWSLAFCTSRDGFSLQSLYRQM-EGHSGPVLLVLRDQDGQMFGAFSSSALRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGCGSGRFGLWLDGDLYRGGSHPCATFNNEVLARQEQFCISELEAW 214          
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Match: sp|Q4V8B0|OXR1_RAT (Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 4.937e-26
Identity = 89/349 (25.50%), Postives = 154/349 (44.13%), Query Frame = 3
Query:  822 EDLSERESNKSHANTSNDGNHYQL----KQLTDNNYLCVIASPRYRKT-----KAIYQ------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSF---SKINRNDPDHSSFVDAFGLIREKSMDWEIIN----NDFDLLTCQNSIYDDS---QFSD-SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            + +++RES    A     G    L    ++   + +LC+      RKT      A  Q      K+ EYWF VP   T+ +  +                 +W  E      + +  +  R P F    K+  + PD +   +A       + +WEI      N       +  +  +S     SD S++L  +Q+++L  H+P    G  W L+Y T + G SL+TLYR +        +++++D +  VFGA+ +   ++S  FYG G T +F + P FE FK   +N + + GD      G    + A+ ++  L++G + +C+TF +  L K E F I  +E+W+
Sbjct:  515 QQVAQRESKHRGAPADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI---------------QWSPEIY----AEDTGEYTREPGFIVVKKMAESGPDEAPAGEA------AAREWEITTREDINSKQAAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTM-TGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWA 837          

HSP 2 Score: 74.3294 bits (181), Expect = 1.862e-12
Identity = 51/181 (28.18%), Postives = 86/181 (47.51%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEESNTNDKKKIIDSFKV--SSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E +      ++   +   SS ES+    ++  S + E E F     + ++K+N KYIT+ +G + G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   +MY +
Sbjct:   93 YTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVVHPKEAPPSSTESSIRPARVVSSTSEEEEAF----TEKFLKINCKYITNGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKE 269          
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Match: sp|A8KBE0|OXR1_XENTR (Oxidation resistance protein 1 OS=Xenopus tropicalis OX=8364 GN=oxr1 PE=2 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.461e-24
Identity = 52/162 (32.10%), Postives = 92/162 (56.79%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S +L ++Q+++L  H+P    G  W L+Y+T + G SL+TLYR +        +L+++D +  +FGA+ +   ++S  FYG G T LF + P+FE FK   +N + + GD      G    + A+ ++  L++G +  C+TF +  L K E F +  +E+W+
Sbjct:  708 SSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTML-GLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCILSKKEDFIVQDIEIWA 868          

HSP 2 Score: 73.9442 bits (180), Expect = 2.354e-12
Identity = 51/180 (28.33%), Postives = 84/180 (46.67%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV----------------------FTIKEEE-SNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            Y V   D++ S+A  F  TP++L  +NKL  R ++  Q L V                       T  E E   + D +++      SSP  +       +S  SE E     + + ++K+N KYITD +G + G LL+TP ++ F+P   D +VQE G +++ I  P  ++   +MY +
Sbjct:   97 YTVETRDSLNSIALKFDTTPNELVQLNKLFSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTDTERMPYKEITSSPAYSAIRPSRVVSSTSEEE---EAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDPHKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKE 273          
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Match: H2TCI2 (Oxidation resistance 1 OS=Takifugu rubripes OX=31033 GN=OXR1 PE=4 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 1.630e-38
Identity = 146/641 (22.78%), Postives = 269/641 (41.97%), Query Frame = 3
Query:  195 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFK------VSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMY---TDSNAMTYIR-------SQRTLCRQIHPPVNHEIFFTCQHS--LDEEKSPND------FETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQL----------------------KQLTDNNYLCVIASPRYRKT-----------KAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN-----------NDFDLLT-CQ----------NSIYDDSQFSD-------------SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            V   DT+ S++  F  TP+KL  +NKL  R ++  Q L V                  +      +  D +K+ DS        V  P      +   +S  SE E       + ++K+N KYITD +G + G LL+TP ++ F+P   DP+VQ +G +++ I  P  ++   ++Y   TD      +        S  T  R     V+ ++F   + S   +EE++ N+           T  +  I++  S  ++     ++++      L                      KQ   + +LC+      +KT            A   K+ EYWF VP   ++ +  +                 +W   + D+ G    + M + P F  + +N+   S+  +    +  K  +WE+++           N  DL + C+          NS +  S  ++             SD+L ++Q+++L  ++P    G  W L ++T + G S++TLYR    S     +++++D +  VFGA+ +   ++S  FYG G T LF +NP FE ++   +N + + GD      G  + +  + ++  L++G + +C+TF +P L K E F +  +E+W+
Sbjct:   22 VESRDTLNSISLKFDTTPNKLVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPVSPLSPSCSEADLEKVTDSDGPSRQDSVQPPVFPALRKSRVVSSTSEEE---EALTEKFLKINCKYITDGKGAVSGVLLVTPNNIMFDPHRMDPMVQAHGCEEYGIMCPLEEVQSAAIYKEITDPKIRETVPEDSGANDSGSTAPRSTEGSVSEDVFTESELSPIREEEQASNEDLRLDKSSGTSTESVLTITQVESAAKAPDGAGSSASQAEEPALTIPEDNPPDTATKNKSTGCAEKKQPRSHKFLCLRVGKPMKKTFVSNASASMQQYAQQGKKHEYWFAVPQERSDHLYVFF---------------MQW---SPDMYGE-GVRGMEQEPGFMVVKKNEVSESAEDEPITDLNVK--EWEVVSLTEYHRRIDALNSEDLRSLCKRLQITTKEEVNSQHGPSIKAELEPETFKPNLKEASDLLEADQIEKLAKNLPPRTIGYPWTLAFSTSKHGMSIKTLYR-AMQSQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFNPEFEVYRWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSKKEDFYVQDIEIWT 637          
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Match: A0A3Q2ZIS3 (Oxidation resistance 1 OS=Kryptolebias marmoratus OX=37003 GN=OXR1 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.917e-38
Identity = 148/644 (22.98%), Postives = 263/644 (40.84%), Query Frame = 3
Query:  222 VAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES------ADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKI--------------------ACVSMYTDSNAMTYIRSQRTLCRQIHP-----PVNHEIFFTCQHS--LDEEKSPN---------DFETVHTRKLSLISEDLSERESNKSHANTSNDG----------------NHYQLKQLTDNNYLCVIASPRYRKT-----------KAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN-----------NDFDL--------LTCQNSI----------------YDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            +A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS     PE       +   +   +S  SE E       + ++K+N KYITD  G + G LL+TP ++ F+P   DP+VQ +G +++ I  P  ++                     CVS +  +        QR +C    P      V+ ++F   + S   +EE++ N         D  T   + L+ + E  S +    +H++ S +                 N  Q K  + + +LC+      +KT            A   K++EYWF VP   +  +  +                K+W   + D+ G    + M + P F  + +N    +S  D   +      +WE+++           N  DL        +T +  +                +  +    S++L +EQ+++L  H+P    G  W L + T + G S++TLYR          +L+++D +  VFGA+ +   ++S  FYG G T LF +NP FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L K E F +  +E+W+
Sbjct:   24 IALEFDTTPNELVQLNKLFSRAVVPGQVLYVPDPDYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDAPPRPEGVHPPVFSALRQSRVVSSTSEEE---EALTEKFLKINCKYITDGMGAVSGVLLVTPNNIMFDPHRMDPLVQAHGCEEYGIMCPLEEVQSAAICKEITDPKIRECCSCTCVSFFPQTR-------QRYICVSTAPRSAGGSVSEDVFTETELSPIREEEQASNEDLRQDKSSDASTESVQTLTQV-EVTSSQAPGSAHSSVSQEEPAAAKTEDNPPDTATVNDSQSKHRS-HKFLCLRVGKPMKKTFVSNASASMQQYAQLGKKNEYWFAVPQERSNHLYVFF---------------KQW---SPDMYGE-GVRGMGQEPGFMVVKKNVVSETS--DDEPITERNVKEWEVVSLTEYHRRIDALNSEDLRSLCKRLQITTKEEVNSKHGTTIKAELEPETFKPNLREPSELLEAEQIEKLARHLPPRTIGYPWALAFGTSKHGMSIKTLYR-AMQGQDTPVLLVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFNPEFEVYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSKKEDFYVQDIEIWA 633          
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Match: A0A4W5KR88 (LysM domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.913e-35
Identity = 134/562 (23.84%), Postives = 233/562 (41.46%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKS----------HANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQ---------KEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIIN-NDFDLLTCQNSIYDDSQFSD--------SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            Y V P ++I S+A  F +TP+KL  +N+L  R++   Q                 + +    +  SP S D  E  +I                +IK++ KY TD  G++ G +++TP ++ F+P   DP+V E+G +++ +  P  ++  V++Y D +  T +    T                      +E SP +           +SE+   + SNK+           A   N     + K  T   +LC       RK+  I +         K+ EYWF VP    + +  +                   +  + DV G     K  R   F  + +   D  + +D F    + S  WEII  N+        S   +  F D        S +L    +++L   +P    G  W L Y+T   G SL+TLYR++ +   +  +L+++D+++ +FG       R+S   YG G T LF + P  + ++    N+Y + G+     +G    +  + +++ L++G T +C TF++ PL   + F I SVEVW+
Sbjct:   27 YTVGPQESINSIALKFNITPNKLVQLNRLFSRSVYPGQ-----------DGDFSGRSVRPLRREQSPPSED--ENPAIV--------------KFIKMSCKYFTDGMGVVGGVMIVTPNNIMFDPHKSDPLVIEHGCEEYGLICPMEEVVSVALYNDISRPTLLSLSETAA-------------ASGKCSSQEPSPAE---------ERLSEEEKRKRSNKAEVKSWLLERMQAPIQNMLLSTEDKSKTPPMFLCFKVGKPMRKSFIIGRTSSPVHTRGKQPEYWFAVPQERVDHLYAFF------------------VQWSPDVYG-----KEAREQGFVVVEK---DELNMIDNFFSDPKSSRSWEIITINEAKRRQSFGSYEGEEPFGDLLPMLSDPSALLQDTHIEKLACRLPARVQGYPWRLAYSTVEHGTSLKTLYRSLLE-VDSPVLLVIKDMDNQLFGGYSTHPFRVSEHCYGTGETFLFSFCPEIKVYRWTGENSYFVKGNIDSLQMGGGGGQIGLWLDADLYHGTTSSCATFHNQPLSTQKDFIIHSVEVWA 512          
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Match: H2YD23 (LysM domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.251e-34
Identity = 127/500 (25.40%), Postives = 209/500 (41.80%), Query Frame = 3
Query:  459 YKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQ-----IHPPVN-------HEIFFTCQHSLDEEKSPND----FETVHTRKLSLISE----DLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKED----------------EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENND--VSGSLNQKKMVRNPSFSKINRNDPDHSS------FVDAFGLIREKSMDWEIINND----------FDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRN--ACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            +++N+IK  V+YIT ++  ++G LL+TP ++ F+P   DP+  ++G ++F I    + +  VSM++D   M    S ++   +       PP +        +   T   + +  KSP++     E +    L L  E    D   +      +    D       Q  +  YLCV +     KT + + + D                E WF      ++ +L +           N DP      E N   V   L + ++        I++ D   +S      F++ F        +WEI++ D           +L     S+  D     S++LN + L EL  H+P    G  W L+Y+T+  G SL+TLYR V     +    +LI++D    +FGA C+    +S  FYG G T LF   PN   F     NN+ + G+     IG  +    + ++  L +G +  C TF + PL  SE F I +VEVW 
Sbjct:  185 FEENFIKTTVRYITSSQETVEGTLLVTPTNIMFDPDRNDPLAIKHGCEKFGIMCNLTLVTSVSMFSDKGCMVTSHSTQSTASKDAKSDTLPPQDVTLLAEDPDAIVTTSSNQEPPKSPSNQSDSSERITRADLKLKEEFPFLDSIVKSVGDFFSEEDLDSTMKPPAQQVERMYLCVRSDVPMMKTFSTHSELDAGNSHMTSSKTNDQSKETWFQTHRDRSDQLLAFFMQ-------WNPDPYALDFAEQNGFVVMDPLTEFELNDKTKCDLISKEDRGRTSTNTSLEFIEDFFSDSRIEKEWEIVSVDEARRRSTLGAIELANDDTSLMPD-LLDSSNLLNDDTLLELCRHIPARTIGCPWKLLYSTFEHGISLRTLYRKVASKYNDDTPVVLIVQDSGGQIFGAFCSNQPHVSEHFYGTGETFLFTLEPNITIFPWSGENNFFVKGNLDSLAIGGGDGSSGLWLDGDLCHGSSHTCLTFQNDPLASSEDFFIQNVEVWG 676          
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Match: R7VH22 (LysM domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_218966 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 8.945e-31
Identity = 87/308 (28.25%), Postives = 160/308 (51.95%), Query Frame = 3
Query:  915 YLCV-IASP---RYRKTKAIY-----QKEDEYWFIVPASSTETVLNYLS--SKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFG-LIREKSMDWEIINNDFDLLTCQNSIYDDSQFSD----SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            YLC+ +  P   R  KT  I      +++ EYWF +P    + +  +    S   Y    ++DP+++     +D S +     M            D     F+D+ G ++R+ + DWEI+N +        +  ++    +    S+I++ E ++ L  H+P  A G  W+L+Y++ R G+SL+TLYRN+ D   +  +L+++D   +VFG I    +++S  FYGNG + LF + P+F+KF    +NNY L G+ +   +G+      + ++  L++G +Q+C+T+++  L ++E F I  +E WS
Sbjct:  560 YLCLKVGIPTNKRISKTCPIEAYLKNKRKPEYWFSIPREKVDQLYAFFIQWSPNIYGVEEDIDPRERGFVVLDDTSDNEEDDGM------------DVVEDHFLDSRGKMVRQMTKDWEIVNIEEARRRISAAELENLPLPELSESSNIMDEEHIRRLCFHLPARAEGYPWNLVYSSDRHGFSLKTLYRNMND-IDSPILLVIKDTRDHVFGGIVPCALKISDHFYGNGESFLFTFFPDFKKFPWTGHNNYFLKGNTESMSVGAGEGSFGLWLDGDLYHGRSQSCKTYSNDILSETEDFVIKGLEAWS 854          

HSP 2 Score: 76.6406 bits (187), Expect = 1.189e-10
Identity = 73/274 (26.64%), Postives = 119/274 (43.43%), Query Frame = 3
Query:   39 LYE*KRFFLTFNKMAEN--CVKSISISDKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVF------TIKEEESNTNDKKKIIDSFKVSSPES------------ADF-LEQLSISCNSESEL---FPVHYK------------------------DNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIHP 716
            LY+ +++ L F K AE    VK    + +   ++    +  K  L+      + V   DT+ S+AA F  T S+L  +N+L  + +   Q + V       +     S+ +DK   I+  +VS P +             DF L Q   +    S L    P H +                        + +IKV VK+ITD +G++ G LL+TP +L F+P   DP+V E+G DQ+ +  P   +   +MY D  AM    S++T   ++ P
Sbjct:   10 LYDPRKYKLIFQKYAETEPTVKPGKENKRRSRVM----AQPKGTLE------HTVGSRDTLASIAAQFDTTTSELKKLNRLMTQMVFPGQVIYVPDQNFIPSTPSTPSSVDDKSLTINIPEVSPPPTDSSDKTDVKSPFPDFSLRQFLYAAKDVSLLKMRIPGHAERAQKAEVPQALTDDEAKRLDEECYERFIKVQVKHITDGQGVVNGVLLVTPNALMFDPNVSDPLVMEHGADQYGMIAPMDTVISAAMYHDIAAMRL--SRQTASDEVKP 271          
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 120.553 bits (301), Expect = 6.158e-28
Identity = 51/162 (31.48%), Postives = 94/162 (58.02%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L +EQ+++L  H+P    G  W L ++T + G S++TLYR +     +  +++++D +  VFGA+ +   ++S  FYG G T LF + P+FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L   E F +  +E+WS
Sbjct:  672 SDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYR-IMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSMKEDFFVQDIEIWS 832          

HSP 2 Score: 76.6406 bits (187), Expect = 4.179e-14
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  114 DKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES-ADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            DK     +M +   K  ++      Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS      E+ A      S       +S  SE E       + ++K+N KYITD +G++ G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   ++Y +
Sbjct:   59 DKKDASRRMSFQRPKGTIE------YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPASIPPAFSALRPSRVVSSTSEEE---EALTEKFLKINCKYITDGKGVVSGVLLVTPNNIMFDPHRTDPLVQERGCEEYGIMCPLEEVQSAAVYRE 256          
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 120.168 bits (300), Expect = 6.170e-28
Identity = 51/162 (31.48%), Postives = 94/162 (58.02%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L +EQ+++L  H+P    G  W L ++T + G S++TLYR +     +  +++++D +  VFGA+ +   ++S  FYG G T LF + P+FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L   E F +  +E+WS
Sbjct:  632 SDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYR-IMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSMKEDFFVQDIEIWS 792          

HSP 2 Score: 76.2554 bits (186), Expect = 5.637e-14
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  114 DKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES-ADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            DK     +M +   K  ++      Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS      E+ A      S       +S  SE E       + ++K+N KYITD +G++ G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   ++Y +
Sbjct:   19 DKKDASRRMSFQRPKGTIE------YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPASIPPAFSALRPSRVVSSTSEEE---EALTEKFLKINCKYITDGKGVVSGVLLVTPNNIMFDPHRTDPLVQERGCEEYGIMCPLEEVQSAAVYRE 216          
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 120.553 bits (301), Expect = 6.262e-28
Identity = 51/162 (31.48%), Postives = 94/162 (58.02%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L +EQ+++L  H+P    G  W L ++T + G S++TLYR +     +  +++++D +  VFGA+ +   ++S  FYG G T LF + P+FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L   E F +  +E+WS
Sbjct:  665 SDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYR-IMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSMKEDFFVQDIEIWS 825          

HSP 2 Score: 76.2554 bits (186), Expect = 4.694e-14
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  114 DKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES-ADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            DK     +M +   K  ++      Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS      E+ A      S       +S  SE E       + ++K+N KYITD +G++ G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   ++Y +
Sbjct:   79 DKKDASRRMSFQRPKGTIE------YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPASIPPAFSALRPSRVVSSTSEEE---EALTEKFLKINCKYITDGKGVVSGVLLVTPNNIMFDPHRTDPLVQERGCEEYGIMCPLEEVQSAAVYRE 276          
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 120.168 bits (300), Expect = 7.097e-28
Identity = 51/162 (31.48%), Postives = 94/162 (58.02%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L +EQ+++L  H+P    G  W L ++T + G S++TLYR +     +  +++++D +  VFGA+ +   ++S  FYG G T LF + P+FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L   E F +  +E+WS
Sbjct:  692 SDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYR-IMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSMKEDFFVQDIEIWS 852          

HSP 2 Score: 76.6406 bits (187), Expect = 4.272e-14
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  114 DKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES-ADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            DK     +M +   K  ++      Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS      E+ A      S       +S  SE E       + ++K+N KYITD +G++ G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   ++Y +
Sbjct:   79 DKKDASRRMSFQRPKGTIE------YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPASIPPAFSALRPSRVVSSTSEEE---EALTEKFLKINCKYITDGKGVVSGVLLVTPNNIMFDPHRTDPLVQERGCEEYGIMCPLEEVQSAAVYRE 276          
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 120.168 bits (300), Expect = 7.367e-28
Identity = 51/162 (31.48%), Postives = 94/162 (58.02%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L +EQ+++L  H+P    G  W L ++T + G S++TLYR +     +  +++++D +  VFGA+ +   ++S  FYG G T LF + P+FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L   E F +  +E+WS
Sbjct:  723 SDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYR-IMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSMKEDFFVQDIEIWS 883          

HSP 2 Score: 76.2554 bits (186), Expect = 4.914e-14
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  114 DKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES-ADFLEQLS-------ISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            DK     +M +   K  ++      Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K+ DS      E+ A      S       +S  SE E       + ++K+N KYITD +G++ G LL+TP ++ F+P   DP+VQE G +++ I  P  ++   ++Y +
Sbjct:  110 DKKDASRRMSFQRPKGTIE------YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPASIPPAFSALRPSRVVSSTSEEE---EALTEKFLKINCKYITDGKGVVSGVLLVTPNNIMFDPHRTDPLVQERGCEEYGIMCPLEEVQSAAVYRE 307          
BLAST of Oxidation resistance protein 1 vs. Ensembl Sea Lamprey
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 111.309 bits (277), Expect = 9.863e-26
Identity = 54/163 (33.13%), Postives = 91/163 (55.83%), Query Frame = 3
Query: 1299 SDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            S S IL  + + +L  ++P    G  W L Y+T + G SL+TLYR +     +  +L+++D +  +FGA+ +   ++S  FYG G T LF +NP ++ +K   +N + + GD     IG  + +  + ++  L++G +  C+TFN+  L K E F I  VEVW
Sbjct:  649 SSSSILEQDHINKLAANLPPRTVGYPWTLAYSTSKHGMSLKTLYRTMV-GLDSPMLLVIKDTDRQIFGALSSDPFKVSDHFYGTGETFLFTFNPEYQCYKWTGDNLFFIKGDMDSLAIGGGSGQFGLWLDEDLYHGRSHFCKTFNNETLSKKEDFFIQEVEVW 810          

HSP 2 Score: 67.0106 bits (162), Expect = 8.240e-12
Identity = 51/204 (25.00%), Postives = 90/204 (44.12%), Query Frame = 3
Query:  135 KMHYSNSKQILDDIKFDTYIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKL-----------------KVFTIKEEESNTNDKKKIID------------SFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTD 659
            +M +   K +++      Y     DT+ S+A  F  TP++L  +NKL  R ++  Q L                    +     S+  + +K+ D            +   SSP  A     +S +   E  L      + ++K+N KYIT+ +G++ G LL+TP ++ F+P   DP+V E G +++ I  P  ++   +MY D
Sbjct:   14 RMSFQKPKGMME------YTAGAQDTLNSIALKFDTTPNELVQLNKLFSRMIVPGQMLYCPDPDYMSSEGSSPSVSPVSPLSPTSSEAEFEKLQDMEPATQRPSERPAPATSSPNPARSARVVSSTSEEEEAL-----SERFLKINCKYITNGKGVVGGVLLVTPNNIMFDPHKLDPLVVENGCEEYGIICPMDEVISAAMYHD 206          
BLAST of Oxidation resistance protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002915.1 (pep scaffold:Pmarinus_7.0:GL486283:803:7015:1 gene:ENSPMAG00000002672.1 transcript:ENSPMAT00000002915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.033e-25
Identity = 50/151 (33.11%), Postives = 85/151 (56.29%), Query Frame = 3
Query: 1335 ELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVW 1787
            +L  ++P    G  W L Y+T + G SL+TLYR +     +  +L+++D +  +FGA+ +   ++S  FYG G T LF +NP ++ +K   +N + + GD     IG  + +  + ++  L++G +  C+TFN+  L K E F I  VEVW
Sbjct:    1 QLAANLPPRTVGYPWTLAYSTSKHGMSLKTLYRTMV-GLDSPMLLVIKDTDRQIFGALSSDPFKVSDHFYGTGETFLFTFNPEYQCYKWTGDNLFFIKGDMDSLAIGGGSGQFGLWLDEDLYHGRSHFCKTFNNETLSKKEDFFIQEVEVW 150          
BLAST of Oxidation resistance protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008752.1 (pep scaffold:Pmarinus_7.0:GL487419:1521:5503:-1 gene:ENSPMAG00000007923.1 transcript:ENSPMAT00000008752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 7.646e-25
Identity = 48/153 (31.37%), Postives = 82/153 (53.59%), Query Frame = 3
Query: 1332 KELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            ++L  H+P    G  W L Y T   G SL+TLYR       +  +L ++D +  VFGA+ +   ++S  FYG G   LF +NP+ + ++   +N + + GD     +GS      + ++S L++G +  C+TF + PL   E F ++ +EVW+
Sbjct:   28 QQLSRHLPPRTVGYPWQLKYGTATHGTSLRTLYR-ALAPLSSPVLLTVQDTHKQVFGALASEPFKVSEHFYGTGECFLFTFNPDLKVYRWTGDNTFFIKGDLDSLGMGSGRGAFGLWLDSDLYHGRSHHCDTFGNAPLSTQEDFSVNQLEVWA 179          
BLAST of Oxidation resistance protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003437.1 (pep scaffold:Pmarinus_7.0:GL481497:1413:14222:1 gene:ENSPMAG00000003138.1 transcript:ENSPMAT00000003437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.058e-11
Identity = 58/260 (22.31%), Postives = 100/260 (38.46%), Query Frame = 3
Query:  957 AIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE-----NNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFS--------DSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSL 1697
            A    + EYWF VP    + +  + +               +W  E          G            F  + R+D +    ++ F    + SMDWEI+  +  L         DS+          +S++L    +++ I  +    F  ++    AT R    + TLY+      + AC     D    VFGA  ++ IR +  +YG G T L+ +NP+F+ F+    N++ + GD    VIG  +    + +   L
Sbjct:   40 ACRGAQPEYWFAVPKDRVDQLYTFFA---------------QWTPEVCGCGGGAGGGGGGGGDGSGELGFVVLERHDAEALEAIEDF--YSDSSMDWEIVTLEEALRRQSLHTLTDSEPEPMWPTLNVESNLLQHHHIEKYIMKLKSNIFYMRYIFCQATCRHCRQVATLYQPRLLQNQAACSAAEADTQ--VFGAFVSSAIRCNDHYYGTGETFLYTFNPDFKIFRWTGENSFFISGDKDSLVIGGGDGVFGLWLGGDL 280          
BLAST of Oxidation resistance protein 1 vs. Ensembl Nematostella
Match: EDO46287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH3])

HSP 1 Score: 98.2117 bits (243), Expect = 6.032e-24
Identity = 48/164 (29.27%), Postives = 91/164 (55.49%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRW--NPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            S+I+  +Q+K+L   +P    G  W L+Y+T+  G+SL+TLYRN+ +   +  ++I+RD  H +FG + +  +R+S  FYG G + LF++  +   + +K    NN+ + G       GS      + ++   ++G +  CET+ +  L + + F  S++E W+
Sbjct:    5 SEIITEKQIKQLNKLLPSRTVGHTWMLVYSTFLHGFSLKTLYRNM-ECYDSPMLIIIRDDEHQIFGVLSSLPLRISDGFYGTGESFLFKFMEDGTIKDYKWTGENNFFMKGSRDSVAFGSGRGHFGLWLDEDFYHGSSNKCETYGNDTLSRHKDFLCSALEAWT 167          
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007318.2 (nuclear receptor coactivator 7 [Source:NCBI gene;Acc:101169561])

HSP 1 Score: 111.694 bits (278), Expect = 1.545e-27
Identity = 60/188 (31.91%), Postives = 106/188 (56.38%), Query Frame = 3
Query: 1227 DWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            +++ + N F +L+ Q+ + DD             LK L+ H+P      KW L+Y+T   G SL+TLYRN+     +  +L+++D++  VFGA  +   R+S+  YG G T LF ++P+F+++K    N+Y + GD +   IG      A+ +++ L++G + +C TF++P L   + F +  VEVW+
Sbjct:   45 EFQEVGNSFPVLSDQSQLIDD-----------RHLKTLLAHLPPRTQSYKWYLVYSTAIHGSSLKTLYRNM-AGLDSPVLLVIKDMHKKVFGAFSSDPFRISKYCYGTGETFLFTFSPDFQQYKWSGENSYFVSGDLESLQIGGGGGGFALWLDADLYHGASFSCPTFHNPTLSTHQDFIVQDVEVWT 220          
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007312.2 (nuclear receptor coactivator 7 [Source:NCBI gene;Acc:101169561])

HSP 1 Score: 111.694 bits (278), Expect = 1.545e-27
Identity = 60/188 (31.91%), Postives = 106/188 (56.38%), Query Frame = 3
Query: 1227 DWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            +++ + N F +L+ Q+ + DD             LK L+ H+P      KW L+Y+T   G SL+TLYRN+     +  +L+++D++  VFGA  +   R+S+  YG G T LF ++P+F+++K    N+Y + GD +   IG      A+ +++ L++G + +C TF++P L   + F +  VEVW+
Sbjct:   45 EFQEVGNSFPVLSDQSQLIDD-----------RHLKTLLAHLPPRTQSYKWYLVYSTAIHGSSLKTLYRNM-AGLDSPVLLVIKDMHKKVFGAFSSDPFRISKYCYGTGETFLFTFSPDFQQYKWSGENSYFVSGDLESLQIGGGGGGFALWLDADLYHGASFSCPTFHNPTLSTHQDFIVQDVEVWT 220          
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 116.316 bits (290), Expect = 1.354e-26
Identity = 77/339 (22.71%), Postives = 151/339 (44.54%), Query Frame = 3
Query:  837 RESNKSHANTSNDGNHYQ-LKQLTDNNYLCVIASPRYRKT-----------KAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKW-IDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEI-----INNDFDL---LTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            +E+ + +   S +G  Y   ++   + +LC+      +KT            A   K+ EYWF VP   ++ +  +                 +W  D   +  G + Q      P F  + +N+   ++  +    +  K  +WEI     +N+          +   +  +    SD+L ++Q+++L  ++P    G  W L + T + G S++TLYR          +++++D +  VFGA+ +   ++S  FYG G T LF + P FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L K E F +  +E+W+
Sbjct:  507 KETQEDNTQNSAEGTGYAGRRKHRSHKFLCLRVGRPMKKTFISNASASMQQYAQQGKKHEYWFAVPQERSDHLYVFF---------------MQWSPDMYGEGVGGMGQ------PGFKVVKKNEVSETAEDEPITDLNVK--EWEITTKEEVNSKHGPSIKAELEPETFKPNLTEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYR-AMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSKKEDFVVQDIEIWA 821          

HSP 2 Score: 70.0922 bits (170), Expect = 4.512e-12
Identity = 48/177 (27.12%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKV-----------------FTIKEEESNTNDKKKIIDSFKVSSPES------ADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSM 650
            Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q L V                  +     S+  D +K  DS  +  P++      +   +   +S  SE E       + ++K++ KYITD +G + G LL+TP ++ F+P   DP+VQ +G +++ I  P  ++   ++
Sbjct:  121 YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKATDSDALPRPDAVHPPVFSALRQSRVVSSTSEEE---EALTEKFLKISCKYITDGKGAVSGVLLVTPNNIMFDPHRMDPLVQAHGCEEYGIMCPLEEVQSAAV 294          
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 115.931 bits (289), Expect = 1.656e-26
Identity = 49/162 (30.25%), Postives = 91/162 (56.17%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L ++Q+++L  ++P    G  W L + T + G S++TLYR          +++++D +  VFGA+ +   ++S  FYG G T LF + P FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L K E F +  +E+W+
Sbjct:  602 SDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYR-AMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSKKEDFVVQDIEIWA 762          

HSP 2 Score: 70.4774 bits (171), Expect = 3.555e-12
Identity = 43/154 (27.92%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  189 YIVRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSM 650
            Y V   DT+ S+A  F  TP++L  +NKL  R ++  Q               D   +     V  P  +   +   +S  SE E       + ++K++ KYITD +G + G LL+TP ++ F+P   DP+VQ +G +++ I  P  ++   ++
Sbjct:   73 YSVESRDTLNSIALKFDTTPNELVQLNKLFSRAVVPGQ---------------DSDALPRPDAVHPPVFSALRQSRVVSSTSEEE---EALTEKFLKISCKYITDGKGAVSGVLLVTPNNIMFDPHRMDPLVQAHGCEEYGIMCPLEEVQSAAV 208          
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 115.546 bits (288), Expect = 2.420e-26
Identity = 49/162 (30.25%), Postives = 91/162 (56.17%), Query Frame = 3
Query: 1305 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACETFNSPPLVKSESFQISSVEVWS 1790
            SD+L ++Q+++L  ++P    G  W L + T + G S++TLYR          +++++D +  VFGA+ +   ++S  FYG G T LF + P FE +K   +N + + GD      G  + +  + ++  L++G + +C+TF +P L K E F +  +E+W+
Sbjct:  652 SDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYR-AMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLSKKEDFVVQDIEIWA 812          

HSP 2 Score: 54.6842 bits (130), Expect = 2.364e-7
Identity = 31/111 (27.93%), Postives = 59/111 (53.15%), Query Frame = 3
Query:  336 SNTNDKKKIIDSFKVSSPES------ADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSM 650
            S+  D +K  DS  +  P++      +   +   +S  SE E       + ++K++ KYITD +G + G LL+TP ++ F+P   DP+VQ +G +++ I  P  ++   ++
Sbjct:  151 SSEADLEKATDSDALPRPDAVHPPVFSALRQSRVVSSTSEEE---EALTEKFLKISCKYITDGKGAVSGVLLVTPNNIMFDPHRMDPLVQAHGCEEYGIMCPLEEVQSAAV 258          
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Match: SMESG000038268.1 (SMESG000038268.1)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 456/489 (93.25%), Postives = 459/489 (93.87%), Query Frame = 3
Query:  195 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 1661
            VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSIS NSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQI PPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE NDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWE+            S Y    F+          K+LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS
Sbjct:   20 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISSNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIPPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDEKNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEV------------SWYIVIFFN----------KKLINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 486          
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Match: SMESG000038268.1 (SMESG000038268.1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 452/489 (92.43%), Postives = 452/489 (92.43%), Query Frame = 3
Query:  195 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 1661
            VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSIS NSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQI PPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE NDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWE                                  LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS
Sbjct:   20 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISSNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIPPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDEKNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWE----------------------------------LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 474          
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Match: SMESG000038268.1 (SMESG000038268.1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 452/494 (91.50%), Postives = 452/494 (91.50%), Query Frame = 3
Query:  195 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQ-----LSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 1661
            VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQ     LSIS NSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQI PPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE NDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWE                                  LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS
Sbjct:   20 VRPNDTIESVAALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQNGSSSLSISSNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQRTLCRQIPPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDEKNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWE----------------------------------LINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 479          
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Match: SMESG000009764.1 (SMESG000009764.1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 321/330 (97.27%), Postives = 324/330 (98.18%), Query Frame = 3
Query:  672 TYIRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISEDLSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 1661
            T I  ++TLCRQI PPVNHEIFFTCQHSLDEEKSPNDFET+HTRKLSLISEDLS RESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDE NDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS
Sbjct:   12 TAIDVEKTLCRQIPPPVNHEIFFTCQHSLDEEKSPNDFETIHTRKLSLISEDLSVRESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKEDEYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDEKNDVSGSLNQKKMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNSIYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 341          
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Match: SMESG000009763.1 (SMESG000009763.1)

HSP 1 Score: 309.686 bits (792), Expect = 3.289e-103
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  240 MTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQR 692
            MTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQR
Sbjct:    1 MTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFKVSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGKLLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTYIRSQR 151          
The following BLAST results are available for this feature:
BLAST of Oxidation resistance protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLDC21.441e-3134.78TBC/LysM-associated domain containing 2 [Source:HG... [more]
TLDC21.441e-3134.78TBC/LysM-associated domain containing 2 [Source:HG... [more]
OXR19.066e-2732.10oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR12.045e-2632.10oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR11.151e-2526.21oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmd-33.639e-1925.56LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-34.007e-1925.56LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-31.525e-1730.64LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-31.525e-1730.64LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-31.525e-1730.64LysM Domain (Peptidoglycan binding) protein [Sour... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtd4.709e-2831.48gene:FBgn0013576 transcript:FBtr0078816[more]
mtd4.709e-2831.48gene:FBgn0013576 transcript:FBtr0273430[more]
mtd6.880e-2831.48gene:FBgn0013576 transcript:FBtr0078814[more]
mtd7.743e-2831.48gene:FBgn0013576 transcript:FBtr0078817[more]
mtd3.739e-2731.48gene:FBgn0013576 transcript:FBtr0078815[more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxr1b7.159e-2730.25oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-15d5.119.270e-2733.51si:ch211-15d5.11 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
oxr1b4.940e-2524.07oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
LO017815.11.726e-2332.72nuclear receptor coactivator 7-like [Source:NCBI g... [more]
oxr1b2.781e-2323.78oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo102.498e-2733.13F-box protein 10 [Source:Xenbase;Acc:XB-GENE-98764... [more]
tbl28.280e-2626.42transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl28.492e-2626.42transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl29.177e-2626.42transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl21.008e-2526.42transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tldc21.245e-3034.16TBC/LysM associated domain containing 2 [Source:MG... [more]
Tldc21.935e-3034.16TBC/LysM associated domain containing 2 [Source:MG... [more]
Oxr12.039e-2726.22oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oxr12.039e-2726.22oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oxr12.039e-2726.22oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0PJX2|TLDC2_HUMAN6.918e-3134.78TLD domain-containing protein 2 OS=Homo sapiens OX... [more]
sp|A2ACG1|TLDC2_MOUSE8.707e-3034.16TLD domain-containing protein 2 OS=Mus musculus OX... [more]
sp|Q0IID2|TLDC2_BOVIN2.131e-2933.54TLD domain-containing protein 2 OS=Bos taurus OX=9... [more]
sp|Q4V8B0|OXR1_RAT4.937e-2625.50Oxidation resistance protein 1 OS=Rattus norvegicu... [more]
sp|A8KBE0|OXR1_XENTR1.461e-2432.10Oxidation resistance protein 1 OS=Xenopus tropical... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2TCI21.630e-3822.78Oxidation resistance 1 OS=Takifugu rubripes OX=310... [more]
A0A3Q2ZIS32.917e-3822.98Oxidation resistance 1 OS=Kryptolebias marmoratus ... [more]
A0A4W5KR883.913e-3523.84LysM domain-containing protein OS=Hucho hucho OX=6... [more]
H2YD231.251e-3425.40LysM domain-containing protein OS=Ciona savignyi O... [more]
R7VH228.945e-3128.25LysM domain-containing protein OS=Capitella teleta... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxr1b6.158e-2831.48oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
oxr1b6.170e-2831.48oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
oxr1b6.262e-2831.48oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
oxr1b7.097e-2831.48oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
oxr1b7.367e-2831.48oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oxr1b9.863e-2633.13oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000002915.11.033e-2533.11pep scaffold:Pmarinus_7.0:GL486283:803:7015:1 gene... [more]
ENSPMAT00000008752.17.646e-2531.37pep scaffold:Pmarinus_7.0:GL487419:1521:5503:-1 ge... [more]
ENSPMAT00000003437.11.058e-1122.31pep scaffold:Pmarinus_7.0:GL481497:1413:14222:1 ge... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462876.032e-2429.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007318.21.545e-2731.91nuclear receptor coactivator 7 [Source:NCBI gene;A... [more]
ENSORLT00000007312.21.545e-2731.91nuclear receptor coactivator 7 [Source:NCBI gene;A... [more]
oxr1b1.354e-2622.71oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b1.656e-2630.25oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b2.420e-2630.25oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Oxidation resistance protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038268.10.000e+093.25SMESG000038268.1[more]
SMESG000038268.10.000e+092.43SMESG000038268.1[more]
SMESG000038268.10.000e+091.50SMESG000038268.1[more]
SMESG000009764.10.000e+097.27SMESG000009764.1[more]
SMESG000009763.13.289e-103100.00SMESG000009763.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010370 ID=SMED30010370|Name=Oxidation resistance protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1863bp
CGATGTAATTTCGAATATAATTTATTTTATCGTATAAATTATATGAATAA
AAAAGGTTTTTTTTGACATTCAATAAGATGGCAGAAAATTGTGTAAAATC
GATATCAATATCAGATAAAGCAAAAACGCTTCTTAAAATGCATTATTCTA
ATTCCAAACAGATTTTGGATGATATCAAATTTGACACATATATTGTAAGA
CCAAATGATACAATTGAAAGTGTTGCAGCTCTTTTTAAAATGACGCCAAG
TAAATTGTTTCACATAAACAAGTTAAGTATGCGAACTTTACTTGTTAATC
AGAAATTGAAAGTATTCACGATAAAAGAGGAGGAATCAAATACCAATGAC
AAAAAAAAGATAATCGACTCATTCAAAGTTTCATCTCCAGAATCTGCTGA
TTTTTTAGAACAGTTATCTATTTCGTGCAATTCCGAATCGGAGCTATTTC
CGGTTCACTATAAGGACAACTATATAAAAGTCAATGTCAAATACATTACC
GATACCGAAGGTATCATCAAAGGAAAGTTACTCCTGACTCCAGTGTCCTT
GACATTCAATCCCGCATTCAAGGATCCAGTTGTACAAGAATATGGCATTG
ATCAGTTTATGATTCATTTACCTAATAGTAAAATTGCCTGCGTATCAATG
TACACTGATTCCAATGCGATGACTTACATACGATCTCAAAGAACTCTTTG
CCGGCAAATACATCCACCTGTTAATCATGAAATATTTTTCACTTGCCAGC
ATTCATTAGATGAAGAAAAAAGTCCCAATGATTTTGAAACAGTTCATACA
AGAAAACTGAGTTTGATTTCCGAAGACTTGTCCGAACGAGAGAGCAATAA
ATCTCATGCAAACACAAGCAATGATGGAAATCATTATCAACTCAAACAAT
TGACTGACAATAATTATTTATGTGTTATTGCTTCACCAAGATACAGGAAA
ACCAAAGCAATATATCAAAAAGAAGATGAATATTGGTTTATTGTTCCAGC
TTCTAGCACTGAAACGGTTTTAAATTATCTGAGCAGTAAAACTGAATACG
ATACAGGAGCTAATGTTGATCCTCAAAAGAAATGGATAGATGAAAATAAT
GATGTATCTGGTTCATTGAATCAGAAGAAAATGGTCAGAAATCCTAGTTT
TAGTAAGATCAATAGAAACGATCCAGATCATTCATCTTTCGTTGATGCGT
TTGGACTAATCAGAGAGAAGTCAATGGATTGGGAGATCATCAACAATGAC
TTCGATTTATTAACATGTCAGAATTCTATATACGACGATTCACAGTTTTC
GGACAGCGATATTTTGAATTCTGAACAATTGAAGGAGTTAATAAATCACG
TTCCGAAAGAAGCATTTGGTGCTAAATGGGATTTAATATATGCAACTTAT
AGAGATGGATGGAGTTTGCAGACTTTATATCGAAACGTTTTCGATTCAAC
AAGAAATGCTTGCATTCTTATATTAAGGGATTTAAATCATAACGTGTTTG
GAGCCATCTGCAACACATATATCCGCATGTCCAGATCCTTCTACGGAAAC
GGATTAACTGTTCTATTTCGATGGAATCCGAATTTTGAAAAATTCAAATG
TGTTCAGAACAATAATTATATTCTTTTCGGTGACCCAAAATATTTTGTCA
TTGGATCTTCAAATTGTAAACATGCAATACGAATCAACAGTTCCTTGTTC
AACGGAATCACTCAAGCTTGTGAAACGTTCAACTCCCCGCCTCTTGTTAA
ATCAGAAAGTTTTCAAATTTCTTCAGTAGAAGTTTGGTCATTTTATTAAT
AACTTTTCGAATTTTTAAATGACTTTTTTTTTTAATTTGAATATAATTTC
GCATTTCAAAAAA
back to top

protein sequence of SMED30010370-orf-1

>SMED30010370-orf-1 ID=SMED30010370-orf-1|Name=SMED30010370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=574bp
MAENCVKSISISDKAKTLLKMHYSNSKQILDDIKFDTYIVRPNDTIESVA
ALFKMTPSKLFHINKLSMRTLLVNQKLKVFTIKEEESNTNDKKKIIDSFK
VSSPESADFLEQLSISCNSESELFPVHYKDNYIKVNVKYITDTEGIIKGK
LLLTPVSLTFNPAFKDPVVQEYGIDQFMIHLPNSKIACVSMYTDSNAMTY
IRSQRTLCRQIHPPVNHEIFFTCQHSLDEEKSPNDFETVHTRKLSLISED
LSERESNKSHANTSNDGNHYQLKQLTDNNYLCVIASPRYRKTKAIYQKED
EYWFIVPASSTETVLNYLSSKTEYDTGANVDPQKKWIDENNDVSGSLNQK
KMVRNPSFSKINRNDPDHSSFVDAFGLIREKSMDWEIINNDFDLLTCQNS
IYDDSQFSDSDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTL
YRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWN
PNFEKFKCVQNNNYILFGDPKYFVIGSSNCKHAIRINSSLFNGITQACET
FNSPPLVKSESFQISSVEVWSFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036779LysM_dom_sf
IPR018392LysM_dom
IPR006571TLDc_dom
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018392LysM domainSMARTSM00257LysM_2coord: 37..80
e-value: 9.4E-6
score: 35.1
IPR018392LysM domainPFAMPF01476LysMcoord: 38..79
e-value: 1.7E-5
score: 24.8
IPR018392LysM domainPROSITEPS51782LYSMcoord: 36..79
score: 8.719
IPR018392LysM domainCDDcd00118LysMcoord: 37..79
e-value: 3.29905E-5
score: 39.3909
IPR006571TLDc domainSMARTSM00584109ultracoord: 410..573
e-value: 3.2E-30
score: 116.4
IPR006571TLDc domainPFAMPF07534TLDcoord: 436..572
e-value: 8.8E-27
score: 94.0
IPR036779LysM domain superfamilyGENE3DG3DSA:3.10.350.10coord: 25..95
e-value: 5.9E-7
score: 30.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..270
NoneNo IPR availablePANTHERPTHR23354NUCLEOLAR PROTEIN 7/ESTROGEN RECEPTOR COACTIVATOR-RELATEDcoord: 409..572
NoneNo IPR availablePANTHERPTHR23354:SF62MUSTARD, ISOFORM Vcoord: 409..572
NoneNo IPR availablePROSITEPS51886TLDCcoord: 411..573
score: 23.079
NoneNo IPR availableSUPERFAMILYSSF54106LysM domaincoord: 37..79