SANT domain-containing protein

Overview
NameSANT domain-containing protein
Smed IDSMED30010369
Length (bp)2379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SANT domain-containing protein (SMED30010369) t-SNE clustered cells

Violin plots show distribution of expression levels for SANT domain-containing protein (SMED30010369) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SANT domain-containing protein (SMED30010369) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SANT domain-containing protein (SMED30010369) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010369

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010369SMESG000035735.1 dd_Smed_v4_6124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SANT domain-containing protein vs. Ensembl Human
Match: CRAMP1 (cramped chromatin regulator homolog 1 [Source:HGNC Symbol;Acc:HGNC:14122])

HSP 1 Score: 125.946 bits (315), Expect = 6.940e-29
Identity = 84/219 (38.36%), Postives = 120/219 (54.79%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F    S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V IEL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       +R+TL
Sbjct:  166 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDHVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPIELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRVRKTL 377          
BLAST of SANT domain-containing protein vs. Ensembl Human
Match: CRAMP1 (cramped chromatin regulator homolog 1 [Source:HGNC Symbol;Acc:HGNC:14122])

HSP 1 Score: 125.946 bits (315), Expect = 6.940e-29
Identity = 84/219 (38.36%), Postives = 120/219 (54.79%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F    S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V IEL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       +R+TL
Sbjct:  166 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDHVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPIELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRVRKTL 377          
BLAST of SANT domain-containing protein vs. Ensembl Human
Match: AL031708.1 (novel protein)

HSP 1 Score: 50.447 bits (119), Expect = 7.113e-7
Identity = 32/81 (39.51%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  495 PNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGST 713
            P +  K+KEQVR FY RTW+ + +Y+ F    S+ +    QELY LI Y   R    KKIG  + +    KLNE++  G +
Sbjct:    7 PASMVKNKEQVRHFYYRTWHKITKYIDFDHVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGRS 83          
BLAST of SANT domain-containing protein vs. Ensembl Celegans
Match: R151.8 (pep chromosome:WBcel235:III:7226820:7229787:-1 gene:WBGene00020111.1 transcript:R151.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.8)

HSP 1 Score: 88.5817 bits (218), Expect = 6.821e-18
Identity = 59/212 (27.83%), Postives = 107/212 (50.47%), Query Frame = 3
Query:  387 VWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDS----SQAVQELYALINYSVF-RTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPP 1007
             WS ++   F   +K++GK+F+ + KF+  R          K+K+ V+ F+  +    K  L    D      +  +EL+ LIN   + R  V  K+   + EKL E+V  G+  ++   K +T++TP CPAL R  ++K  ++   +P+D+ I L P +      ++Q  QNP +R+K+  N +++ ++ FL  K   +      ++TL P
Sbjct:   90 AWSFDEVCAFHDGIKLHGKDFDSVVKFMAKRKME-------KTKDHVKTFFFNSAKAYKSLLAMTDDDFANIPRDARELFLLINACEYKRKTVNMKV---IVEKLKELVFEGTVVVRAGRKLVTIKTPPCPALCRYFSVKKGDK---VPNDLYIHLEPTSNGDHVFMRQRNQNPFLRVKLNANDRITKLLEFLHKKWSLAGDSTPISVTLWP 288          
BLAST of SANT domain-containing protein vs. Ensembl Fly
Match: crm (gene:FBgn0000376 transcript:FBtr0070496)

HSP 1 Score: 120.939 bits (302), Expect = 1.055e-27
Identity = 70/209 (33.49%), Postives = 114/209 (54.55%), Query Frame = 3
Query:  381 KTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNN--CGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRE 989
            KT W+  ++  FF AL  +GK+F  ++  I ++  R N N+    K+K+QVR  Y +T + + +Y++F  +  +  QELY LINY   R +++     +L EK    L ++V  G  T++C GK I ++TP C AL+RLN L    ++  +P  V + + P N     RVQ   QNPR R+ V ++++L   I     K +S+   + E
Sbjct:  111 KTTWTNVERNCFFDALNEFGKDFEAVANCINAKLKRRNANSDYSFKTKDQVRQHYYQTHHKICKYVRFSEELKKPAQELYTLINYGEMRRKLQ-----FLTEKHFMKLKQLVYQGQITVRCKGKNIRIKTPSCKALRRLNQLDDSLEDIRLPSKVEVLVTPANMEAFGRVQSLAQNPRGRIIVPLHKKLISFIKTFEYKWRSANQRLHE 314          
BLAST of SANT domain-containing protein vs. Ensembl Fly
Match: crm (gene:FBgn0000376 transcript:FBtr0070495)

HSP 1 Score: 120.939 bits (302), Expect = 1.055e-27
Identity = 70/209 (33.49%), Postives = 114/209 (54.55%), Query Frame = 3
Query:  381 KTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNN--CGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRE 989
            KT W+  ++  FF AL  +GK+F  ++  I ++  R N N+    K+K+QVR  Y +T + + +Y++F  +  +  QELY LINY   R +++     +L EK    L ++V  G  T++C GK I ++TP C AL+RLN L    ++  +P  V + + P N     RVQ   QNPR R+ V ++++L   I     K +S+   + E
Sbjct:  111 KTTWTNVERNCFFDALNEFGKDFEAVANCINAKLKRRNANSDYSFKTKDQVRQHYYQTHHKICKYVRFSEELKKPAQELYTLINYGEMRRKLQ-----FLTEKHFMKLKQLVYQGQITVRCKGKNIRIKTPSCKALRRLNQLDDSLEDIRLPSKVEVLVTPANMEAFGRVQSLAQNPRGRIIVPLHKKLISFIKTFEYKWRSANQRLHE 314          
BLAST of SANT domain-containing protein vs. Ensembl Zebrafish
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8255])

HSP 1 Score: 120.168 bits (300), Expect = 2.301e-27
Identity = 76/220 (34.55%), Postives = 122/220 (55.45%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLT 998
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +++ F +  S+ +    QELY LI Y+  R    KK+G  + +K    LNE++  G+TT++  G+ + ++ P+C ALK++   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R+ + ++R++S +I FL  K       IR++L 
Sbjct:  194 WSTEDKNSFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKISKHIDFNNVYSRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKICDPDGVSDEEDQKPVRLPLKVAVELQPRSNHSWARVQSLAHNPRLRMVIELHRKVSTLIEFLKQKWAVQDQRIRKSLA 406          
BLAST of SANT domain-containing protein vs. Ensembl Zebrafish
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8255])

HSP 1 Score: 101.679 bits (252), Expect = 1.323e-21
Identity = 60/176 (34.09%), Postives = 102/176 (57.95%), Query Frame = 3
Query:  510 KSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLT 998
            K+KEQVR FY RTW+ + +++ F +  S+ +    QELY LI Y+  R    KK+G  + +K    LNE++  G+TT++  G+ + ++ P+C ALK++   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R+ + ++R++S +I FL  K       IR++L 
Sbjct:    3 KNKEQVRHFYYRTWHKISKHIDFNNVYSRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKICDPDGVSDEEDQKPVRLPLKVAVELQPRSNHSWARVQSLAHNPRLRMVIELHRKVSTLIEFLKQKWAVQDQRIRKSLA 174          
BLAST of SANT domain-containing protein vs. Ensembl Xenopus
Match: pax5 (paired box 5 [Source:Xenbase;Acc:XB-GENE-479876])

HSP 1 Score: 124.405 bits (311), Expect = 1.910e-28
Identity = 83/219 (37.90%), Postives = 119/219 (54.34%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFIKSR-GSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL------NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF AL  +GK+F  I   I  +   +  P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G TT++  G+ + ++ P+C ALK+L        L   E +  +  P  V +EL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       IR+TL
Sbjct:  166 WSTEDKNTFFEALYEHGKDFEAIQNNIALKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYIDFNNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQLGVTTVRYKGRNLRIKAPMCRALKKLCDPDGKTGLSDEEDQKPVRLPLKVPVELQPRNNQAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALKEVRIRKTL 380          
BLAST of SANT domain-containing protein vs. Ensembl Xenopus
Match: pax5 (paired box 5 [Source:Xenbase;Acc:XB-GENE-479876])

HSP 1 Score: 111.309 bits (277), Expect = 2.321e-24
Identity = 75/197 (38.07%), Postives = 109/197 (55.33%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFIKSR-GSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDV 938
            WS EDK  FF AL  +GK+F  I   I  +   +  P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +    KLNE++  G TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V +EL PRN     RVQ   QNPR+R  + +N QL ++
Sbjct:   58 WSTEDKNTFFEALYEHGKDFEAIQNNIALKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYIDFNNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQLGVTTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPVELQPRNNQAWARVQSLAQNPRLRKNI-LNHQLKEL 249          
BLAST of SANT domain-containing protein vs. Ensembl Xenopus
Match: pax5 (paired box 5 [Source:Xenbase;Acc:XB-GENE-479876])

HSP 1 Score: 105.916 bits (263), Expect = 1.063e-22
Identity = 74/197 (37.56%), Postives = 108/197 (54.82%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFIKSR-GSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDV 938
            WS EDK  FF AL  +GK+F  I   I  +   +  P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +    KLNE++    TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V +EL PRN     RVQ   QNPR+R  + +N QL ++
Sbjct:  149 WSTEDKNTFFEALYEHGKDFEAIQNNIALKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYIDFNNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQ--VTTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPVELQPRNNQAWARVQSLAQNPRLRKNI-LNHQLKEL 338          
BLAST of SANT domain-containing protein vs. Ensembl Mouse
Match: Cramp1l (cramped chromatin regulator homolog 1 [Source:MGI Symbol;Acc:MGI:1930190])

HSP 1 Score: 126.716 bits (317), Expect = 3.312e-29
Identity = 84/219 (38.36%), Postives = 121/219 (55.25%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V +EL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       IR+TL
Sbjct:  163 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPVELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRIRKTL 374          
BLAST of SANT domain-containing protein vs. Ensembl Mouse
Match: Cramp1l (cramped chromatin regulator homolog 1 [Source:MGI Symbol;Acc:MGI:1930190])

HSP 1 Score: 126.716 bits (317), Expect = 3.312e-29
Identity = 84/219 (38.36%), Postives = 121/219 (55.25%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V +EL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       IR+TL
Sbjct:  163 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPVELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRIRKTL 374          
BLAST of SANT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PG95|CRML_MOUSE (Protein cramped-like OS=Mus musculus OX=10090 GN=Cramp1 PE=1 SV=3)

HSP 1 Score: 126.716 bits (317), Expect = 2.316e-28
Identity = 84/219 (38.36%), Postives = 121/219 (55.25%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F +  S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V +EL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       IR+TL
Sbjct:  163 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDNVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPVELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRIRKTL 374          
BLAST of SANT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96RY5|CRML_HUMAN (Protein cramped-like OS=Homo sapiens OX=9606 GN=CRAMP1 PE=1 SV=3)

HSP 1 Score: 125.946 bits (315), Expect = 3.333e-28
Identity = 84/219 (38.36%), Postives = 120/219 (54.79%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETL 995
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +Y+ F    S+ +    QELY LI Y   R    KKIG  + +K    LNE++  G+TT++  G+ + ++ P+C ALK+L   + L   E +  +  P  V IEL PRN     RVQ   QNPR+R+ V ++R++S +I FL  K       +R+TL
Sbjct:  166 WSTEDKNTFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASMVKNKEQVRHFYYRTWHKITKYIDFDHVFSRGLKKSSQELYGLICYGELR----KKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDPDGLSDEEDQKPVRLPLKVPIELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLKQKWALHEVRVRKTL 377          
BLAST of SANT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8MX88|CRM_DROSE (Protein cramped OS=Drosophila sechellia OX=7238 GN=crm PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.037e-27
Identity = 70/209 (33.49%), Postives = 115/209 (55.02%), Query Frame = 3
Query:  381 KTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNN--CGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRE 989
            KT W+  ++  FF AL  +GK+F  ++  I ++  R N N+    K+K+QVR  Y +T++ + +Y++F  +  +  QELY LINY   R +++     +L EK    L ++V  G  T++C GK I ++TP C AL+RLN L    ++  +P  V + + P N     RVQ   QNPR R+ V ++++L   I     K +S+   + E
Sbjct:  111 KTTWTNVERNCFFDALNEFGKDFEAVANCINAKLKRRNANSDYSFKTKDQVRQHYYQTYHKICKYVRFSEELKKPAQELYTLINYGEMRRKLQ-----FLTEKHFMKLKQLVYQGQITVRCKGKNIRIKTPSCKALRRLNQLDDSLEDIRLPSKVEVLVTPANMEAFGRVQSLAQNPRGRIIVPLHKKLISFIKTFEYKWRSANQRLHE 314          
BLAST of SANT domain-containing protein vs. UniProt/SwissProt
Match: sp|O76906|CRM_DROME (Protein cramped OS=Drosophila melanogaster OX=7227 GN=crm PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.134e-26
Identity = 70/209 (33.49%), Postives = 114/209 (54.55%), Query Frame = 3
Query:  381 KTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNN--CGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEK----LNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRE 989
            KT W+  ++  FF AL  +GK+F  ++  I ++  R N N+    K+K+QVR  Y +T + + +Y++F  +  +  QELY LINY   R +++     +L EK    L ++V  G  T++C GK I ++TP C AL+RLN L    ++  +P  V + + P N     RVQ   QNPR R+ V ++++L   I     K +S+   + E
Sbjct:  111 KTTWTNVERNCFFDALNEFGKDFEAVANCINAKLKRRNANSDYSFKTKDQVRQHYYQTHHKICKYVRFSEELKKPAQELYTLINYGEMRRKLQ-----FLTEKHFMKLKQLVYQGQITVRCKGKNIRIKTPSCKALRRLNQLDDSLEDIRLPSKVEVLVTPANMEAFGRVQSLAQNPRGRIIVPLHKKLISFIKTFEYKWRSANQRLHE 314          
BLAST of SANT domain-containing protein vs. TrEMBL
Match: A0A5K3FRU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 9.100e-84
Identity = 174/540 (32.22%), Postives = 265/540 (49.07%), Query Frame = 3
Query:  177 MKTRSFLDNSSNIASIVKARRNPSDIETTSFLQIGNDPIXXXXXXXXSNENFIQNISQNILPEKKVITKT----VWSMEDKILFFTALKIYGKNFNEISKFIKSRGSR---------------------------------------LNPNNC------------GKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPP-------------KLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCEN-------------------------ILKLNSGTPGAPKSSTENETP---------------------FFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEH------------SVSNGLRRLLHLSKHDYL 1418
            MKTRS   +  NIA+ VKARR           Q  + P   + +   ++ N I  I ++I   ++V  K     +W+  D+ LFF  +++YG+NFNE+++F++SRG R                                       L P+N             G++K+QVR FY +TW+ L++Y+K+P    Q V+E+YA+IN+S+ R R+KK +   LGEKLNE+V  GST +K NG+R  LRTPVCPALK+LN++  P QE+T+PDDV +ELVP   +  WRV + EQNPR+RL+V +NRQLSDVI+ +  K       IR  L   P++P              KL +R   + R    IS+QEVS+ R   I   +Y                            +    +  P +  S+ E++ P                        +D   + ++L +G+  E+AR +K++ +++ LGCP+ IRF Y+++     + + +             +SNGLRRLLHLS  +YL
Sbjct:    1 MKTRSTPVDPPNIAAGVKARRTARIGSPLYRSQSDSQPEEGSNSLPATSVNTIDKIDEHISKSRQVSQKASIKDIWTAYDRKLFFQGVRLYGRNFNELARFMRSRGHRTDTATNTTSNQLPVSSEVPSTNPQPNSPNVVAPVAAAAGLLPSNSTNQSGAQSAGVEGRTKDQVRLFYQQTWHKLRRYIKYPDGVPQHVREVYAIINWSIMRCRIKKALDNRLGEKLNELVHYGSTCVKHNGRRFLLRTPVCPALKQLNHISAPTQEFTLPDDVWVELVPATQMVAWRVLEAEQNPRLRLRVDINRQLSDVISLVEAKWVFPTDRIRSLLC--PVDPTAAAAAADNTQTSEKLLLRFVREQRLDGAISLQEVSRTRSTDIALNAYLARRQSSQSPSKTVSPADANVGNTTPDVVAGEGTAAPASRTSTHEDQRPAVPPRTGGAATAAAASTVTSGVVHLDLHTVGKQLATGVTFEEARAIKLIVIFLALGCPARIRFEYDFVQSGHGKASSYIALSKEAMANGEGISNGLRRLLHLSASEYL 538          
BLAST of SANT domain-containing protein vs. TrEMBL
Match: A0A068YHM0 (Protein cramped OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001053700 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 4.332e-77
Identity = 161/466 (34.55%), Postives = 237/466 (50.86%), Query Frame = 3
Query:  366 KKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLN----------PNNC------------------------------------------GKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPP--------KLHIRLSDDARFFKEISIQEVSKPRFDSITFKSY------CENILKLNSGTPGA------------------------------PKSSTENETP---FFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYL------------YPSDME----TAEHSVSNGLRRLLHLSKHDYL 1418
            +KV  K VW+ +D+ LFF  +++YG+NFNE+++F++SRG R +          P+ C                                          G++KEQVR  Y +TW+ L++Y+K+P D  Q V+E+YA+IN+SV R R+KK +   LGEKLNE+V  GST +K  G+R  LRTPVCP LK+LN++  P QE+T+P+DV +ELVP   +  WRV Q EQNPR+RLK  +NRQLSDVI+    K      LIR  L       P        KL +RL  + R    IS+QEVS+ R   I   +Y       +++ K  +    A                              P++     +P     ++D   + ++L +G+  E+AR +K++ +Y+ LGCP+ IRF Y++L            YP+ +     T    ++NGLRRLLHLS  +YL
Sbjct:   66 QKVSLKDVWTADDRRLFFLGVRLYGRNFNELARFVRSRGHRNDTYSTSATANQPSTCAEAPGTGSQSIGSSVVAPVAAAAGLLPGNPPNQSGVQLAAMDGRTKEQVRLLYQQTWHKLRRYIKYPDDVPQHVREVYAIINWSVMRFRIKKTLDNRLGEKLNELVHFGSTCVKHKGRRFLLRTPVCPILKQLNHISAPTQEFTLPEDVWVELVPATQMVAWRVLQAEQNPRLRLKTDINRQLSDVISLAEAKWILPTDLIRFLLCPSAETKPEEKGGVSEKLLLRLQREHRLDGAISLQEVSRTRSTDIALNAYLARRQASQDVPKPTAAGEDAPGASGTTSTSTAATGTSKASAQEGQRHLVPPRTGGSGASPNSAAVRLDLRGVGKQLANGVTFEEARGIKLVVIYLALGCPARIRFEYDFLQSSSTRASVSFSYPTSLPKEAITNGEGITNGLRRLLHLSASEYL 531          
BLAST of SANT domain-containing protein vs. TrEMBL
Match: A0A068WDJ0 (Protein cramped OS=Echinococcus granulosus OX=6210 GN=EgrG_001053700 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 9.308e-76
Identity = 161/475 (33.89%), Postives = 235/475 (49.47%), Query Frame = 3
Query:  366 KKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLN----------PNNC------------------------------------------GKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPP--------KLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYC------------------------------------------------ENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYL------------YPSDMETAE----HSVSNGLRRLLHLSKHDYL 1418
            +KV  K VW+ +D+ LFF  +++YG+NFNE+++F++SRG R +          P+ C                                          G++KEQVR  Y +TW+ L++Y+K+P D  Q V+E+YA+IN+SV R R+KK +   LGEKLNE+V  GST +K  G+R  LRTPVCP LK+LN++  P QE+T+P+DV +ELVP   +  WRV Q EQNPR+RLK  +NRQLSDVI+    K      LIR  L       P        KL +RL  + R    IS+QEVS+ R   I   +Y                                                  +++   +G  GA  +ST       ++D   + ++L +G+  E+AR +K++ +Y+ LGCP+ IRF Y++L            YP+ +          ++NGLRRLLHLS  +YL
Sbjct:   66 QKVSLKDVWTADDRRLFFLGVRLYGRNFNELARFVRSRGHRNDTYSTSATANQPSTCAEAPGTGSQPIGSSVVAPVAVAAGLLPGNPPNQSGVQLAAMDGRTKEQVRLLYQQTWHKLRRYIKYPDDVPQHVREVYAIINWSVMRFRIKKTLDNRLGEKLNELVHYGSTCVKHKGRRFLLRTPVCPILKQLNHISAPTQEFTLPEDVWVELVPATQMVAWRVLQAEQNPRLRLKTDINRQLSDVISLAEAKWILPTDLIRFLLCPSAETKPEEKGGVSEKLLLRLQREHRLDGAISLQEVSRTRSTDIALNAYLARRQASQDVPKPTAAGEAAGEDAPGASGTTSTSTAATGTSKASAQEGQRHLVPSRTGGSGASPNSTA-----VRLDLRGVGKQLANGVTFEEARGIKLVVIYLALGCPARIRFEYDFLQSSSTRASASSSYPTSLPKEAIANGEGITNGLRRLLHLSASEYL 535          
BLAST of SANT domain-containing protein vs. TrEMBL
Match: A0A158R8P8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5843 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 6.221e-74
Identity = 174/539 (32.28%), Postives = 254/539 (47.12%), Query Frame = 3
Query:  177 MKTRSFLDNSSNIASIVKARRNPSDIETTSFLQ--------IGNDPIXXXXXXXXSNENFIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLN-------------------------------------------PNNC--------GKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPP--------KLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCE-----------NILKLNSG--TPGAPKSS------------------------------TENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYL---------------YPSDMETAEHSVSNGLRRLLHLSKHDYL 1418
            MKTR     S  I S V+ RR       ++ +Q        +   P+   +   +   +  +  SQ      KV  K VW+ +D+ LFF  +++YG+NFNE+++FI+SRG R +                                           PN          G++KEQVR  Y +TW+ L++Y+K P+   Q V+E+YA+IN+SV R RVKK +   LGEKLNE+V  GST +K  G+R  LRTPVCP LK+LN++  P QE+T+P+DV +ELVP   +  WRV Q EQNPR+RLK  +NRQLSD+I+    K      LIR  L       P        KL +RL  + R    IS+QEVS+ R   I   +Y                K  +G   PGA  ++                              +   +   ++D   + R+L +G+  E+AR +K++ +Y+ LGCP+ IRF Y+++                P +       ++NGLRRLLHLS  +YL
Sbjct:    1 MKTRRTSTESPKITSGVRTRRTARISSPSARIQNEAQLDENVSAQPVALTVEKVDEPSSKFRQGSQ------KVSLKDVWTADDRRLFFLGVRLYGRNFNELTRFIRSRGHRTDTCSSSATANQPPTADAPKASSQSIGPTVVGSVAAAAGLLPSNPPNQSSIQSAATEGRTKEQVRLLYQQTWHKLRRYIKCPNYVPQHVREVYAIINWSVMRFRVKKTLDNRLGEKLNELVHYGSTCVKHKGRRFLLRTPVCPILKQLNHISAPTQEFTLPEDVWVELVPATQMVAWRVLQAEQNPRLRLKTDINRQLSDIISLAEAKWILPTDLIRFLLCASVQSKPEEKGSVSEKLLLRLQRENRVDGAISLQEVSRTRSTDIALNAYLARHQASQEVPKPTDAKETAGEDAPGASGTTSATIATADISKPPAQESQRHLVTSRAGGSVSSGNSAAVRLDLHGVGRQLANGVTFEEARGIKLVVIYLALGCPTRIRFEYDFVQSNSTRATTSSFPISLPKEAIANGEGITNGLRRLLHLSASEYL 533          
BLAST of SANT domain-containing protein vs. TrEMBL
Match: A0A564XZE6 (SANT domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1488 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 8.691e-71
Identity = 174/543 (32.04%), Postives = 267/543 (49.17%), Query Frame = 3
Query:  177 MKTRSFLDNSSNIASIVKARR-----NPSDIETTSFLQIGNDPIXXXXXXXXSNENFIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLN---------------------------------------PNN------CGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPK-------LHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENI-------LKLNSGTP----------------GAPKSSTE-------NETP---------------FFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAE---------------------------HSVSNGLRRLLHLSKHDYL 1418
            MKTRS  +   NIA+ VKARR     +PS    T   +   D   N+    ++++N  ++ +  +    KV  + +W++ED+ LFF  ++IYG+N+ EI+++I+SRG R++                                       PN+       G++K QVR FY +TW+ L++Y+ FP +    V+E+YA++N+SV R+R+KK +   LGEKLNE V  GST +K +G+R  LRTP C  LK+LNN+ +P Q +T+PDDV++ELVP   +  WRV + EQNPR+RL V +NRQLSDVI+    K      LI   L     +  +       L +RL  + R    ISIQEVS+ R   +   ++   I       L  N+  P                GA  +STE        +TP                 ++D  ++ ++L +G+   +AR +K++ +Y+ LGCP  +RF Y+Y+   D  T++                             ++NGLRRLLHLS  +YL
Sbjct:    1 MKTRSTPEEPPNIAAGVKARRTARIGSPSSRANT---EGQTDEGSNSQPVPSTSQNKTEDPAPKLRQGPKVPLRELWTLEDRRLFFEGVRIYGRNYREIARYIQSRGHRVDISTGGSVNQPSTSGEASGAGTKSNAPTVIAPVAAAAGLLPNSPAVSQSAGRTKAQVRMFYQQTWHKLRRYITFPEEVPLHVREVYAIVNWSVMRSRIKKALDNRLGEKLNEFVQTGSTYVKHHGRRYLLRTPTCQILKQLNNISSPTQNFTLPDDVVVELVPATQLVAWRVLEAEQNPRLRLIVDINRQLSDVISITEVKWTPQNILIGRGLGSDKQKQGERIKTNEMLRLRLEKEHRLDGAISIQEVSRTRSTDVCLNAFVNRIRSTAAATLLSNTTAPPPTANATTANASTTNYGASSTSTEATQSAPSGDTPSTSTVAVRPTRATNAGVRLDLREIGKQLFNGVTYNEARSIKLVVIYLALGCPERVRFEYDYVN-VDSGTSDGGNSTALTQSLNPTFTTSLSRKAIANGEGMTNGLRRLLHLSASEYL 539          
BLAST of SANT domain-containing protein vs. Ensembl Cavefish
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8255])

HSP 1 Score: 107.071 bits (266), Expect = 2.781e-23
Identity = 73/204 (35.78%), Postives = 114/204 (55.88%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFI----KSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDS---SQAVQELYALINYSVFRTRVKKKIGAWLGE---KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQE----YTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNK 959
            WS EDK  FF  L  +GK+F  I   I    K +G    P +  K+KEQVR FY RTW+ + +++ F + S    ++ QELY LI Y+  R    KK+G    +   KLNE++   +TT++  G+ + ++ P+C ALK+L +    ++E      +P  V +EL PR+  +  RVQ    NPR+ + V ++R++S +I FL  K
Sbjct:  188 WSAEDKNSFFEGLYEHGKDFEAIQNNIALKYKKKG---KPASIVKNKEQVRHFYYRTWHKISKHIDFNNYSRVLKKSSQELYGLICYAELR----KKVGGMDDKNVAKLNELIQQ-ATTVRFKGRNLRIKAPMCRALKKLCDPDVSDEEDQKPVRLPLKVAVELQPRSNHSWTRVQSLAHNPRL-MVVELHRKVSSLIEFLKQK 382          
BLAST of SANT domain-containing protein vs. Ensembl Nematostella
Match: EDO39547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9P9])

HSP 1 Score: 106.686 bits (265), Expect = 1.377e-23
Identity = 69/198 (34.85%), Postives = 106/198 (53.54%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNFNEISKFIKSRGSRL-NPNNCGKSKEQVRFFYNRTWNNLKQYL---KFPSDSSQAVQ----ELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNK 959
            W   DK  FF AL  YGK+F++I  FI ++  R  +P N  K+K+QVR FY RT N + +Y+   K P+  +   Q    EL+AL+ Y   R +V   +     +KL E++ +G  +I+ NG+ I LR P   + K     + P     +P  +++E +P + V    VQ   QNPR+R  V   R LS ++++L NK
Sbjct:  132 WVNRDKNAFFKALHDYGKDFDKIQSFIATKHKRRGDPLNLVKNKDQVRHFYYRTLNKILKYIPEDKQPTGETDPHQRTTNELFALMCYGEMRKKVCGGLCGKQWKKLTELMADGRASIRQNGRIIRLRAPTFKSTKEAEQNQGPP----LPQKLLVEFLPVDNVAWATVQNLSQNPRLRTSVRPKRPLSVMLSYLMNK 325          
BLAST of SANT domain-containing protein vs. Ensembl Medaka
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:NCBI gene;Acc:101172246])

HSP 1 Score: 121.324 bits (303), Expect = 1.170e-27
Identity = 75/207 (36.23%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNF----NEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNK 959
            WS EDK  FF  L  +GK+F    N I+   K RG    P N  K+KEQVR FY RTW+ + +++ F +  ++ +    QELY LI Y+  R    KK+G  + +    KLNE++  G+TT++  G+ + ++ P+C ALK+L   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R+ V ++R++S +I +L  K
Sbjct:  196 WSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRG---KPANMVKNKEQVRHFYYRTWHKISKHIDFANVYNRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKLCDPDGVSDEEDQKPVRLPLKVAVELQPRSNYSWARVQTLAHNPRLRMVVELHRKVSSLIEYLKQK 395          
BLAST of SANT domain-containing protein vs. Ensembl Medaka
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:NCBI gene;Acc:101172246])

HSP 1 Score: 121.324 bits (303), Expect = 1.188e-27
Identity = 75/207 (36.23%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNF----NEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNK 959
            WS EDK  FF  L  +GK+F    N I+   K RG    P N  K+KEQVR FY RTW+ + +++ F +  ++ +    QELY LI Y+  R    KK+G  + +    KLNE++  G+TT++  G+ + ++ P+C ALK+L   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R+ V ++R++S +I +L  K
Sbjct:  179 WSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRG---KPANMVKNKEQVRHFYYRTWHKISKHIDFANVYNRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKLCDPDGVSDEEDQKPVRLPLKVAVELQPRSNYSWARVQTLAHNPRLRMVVELHRKVSSLIEYLKQK 378          
BLAST of SANT domain-containing protein vs. Ensembl Medaka
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:NCBI gene;Acc:101172246])

HSP 1 Score: 120.939 bits (302), Expect = 1.220e-27
Identity = 75/207 (36.23%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNF----NEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNK 959
            WS EDK  FF  L  +GK+F    N I+   K RG    P N  K+KEQVR FY RTW+ + +++ F +  ++ +    QELY LI Y+  R    KK+G  + +    KLNE++  G+TT++  G+ + ++ P+C ALK+L   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R+ V ++R++S +I +L  K
Sbjct:  167 WSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRG---KPANMVKNKEQVRHFYYRTWHKISKHIDFANVYNRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKLCDPDGVSDEEDQKPVRLPLKVAVELQPRSNYSWARVQTLAHNPRLRMVVELHRKVSSLIEYLKQK 366          
BLAST of SANT domain-containing protein vs. Ensembl Medaka
Match: cramp1 (cramped chromatin regulator homolog 1 [Source:NCBI gene;Acc:101172246])

HSP 1 Score: 109.383 bits (272), Expect = 4.970e-24
Identity = 69/188 (36.70%), Postives = 105/188 (55.85%), Query Frame = 3
Query:  390 WSMEDKILFFTALKIYGKNF----NEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAV----QELYALINYSVFRTRVKKKIGAWLGE----KLNEMVLNGSTTIKCNGKRITLRTPVCPALKRL---NNLKTPEQEYTI--PDDVIIELVPRNYVTLWRVQQNEQNPRMR 902
            WS EDK  FF  L  +GK+F    N I+   K RG    P N  K+KEQVR FY RTW+ + +++ F +  ++ +    QELY LI Y+  R    KK+G  + +    KLNE++  G+TT++  G+ + ++ P+C ALK+L   + +   E +  +  P  V +EL PR+  +  RVQ    NPR+R
Sbjct:  173 WSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRG---KPANMVKNKEQVRHFYYRTWHKISKHIDFANVYNRVLKKSSQELYGLICYAELR----KKVGGLMDDKNVAKLNELIQQGATTVRSKGRNLRIKAPMCRALKKLCDPDGVSDEEDQKPVRLPLKVAVELQPRSNYSWARVQTLAHNPRLR 353          
BLAST of SANT domain-containing protein vs. Planmine SMEST
Match: SMESG000035735.1 (SMESG000035735.1)

HSP 1 Score: 1457.58 bits (3772), Expect = 0.000e+0
Identity = 717/721 (99.45%), Postives = 718/721 (99.58%), Query Frame = 3
Query:  150 MNSQNNTFKMKTRSFLDNSSNIASIVKARRNPSDIETTSFLQIGNDPIXXXXXXXXSNENFIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK 2312
            MN QNNTFKMKTRSFLDNSSNIASIVKARRNPSDIETT+FLQIGNDPILNNLTTTNSNEN IQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDS QAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK
Sbjct:    1 MNLQNNTFKMKTRSFLDNSSNIASIVKARRNPSDIETTTFLQIGNDPILNNLTTTNSNENSIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSPQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK 721          
BLAST of SANT domain-containing protein vs. Planmine SMEST
Match: SMESG000035735.1 (SMESG000035735.1)

HSP 1 Score: 1442.56 bits (3733), Expect = 0.000e+0
Identity = 709/712 (99.58%), Postives = 710/712 (99.72%), Query Frame = 3
Query:  177 MKTRSFLDNSSNIASIVKARRNPSDIETTSFLQIGNDPIXXXXXXXXSNENFIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK 2312
            MKTRSFLDNSSNIASIVKARRNPSDIETT+FLQIGNDPILNNLTTTNSNEN IQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDS QAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK
Sbjct:    1 MKTRSFLDNSSNIASIVKARRNPSDIETTTFLQIGNDPILNNLTTTNSNENSIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNFNEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSPQAVQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLRTPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLNSCIRSDK 712          
BLAST of SANT domain-containing protein vs. Planmine SMEST
Match: SMESG000060116.1 (SMESG000060116.1)

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 439/502 (87.45%), Postives = 456/502 (90.84%), Query Frame = 3
Query:  786 LKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLN 2291
            +KT EQEYTIPDDVIIELVP  YVTLWRVQQNEQNPRMRLKVAVNRQLSDVINF+SNKLKSSAHLIRETLTLPPIE PKLHIRLSDDA+FFKEISIQEVSKPRFDSITFKSY +NILK +    G PKSSTENE   FKIDFDDMERKLT GIGIEDARDMKILALYIGLGCPSVIRFMYEYLY +DM+TAEHSVSNGLRRLLHLSK DYLENKLNKDTKSHLELQI ELQSKLDALKR+V DYEEDRYDEMN      EFLVP I  KVQDP NQ NRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASD GNSSLDNIKRFNKNRKR KSMNN K PAVFTLQLPVTI ESHQENMME N    MYP MQT MYPTGTNDLYI+NQ+P+ N LFFQNNPTVSEGAFE QSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNT SIDYNG+FQNYANDS+++S+TK+EDLNVSINADSDSGSLSQFLN
Sbjct:    1 MKTQEQEYTIPDDVIIELVPMEYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFVSNKLKSSAHLIRETLTLPPIEQPKLHIRLSDDAKFFKEISIQEVSKPRFDSITFKSYYDNILK-SMMNNGDPKSSTENEESCFKIDFDDMERKLTFGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYANDMKTAEHSVSNGLRRLLHLSKQDYLENKLNKDTKSHLELQIVELQSKLDALKRKVADYEEDRYDEMN------EFLVPPIPSKVQDPKNQKNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDNGNSSLDNIKRFNKNRKRHKSMNNSKAPAVFTLQLPVTIHESHQENMMEPN---YMYPEMQTAMYPTGTNDLYISNQIPSENHLFFQNNPTVSEGAFELQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTQSIDYNGIFQNYANDSMIQSITKIEDLNVSINADSDSGSLSQFLN 492          
BLAST of SANT domain-containing protein vs. Planmine SMEST
Match: SMESG000060116.1 (SMESG000060116.1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 434/502 (86.45%), Postives = 451/502 (89.84%), Query Frame = 3
Query:  786 LKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDARFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFFKIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDMETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALKRQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNIKMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYINNQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSINADSDSGSLSQFLN 2291
            +KT EQEYTIPDDVIIELVP  YVTLWRVQQNEQNPRMRLKVAVNRQLSDVINF+SNKLKSSAHLIRETLTLPPIE PKLHIRLSDDA+FFKEISIQEVSKPRFDSITFK        +N+G P   KSSTENE   FKIDFDDMERKLT GIGIEDARDMKILALYIGLGCPSVIRFMYEYLY +DM+TAEHSVSNGLRRLLHLSK DYLENKLNKDTKSHLELQI ELQSKLDALKR+V DYEEDRYDEMN      EFLVP I  KVQDP NQ NRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASD GNSSLDNIKRFNKNRKR KSMNN K PAVFTLQLPVTI ESHQENMME N    MYP MQT MYPTGTNDLYI+NQ+P+ N LFFQNNPTVSEGAFE QSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNT SIDYNG+FQNYANDS+++S+TK+EDLNVSINADSDSGSLSQFLN
Sbjct:    1 MKTQEQEYTIPDDVIIELVPMEYVTLWRVQQNEQNPRMRLKVAVNRQLSDVINFVSNKLKSSAHLIRETLTLPPIEQPKLHIRLSDDAKFFKEISIQEVSKPRFDSITFK--------MNNGDP---KSSTENEESCFKIDFDDMERKLTFGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYANDMKTAEHSVSNGLRRLLHLSKQDYLENKLNKDTKSHLELQIVELQSKLDALKRKVADYEEDRYDEMN------EFLVPPIPSKVQDPKNQKNRPYVYKKQQEALKQLMEDLPNKNNVVINQVEYASDNGNSSLDNIKRFNKNRKRHKSMNNSKAPAVFTLQLPVTIHESHQENMMEPN---YMYPEMQTAMYPTGTNDLYISNQIPSENHLFFQNNPTVSEGAFELQSLSSIINQNQAQNIHVDHCENTNDSLRSFLNEMAESQNADQLNTQSIDYNGIFQNYANDSMIQSITKIEDLNVSINADSDSGSLSQFLN 482          
The following BLAST results are available for this feature:
BLAST of SANT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CRAMP16.940e-2938.36cramped chromatin regulator homolog 1 [Source:HGNC... [more]
CRAMP16.940e-2938.36cramped chromatin regulator homolog 1 [Source:HGNC... [more]
AL031708.17.113e-739.51novel protein[more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R151.86.821e-1827.83pep chromosome:WBcel235:III:7226820:7229787:-1 gen... [more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
crm1.055e-2733.49gene:FBgn0000376 transcript:FBtr0070496[more]
crm1.055e-2733.49gene:FBgn0000376 transcript:FBtr0070495[more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cramp12.301e-2734.55cramped chromatin regulator homolog 1 [Source:ZFIN... [more]
cramp11.323e-2134.09cramped chromatin regulator homolog 1 [Source:ZFIN... [more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pax51.910e-2837.90paired box 5 [Source:Xenbase;Acc:XB-GENE-479876][more]
pax52.321e-2438.07paired box 5 [Source:Xenbase;Acc:XB-GENE-479876][more]
pax51.063e-2237.56paired box 5 [Source:Xenbase;Acc:XB-GENE-479876][more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cramp1l3.312e-2938.36cramped chromatin regulator homolog 1 [Source:MGI ... [more]
Cramp1l3.312e-2938.36cramped chromatin regulator homolog 1 [Source:MGI ... [more]
back to top
BLAST of SANT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6PG95|CRML_MOUSE2.316e-2838.36Protein cramped-like OS=Mus musculus OX=10090 GN=C... [more]
sp|Q96RY5|CRML_HUMAN3.333e-2838.36Protein cramped-like OS=Homo sapiens OX=9606 GN=CR... [more]
sp|Q8MX88|CRM_DROSE3.037e-2733.49Protein cramped OS=Drosophila sechellia OX=7238 GN... [more]
sp|O76906|CRM_DROME1.134e-2633.49Protein cramped OS=Drosophila melanogaster OX=7227... [more]
back to top
BLAST of SANT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FRU99.100e-8432.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YHM04.332e-7734.55Protein cramped OS=Echinococcus multilocularis OX=... [more]
A0A068WDJ09.308e-7633.89Protein cramped OS=Echinococcus granulosus OX=6210... [more]
A0A158R8P86.221e-7432.28Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A564XZE68.691e-7132.04SANT domain-containing protein OS=Hymenolepis dimi... [more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cramp12.781e-2335.78cramped chromatin regulator homolog 1 [Source:ZFIN... [more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SANT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SANT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395471.377e-2334.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SANT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cramp11.170e-2736.23cramped chromatin regulator homolog 1 [Source:NCBI... [more]
cramp11.188e-2736.23cramped chromatin regulator homolog 1 [Source:NCBI... [more]
cramp11.220e-2736.23cramped chromatin regulator homolog 1 [Source:NCBI... [more]
cramp14.970e-2436.70cramped chromatin regulator homolog 1 [Source:NCBI... [more]
back to top
BLAST of SANT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000035735.10.000e+099.45SMESG000035735.1[more]
SMESG000035735.10.000e+099.58SMESG000035735.1[more]
SMESG000060116.10.000e+087.45SMESG000060116.1[more]
SMESG000060116.10.000e+086.45SMESG000060116.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010369 ID=SMED30010369|Name=SANT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2379bp
TTTAAAAATAAGAATTATTTTAATGATATATATTTTTATTATTTAGAGAT
TTATAAATTTATTTATAATTATAATTAATTAAATAAAAATTTTATATTTA
CCTGCAGAGTTATGGTGAAACATTTTTTTATAAATTGCTTAATTCTTTGA
TGAATTCACAGAATAATACATTTAAAATGAAAACTAGAAGTTTTTTGGAT
AATTCTTCAAACATTGCAAGTATCGTCAAAGCTAGAAGAAATCCATCAGA
CATAGAAACAACATCCTTTCTTCAAATTGGAAATGATCCTATTTTAAACA
ATTTAACTACAACTAATTCTAATGAAAACTTTATTCAAAATATTTCCCAA
AACATATTACCGGAAAAAAAAGTTATTACCAAAACGGTATGGTCAATGGA
AGATAAAATTCTGTTTTTCACTGCCCTTAAAATTTATGGGAAAAACTTTA
ATGAAATAAGCAAATTTATCAAAAGTCGTGGCAGCCGATTGAATCCAAAT
AATTGTGGAAAATCCAAAGAACAAGTGCGATTCTTTTACAATCGAACCTG
GAACAATTTAAAACAATATTTAAAATTTCCCTCTGATTCTTCACAGGCAG
TTCAAGAATTATACGCGCTCATCAATTACTCAGTGTTCCGGACTCGTGTA
AAGAAAAAAATAGGCGCCTGGCTCGGCGAGAAATTAAATGAAATGGTTTT
AAATGGATCGACTACTATCAAGTGCAATGGAAAGCGTATAACGCTTCGAA
CTCCAGTTTGTCCGGCTCTGAAGAGGCTGAACAATTTGAAAACACCGGAA
CAAGAATACACAATACCCGATGATGTCATCATAGAACTGGTGCCCAGGAA
TTATGTAACATTATGGCGAGTACAGCAAAATGAACAGAATCCTAGAATGC
GTCTCAAAGTCGCAGTCAATCGACAACTGTCGGATGTTATCAATTTCCTG
AGCAACAAACTTAAAAGTTCAGCACATCTCATTCGAGAAACATTAACTTT
GCCACCCATTGAACCGCCAAAATTACACATTCGACTTAGTGATGACGCGA
GATTTTTCAAGGAGATTTCAATTCAGGAAGTGTCGAAACCTCGATTTGAC
AGCATCACGTTCAAAAGTTATTGTGAAAACATTTTGAAATTAAATAGCGG
CACCCCAGGCGCTCCTAAATCGTCCACAGAAAATGAAACACCTTTTTTCA
AAATTGATTTCGACGACATGGAGCGCAAATTGACATCTGGAATTGGTATT
GAGGATGCACGGGATATGAAAATTTTAGCTTTGTATATCGGTCTAGGGTG
CCCGAGTGTCATTAGATTTATGTATGAATATCTATATCCTAGCGACATGG
AAACGGCTGAGCACTCTGTATCTAATGGTCTTCGTCGGCTTTTGCATTTG
AGTAAACACGACTATTTAGAAAATAAACTTAACAAGGACACCAAAAGTCA
TTTAGAACTTCAAATAGCGGAATTGCAATCGAAACTTGACGCTTTGAAAA
GGCAAGTTGTAGATTACGAAGAAGATAGATACGACGAAATGAATAATAGT
TTCACTGTTGATGAGTTTCTTGTTCCGTCTATCTCTCCTAAAGTCCAAGA
TCCAAATAATCAGAATAATAGACCTTATGTATATAAGAAGCAGCAAGAGG
CATTGAAACAACTAATGGAGGACTTGCCAAATAAGAACAACGTGGTCATA
AATCAGGTCGAATATGCGTCGGACAAGGGAAACAGTTCCCTTGATAACAT
AAAGCGATTCAATAAGAACCGAAAACGGCCCAAATCTATGAATAACATCA
AAATGCCGGCTGTGTTCACGTTACAATTGCCAGTAACAATCCAGGAGTCA
CATCAGGAGAACATGATGGAAGCGAATGACATGTCCAATATGTACCCGGG
AATGCAGACTGTGATGTATCCAACTGGCACCAATGATTTGTACATCAACA
ATCAAATGCCTACTGGAAATCAATTATTCTTTCAGAATAATCCAACGGTG
AGTGAAGGGGCGTTTGAGCCGCAGTCGCTGTCGTCCATCATCAATCAGAA
CCAAGCGCAGAATATCCATGTCGATCATTGTGAAAATACCAATGACTCTC
TTAGATCCTTTCTCAACGAGATGGCCGAATCTCAGAATGCTGACCAGTTG
AACACCGACAGCATAGATTACAATGGACTTTTTCAAAACTATGCGAACGA
CTCCATTATGCGATCAATGACGAAAATGGAGGATTTGAATGTGAGCATTA
ATGCTGATAGCGATTCTGGATCCCTGTCCCAGTTCCTGAATTCTTGCATT
CGATCCGATAAATGATCCATCACTTGATTATTTTCTATTGTGAATAAATT
TATTGATTTTCAAAAAAAAAGATCGGAAG
back to top

protein sequence of SMED30010369-orf-1

>SMED30010369-orf-1 ID=SMED30010369-orf-1|Name=SMED30010369-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=722bp
MNSQNNTFKMKTRSFLDNSSNIASIVKARRNPSDIETTSFLQIGNDPILN
NLTTTNSNENFIQNISQNILPEKKVITKTVWSMEDKILFFTALKIYGKNF
NEISKFIKSRGSRLNPNNCGKSKEQVRFFYNRTWNNLKQYLKFPSDSSQA
VQELYALINYSVFRTRVKKKIGAWLGEKLNEMVLNGSTTIKCNGKRITLR
TPVCPALKRLNNLKTPEQEYTIPDDVIIELVPRNYVTLWRVQQNEQNPRM
RLKVAVNRQLSDVINFLSNKLKSSAHLIRETLTLPPIEPPKLHIRLSDDA
RFFKEISIQEVSKPRFDSITFKSYCENILKLNSGTPGAPKSSTENETPFF
KIDFDDMERKLTSGIGIEDARDMKILALYIGLGCPSVIRFMYEYLYPSDM
ETAEHSVSNGLRRLLHLSKHDYLENKLNKDTKSHLELQIAELQSKLDALK
RQVVDYEEDRYDEMNNSFTVDEFLVPSISPKVQDPNNQNNRPYVYKKQQE
ALKQLMEDLPNKNNVVINQVEYASDKGNSSLDNIKRFNKNRKRPKSMNNI
KMPAVFTLQLPVTIQESHQENMMEANDMSNMYPGMQTVMYPTGTNDLYIN
NQMPTGNQLFFQNNPTVSEGAFEPQSLSSIINQNQAQNIHVDHCENTNDS
LRSFLNEMAESQNADQLNTDSIDYNGLFQNYANDSIMRSMTKMEDLNVSI
NADSDSGSLSQFLNSCIRSDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001005SANT/Myb
IPR017884SANT_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 432..459
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 81..151
e-value: 9.6E-7
score: 30.9
NoneNo IPR availablePANTHERPTHR21677CRAMPED PROTEINcoord: 69..659
NoneNo IPR availablePANTHERPTHR21677:SF1PROTEIN CRAMPED-LIKEcoord: 69..659
IPR001005SANT/Myb domainSMARTSM00717santcoord: 77..136
e-value: 2.0E-6
score: 37.4
IPR001005SANT/Myb domainCDDcd00167SANTcoord: 81..134
e-value: 4.35619E-4
score: 36.3994
IPR017884SANT domainPROSITEPS51293SANTcoord: 76..138
score: 12.286
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 75..132