Leucine Rich repeat-containing domain protein

Overview
NameLeucine Rich repeat-containing domain protein
Smed IDSMED30010360
Length (bp)2491
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine Rich repeat-containing domain protein (SMED30010360) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine Rich repeat-containing domain protein (SMED30010360) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine Rich repeat-containing domain protein (SMED30010360) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine Rich repeat-containing domain protein (SMED30010360) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010360

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v4_2769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010360SMESG000047911.1 SMESG000045664.1 Contig43847newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010360SMESG000047911.1 SMESG000045664.1 Contig43847uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30010360SMESG000047911.1 SMESG000045664.1 dd_Smed_v6_2769_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:HGNC Symbol;Acc:HGNC:5468])

HSP 1 Score: 73.559 bits (179), Expect = 9.205e-13
Identity = 85/311 (27.33%), Postives = 123/311 (39.55%), Query Frame = 3
Query:  537 ISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQ------------------VGNVPDNVFFAVKKLKHLNMTM-------------------------------------------------KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLL 1268
            + +E N +RS+   TF++ P L SL LS+NR+  +ED  F+ L +L  L L  N L  L    F GL  L+ L +  N +  L   +   L  L+   LS N  + I                    +  V    F  +K L+ L+++                                                  +I+ L   +F GL  LE L L  N L  +  G F  +  V ++NLS N +R L  + FR L KL SL L  + L  I    F+ +S L+ L L DN +  IE  +  GL  LL
Sbjct:  127 LHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELL 437          

HSP 2 Score: 63.929 bits (154), Expect = 9.527e-10
Identity = 65/265 (24.53%), Postives = 104/265 (39.25%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNF 1325
            ++ ++ NN+ S+ P  F NL +L  L L   ++G +E ++                          GLE L  L +  N +  L+         L    LS N      ++  + D +F  +  L  LN+    +  L    F GL  L  L L GN L  + P  F  + ++  ++LSRNA+R +    F  LP+                        LQ L L  N I  +   AF+GLK+L    L++ + R    L++ F
Sbjct:   78 ALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQAL------------------------LGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNN------RLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPR------------------------LQKLYLDRNLIAAVAPGAFLGLKALRW--LDLSHNRVAGLLEDTF 286          

HSP 3 Score: 57.3806 bits (137), Expect = 8.198e-8
Identity = 52/179 (29.05%), Postives = 86/179 (48.04%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTAL---TFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAI 1079
            N I S+ P TF +L  L  L+L  NRI  + ++SF+ L  L  L L++N L  +K   F GL  + ++++  N +  L   + + L  L    L        S +G +  + F  +  L+ L   +K   L  +   + +GL +L  L+L  N LT +    FQ + K+  + LSRN +
Sbjct:  300 NAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHL------EGSCLGRIRPHTFTGLSGLRRL--FLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRL 470          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:HGNC Symbol;Acc:HGNC:5468])

HSP 1 Score: 73.1738 bits (178), Expect = 1.137e-12
Identity = 85/311 (27.33%), Postives = 123/311 (39.55%), Query Frame = 3
Query:  537 ISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQ------------------VGNVPDNVFFAVKKLKHLNMTM-------------------------------------------------KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLL 1268
            + +E N +RS+   TF++ P L SL LS+NR+  +ED  F+ L +L  L L  N L  L    F GL  L+ L +  N +  L   +   L  L+   LS N  + I                    +  V    F  +K L+ L+++                                                  +I+ L   +F GL  LE L L  N L  +  G F  +  V ++NLS N +R L  + FR L KL SL L  + L  I    F+ +S L+ L L DN +  IE  +  GL  LL
Sbjct:  165 LHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELL 475          

HSP 2 Score: 63.929 bits (154), Expect = 8.225e-10
Identity = 65/265 (24.53%), Postives = 104/265 (39.25%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNF 1325
            ++ ++ NN+ S+ P  F NL +L  L L   ++G +E ++                          GLE L  L +  N +  L+         L    LS N      ++  + D +F  +  L  LN+    +  L    F GL  L  L L GN L  + P  F  + ++  ++LSRNA+R +    F  LP+                        LQ L L  N I  +   AF+GLK+L    L++ + R    L++ F
Sbjct:  116 ALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQAL------------------------LGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNN------RLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPR------------------------LQKLYLDRNLIAAVAPGAFLGLKALRW--LDLSHNRVAGLLEDTF 324          

HSP 3 Score: 57.3806 bits (137), Expect = 8.560e-8
Identity = 52/179 (29.05%), Postives = 86/179 (48.04%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTAL---TFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAI 1079
            N I S+ P TF +L  L  L+L  NRI  + ++SF+ L  L  L L++N L  +K   F GL  + ++++  N +  L   + + L  L    L        S +G +  + F  +  L+ L   +K   L  +   + +GL +L  L+L  N LT +    FQ + K+  + LSRN +
Sbjct:  338 NAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHL------EGSCLGRIRPHTFTGLSGLRRL--FLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRL 508          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 72.7886 bits (177), Expect = 2.029e-12
Identity = 80/248 (32.26%), Postives = 123/248 (49.60%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N I +I P  F  LP L  L+L+ N+I  ++  +F  L  L SL +  N +T L    F+GL  ++IL + +N +TE++   L  L  LQ   LS N    IS     PD   F  +KL  L++T   +  L   +F GL+ L  L +  N ++ I+   F+ +  +  ++L  N I   + +    F  L KL  L L  N +  I+ + F+ +  L+ LDLSDN I  ++ NAF  +K L    LN
Sbjct:  202 NRISAIPPKMF-KLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRIS-----PDAWEF-CQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 442          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 72.7886 bits (177), Expect = 2.297e-12
Identity = 80/248 (32.26%), Postives = 123/248 (49.60%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N I +I P  F  LP L  L+L+ N+I  ++  +F  L  L SL +  N +T L    F+GL  ++IL + +N +TE++   L  L  LQ   LS N    IS     PD   F  +KL  L++T   +  L   +F GL+ L  L +  N ++ I+   F+ +  +  ++L  N I   + +    F  L KL  L L  N +  I+ + F+ +  L+ LDLSDN I  ++ NAF  +K L    LN
Sbjct:  142 NRISAIPPKMF-KLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRIS-----PDAWEF-CQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 382          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 71.633 bits (174), Expect = 3.167e-12
Identity = 80/248 (32.26%), Postives = 123/248 (49.60%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N I +I P  F  LP L  L+L+ N+I  ++  +F  L  L SL +  N +T L    F+GL  ++IL + +N +TE++   L  L  LQ   LS N    IS     PD   F  +KL  L++T   +  L   +F GL+ L  L +  N ++ I+   F+ +  +  ++L  N I   + +    F  L KL  L L  N +  I+ + F+ +  L+ LDLSDN I  ++ NAF  +K L    LN
Sbjct:  202 NRISAIPPKMF-KLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRIS-----PDAWEF-CQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 442          

HSP 2 Score: 52.373 bits (124), Expect = 3.794e-6
Identity = 63/220 (28.64%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDI----------------LKPLKNLQFFQLSINPNQHIS--QVGNVPDNVFFAVKKLKHLNM-----TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPK 1118
            +  + +  N I+++D  TF  L  L SLK+  N +  + D +F  L N+  L L++N LT +     YGL  L+ L +  N I  +S D                 L  L +  F  LS+    HI   +V  + D  F  +  LK L++     +  I+++    F GL  L RL LQGN +  I+   F  +  +  ++LS NAI  L    F  + K
Sbjct:  217 LQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNG-AFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKK 435          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: egg-6 (Leucine-rich repeat-containing protein egg-6 [Source:UniProtKB/Swiss-Prot;Acc:P90920])

HSP 1 Score: 58.151 bits (139), Expect = 2.575e-8
Identity = 89/356 (25.00%), Postives = 167/356 (46.91%), Query Frame = 3
Query:  210 EANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCSERFLNLMIRETGIEAFFNPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLE-KLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLF 1274
            E  C      C+C+    I++  + L C          G DVK I+  +  S   E  + L   +  IE+   PF GL +I  +    N    +F+   + ++ + I+ I++  N ++++    F NL  L+S+ L+ N+I  I DK+F+ L  L+ L L NN +      +   ++  L +L +  N +  +   IL+   NL +  L  N   +IS++ N        +++L+  N T+  + +  + F  +  L+ L LQ N ++ +     Q  + + ++++S NA+  L   + ++LP L  + +  N ++ I    FS    LQ + + +NNI  I RN+F  L  L++ 
Sbjct:   20 EITCPRIPEKCDCK----ISKSMIILSCN---------GEDVKTIAQTVGTSQIDELHI-LNGTDVKIESL--PFNGLRTIAIL----NSTLQSFSPTAWRHVEATIEHITINGNELKTVP--VFGNLSTLMSMNLNSNQISSIPDKAFNGLSALTQLRLENNAICDFPPKSLDAVKASLVLLDVSGNCLDAIPAQILRNAANLMYLDLGSN---NISEINNFELMNLPFLRELRVQNNTL--RRIHPMAFMNVPQLQYLYLQDNIISTLDGNRLQGFKNLEVLDVSNNALYAL--PSLKDLPNLKQVRVDGNLITKIETLAFSNNPNLQLISVQNNNIVQISRNSFESLDKLVVL 346          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: lron-1 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q93377])

HSP 1 Score: 56.9954 bits (136), Expect = 4.724e-8
Identity = 78/239 (32.64%), Postives = 114/239 (47.70%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNA 1244
            ++ +S+  N I +I  N+   LPNL SL L  N+I  I   SF   P LS LYL NN+LTS+  + F  +  LK+LSM NN                               + ++  N   +V++ K          +  L F     L RLEL    ++ I P + Q+VQ + +I LSRN I  +  +TF NLP+L  LDLS N ++ + D  FS++  L +LDLS N +  +  N 
Sbjct:  209 LEDLSLGVNRIHTISRNSLP-LPNLKSLSLEVNQIRLIPSDSFSETPLLSYLYLGNNLLTSIDASMFLHIGGLKVLSMSNN-----------------------------KDITSIQANGKLSVQQFKLC--------ICILAFQHAPSLIRLELFDCSISRIEPKSLQKVQHIQVILLSRNQITRISHDTFSNLPELSELDLSGNSINAVDDFAFSQLPMLTSLDLSSNRLESLPSNV 409          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: let-4 (Leucine-rich repeat-containing protein let-4 [Source:UniProtKB/Swiss-Prot;Acc:Q93373])

HSP 1 Score: 52.373 bits (124), Expect = 1.264e-6
Identity = 77/295 (26.10%), Postives = 138/295 (46.78%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKS-FDXXXXXXXXXXXXXXXXXXKVNTFYGLE-KLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHI------------------SQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKL 1349
            ++ + +  N I  +     + LPNL+ L LS+N I  I+++  F NL  L  + L +N + S+  +TF  ++  ++ +++ +N +T + +  ++ LK LQ   L  N  + +                  +Q+  +    F  V  L++L ++  KI  LTA  F     LE L+L  N +  I   +   ++++  + L+ N I  +    F N   ++ L LS N+L  ++  + S +  LQ +   DN I  I RNAF    SL++  L      AKN+L      + LA+L
Sbjct:  112 LEEVVLNHNLIEKVPAAALAGLPNLLRLDLSNNSIVEIQEQEIFPNLNKLYDINLGSNKIFSIHTSTFQNVKNSIQTINLGHNNMTAVPSSAIRGLKQLQSLHLHKNRIEQLDALNFLNLPVLNLLNLAGNQIHELNRQAFLNVPSLRYLYLSGNKITKLTAYQFQTFEQLEMLDLTNNEIGAIPANSLSGLKQLRQLYLAHNKISNISSNAFTN-SSIVVLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASLVMLDL------AKNQLTEIAPTTFLAQL 399          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 50.447 bits (119), Expect = 4.981e-6
Identity = 56/182 (30.77%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  573 PNT-FSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKN--LTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRN 1109
            P T F  +P +  LKLS   I  +E   F  L  L  L L  N++ ++    F GLE L  LS+  NFI++L  D+   L +L+   L  N      ++  +P +VF   K L     T+ ++N  ++ L   GL  LE+L L     T IS    +   K+  ++LS+  I  ++  TF N
Sbjct:  248 PETLFKEIPQIEVLKLSGCSIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNFISKLEPDVFFGLSSLEELDLGWN------EIKTIPTDVF---KPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFEN 420          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 50.447 bits (119), Expect = 5.198e-6
Identity = 56/182 (30.77%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  573 PNT-FSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKN--LTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRN 1109
            P T F  +P +  LKLS   I  +E   F  L  L  L L  N++ ++    F GLE L  LS+  NFI++L  D+   L +L+   L  N      ++  +P +VF   K L     T+ ++N  ++ L   GL  LE+L L     T IS    +   K+  ++LS+  I  ++  TF N
Sbjct:  248 PETLFKEIPQIEVLKLSGCSIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNFISKLEPDVFFGLSSLEELDLGWN------EIKTIPTDVF---KPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFEN 420          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: CG7896 (gene:FBgn0039728 transcript:FBtr0085545)

HSP 1 Score: 70.8626 bits (172), Expect = 4.652e-12
Identity = 66/248 (26.61%), Postives = 119/248 (47.98%), Query Frame = 3
Query:  543 VEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            ++ N++ S+  N+ +    L  L L  N+IG +   SF+    L  + L +N++ S+    F GL+K++ + +  N I+ L++D+ + L++LQ   LS N        G  P     AV  LKHLN++   ++ L       +  LE L++  N +T I+PGTF+++  +  ++LS N++R +  +    L                         +LQTL + DNNI ++  +A   L  L   +L+
Sbjct:  191 IDRNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSEN------FFGQFPTVALAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGL------------------------DSLQTLIIKDNNILLVPGSALGRLPQLTSLQLD 408          

HSP 2 Score: 56.6102 bits (135), Expect = 1.147e-7
Identity = 72/266 (27.07%), Postives = 130/266 (48.87%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPN-LVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLS--------------INPNQHI----SQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            + ++ +  N++  I+ +TF+ L + L++LKLS NR+  +    +  LP L SL L+ N LT L    F  LE ++ L++  N +T L+  + KPL  LQ   LS              +   +HI    +Q+  + D  F  +  +  ++++  +I ++ +  F  +  L++L+L GN L+      F     +  +++S N +  L P +FR  P+L  +  + N  S+   E+ S +  L+ +DLS N +  IE   F  L  L
Sbjct:  452 LHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPW-VLPELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISGDLLAGLQDLKHIYLNDNQLQELQDGSFVNLWNISSIDLSNNRIGSIRSGAFVNVMKLQKLDLHGNQLSAFKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAELISTLQYLEHIDLSHNQLKTIEELDFARLPRL 716          

HSP 3 Score: 56.225 bits (134), Expect = 1.259e-7
Identity = 61/251 (24.30%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXE--VFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLL 1271
            ++ I +  N IRSID   F  L  +  +KL+ NRI  +    F+ L +L  L L+ N            +  LK L++ +N + +L    ++ +++L+   +S N       +  +    F  +  LK+L++++  ++ +      GL  L+ L ++ N++ ++      ++ ++T + L  N +  L  E   +L       LS +           F   S+L TLDLS N++ VI  + F GL+S L+
Sbjct:  234 LEIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRN------TITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVINADTFAGLESTLM 478          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: CG42346 (gene:FBgn0259677 transcript:FBtr0333178)

HSP 1 Score: 70.8626 bits (172), Expect = 4.770e-12
Identity = 87/273 (31.87%), Postives = 131/273 (47.99%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGL---TDLERLELQGNHLTVISPGTFQQVQKVTI------------------------INLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            +D I +E N I  IDPN FS L NL  L L  N I  +    FD    L+SL L+NN +  L++  F  LE L+ + + NN I  +   + +PL +LQ  +L I  N     + ++    F  ++ ++H+N  ++   LT L        + L  ++L+ N+L  + P TF + QKV I                        + LS N IR +  +TF NL  L  LDLS N L  +  + F+ +  L+ L L+ N+I  IE  AF  LK+L
Sbjct:  581 VDVIYLESNAIAHIDPNVFSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLPSLQ--ELHIQKN----SIEDIEPQAFHTLENMQHIN--LQDNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNL 845          

HSP 2 Score: 55.8398 bits (133), Expect = 1.877e-7
Identity = 68/234 (29.06%), Postives = 113/234 (48.29%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFV 1250
            NNI  +  + F+N  N+  + L  N I  I+   F  L NL  LYL +N +  L V  F    KL  LS+ NN I +L   + + L++L+  +L      H +++  V   VF  +  L+ L++    I+++    F+ L +++ + LQ N LTV+      +   +  + L  N +  + P TF    K+  + L  N L+ +    F++   L  L LSDN I  IE++ FV
Sbjct:  565 NNILELPADAFTNSTNVDVIYLESNAIAHIDPNVFSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRL------HNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRDIEKDTFV 792          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: CG42346 (gene:FBgn0259677 transcript:FBtr0333177)

HSP 1 Score: 70.8626 bits (172), Expect = 4.770e-12
Identity = 87/273 (31.87%), Postives = 131/273 (47.99%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGL---TDLERLELQGNHLTVISPGTFQQVQKVTI------------------------INLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            +D I +E N I  IDPN FS L NL  L L  N I  +    FD    L+SL L+NN +  L++  F  LE L+ + + NN I  +   + +PL +LQ  +L I  N     + ++    F  ++ ++H+N  ++   LT L        + L  ++L+ N+L  + P TF + QKV I                        + LS N IR +  +TF NL  L  LDLS N L  +  + F+ +  L+ L L+ N+I  IE  AF  LK+L
Sbjct:  581 VDVIYLESNAIAHIDPNVFSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLPSLQ--ELHIQKN----SIEDIEPQAFHTLENMQHIN--LQDNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNL 845          

HSP 2 Score: 55.8398 bits (133), Expect = 1.877e-7
Identity = 68/234 (29.06%), Postives = 113/234 (48.29%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFV 1250
            NNI  +  + F+N  N+  + L  N I  I+   F  L NL  LYL +N +  L V  F    KL  LS+ NN I +L   + + L++L+  +L      H +++  V   VF  +  L+ L++    I+++    F+ L +++ + LQ N LTV+      +   +  + L  N +  + P TF    K+  + L  N L+ +    F++   L  L LSDN I  IE++ FV
Sbjct:  565 NNILELPADAFTNSTNVDVIYLESNAIAHIDPNVFSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRL------HNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRDIEKDTFV 792          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331569)

HSP 1 Score: 65.4698 bits (158), Expect = 1.953e-10
Identity = 85/278 (30.58%), Postives = 117/278 (42.09%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFS---NLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPG------------TFQQVQK-----------VTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            ++ IS++ N I S+ P   S    LPNL  L LS NRI  +    F     L  L L  N L  LK  +F G+++L++L +  N + E     L PL  L+   L  N  + I+      DN F    +L+ L+++   I++++   F     LE L+L GN L  IS G            ++ Q+ +           V  I LS N I  L   TFRNLPK                        LQ LDLS N I  +E  A  GL  L  F L
Sbjct:  525 VERISLKGNQITSL-PAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAIT------DNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPK------------------------LQYLDLSSNEIRNVEPGALKGLDELQEFVL 771          

HSP 2 Score: 52.373 bits (124), Expect = 2.142e-6
Identity = 75/269 (27.88%), Postives = 125/269 (46.47%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIG--------------------------FIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDIL--KPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAF 1247
            + ++ +  N +  I     S LPNLVSLKLS N+I                            IED SF +LPNLS L+LN+N +T L+   F    +LK + + NN I  +  + L       ++   +  N   H+  +  + D    A+ +L++L+M+   +  L      G   LE+L L  NHL +I       +  +  + +  N++   LP  F NLP L  LDL+ N  + +  ++ + + +L+ LDLS+N +  +  N+F
Sbjct:  210 LKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLD----ALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSF 474          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331570)

HSP 1 Score: 65.4698 bits (158), Expect = 1.953e-10
Identity = 85/278 (30.58%), Postives = 117/278 (42.09%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFS---NLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPG------------TFQQVQK-----------VTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            ++ IS++ N I S+ P   S    LPNL  L LS NRI  +    F     L  L L  N L  LK  +F G+++L++L +  N + E     L PL  L+   L  N  + I+      DN F    +L+ L+++   I++++   F     LE L+L GN L  IS G            ++ Q+ +           V  I LS N I  L   TFRNLPK                        LQ LDLS N I  +E  A  GL  L  F L
Sbjct:  525 VERISLKGNQITSL-PAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAIT------DNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPK------------------------LQYLDLSSNEIRNVEPGALKGLDELQEFVL 771          

HSP 2 Score: 52.373 bits (124), Expect = 2.142e-6
Identity = 75/269 (27.88%), Postives = 125/269 (46.47%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIG--------------------------FIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDIL--KPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAF 1247
            + ++ +  N +  I     S LPNLVSLKLS N+I                            IED SF +LPNLS L+LN+N +T L+   F    +LK + + NN I  +  + L       ++   +  N   H+  +  + D    A+ +L++L+M+   +  L      G   LE+L L  NHL +I       +  +  + +  N++   LP  F NLP L  LDL+ N  + +  ++ + + +L+ LDLS+N +  +  N+F
Sbjct:  210 LKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLD----ALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSF 474          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: si:dkey-1j5.4 (si:dkey-1j5.4 [Source:ZFIN;Acc:ZDB-GENE-130603-91])

HSP 1 Score: 77.411 bits (189), Expect = 1.196e-14
Identity = 69/198 (34.85%), Postives = 102/198 (51.52%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNM-TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPK 1118
            I+S+ +E N+I+SI P  F+    L+ L L  NRI  I  K F +L NL  L L  N + +LK N F G+  L  L +  N +T L  +  KPL  L+   LS+N  Q IS         F  +++L  LNM   K+K++ A TF  LT LE L L  N L+ ++  T + +  +  + + +N I  L  + F + PK
Sbjct:   80 IESVKLERNSIKSIHPQAFAGAQRLMLLNLQGNRISKIPVKGFKDLLNLRFLMLGQNQIANLKPNMFIGMRNLSELDLPLNALTALPPNAFKPLIALKVLDLSLNRIQRIS------PKAFVGLEELLFLNMDNNKLKSIQAGTFGPLTGLEMLVLDNNLLSTLTVSTLEGLSNLQELYVRKNEIESLPADVFLHTPK 271          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 75.485 bits (184), Expect = 1.453e-13
Identity = 73/252 (28.97%), Postives = 124/252 (49.21%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            +  + +E NN+RS+    F    NL +L L++N++  I+D+ F  + ++  L L  N+L+ L    F  L  L+ L +  N +  L   + + L  L+   L+ N       +  +  NVF  + KL+ L +   +I  +    F G+  L  L+L  N LTV+   TF  +Q + ++ LS N+I  L P TFR+L  L  L L +N +  +   VF  +  L+ L+L +N +       F+GL  L + +L
Sbjct:  132 LAHLHLERNNLRSLSGLVFQGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGN------YLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKL 377          

HSP 2 Score: 64.3142 bits (155), Expect = 4.455e-10
Identity = 79/268 (29.48%), Postives = 126/268 (47.01%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLR 1352
            N ++ I  N F  LP L  L L  N+I  +  ++F  + +L  L L+ N LT L   TF GL+ L +L + NN I  L     + L+ L+   L  N      Q+  +   VF  +  L+ LN+   +++     TF GL  L  ++L G+    +    F+ + K+  I+L R+ +  +  ++F  L  L  L L +N++S +  + F E+  LQ LDL  N +  I  N F GLK       N+ Y      L +N  A +L  L+
Sbjct:  236 NYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHN------QIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLK-------NLDYLLLSGNLLHNLPAEALLPLQ 490          

HSP 3 Score: 58.151 bits (139), Expect = 3.928e-8
Identity = 70/240 (29.17%), Postives = 114/240 (47.50%), Query Frame = 3
Query:  567 IDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALT-FYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +D N FSNLP     KL++  + F+  +S              ++L SL  + F GL  L  L +  N +  LS  + +   NL    LS+N NQ       + D +F  +  +  LN+   + ++   T F  L  L  L L GN L  + P  FQ + ++  ++L+ N ++ +    F  LPKL  L L  N +  ++   F  + +L+ LDLS N + V+    F+GL+SL + RL+
Sbjct:   89 LDGNLFSNLPAGAFEKLTN--LEFLNLQS--------------SLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVFQGTSNLA--TLSLNNNQMF----RIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLS 306          

HSP 4 Score: 52.7582 bits (125), Expect = 1.686e-6
Identity = 56/208 (26.92%), Postives = 94/208 (45.19%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQ------------------VGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPK 1118
            N+I S+ P TF +L  L  L L  N+I  +  + F+ L +L  L L NN L   ++ TF GL  L ++ +  +    L   + K L  L    L  +    +S                   +  V    F  +++L+ L++   K+  +T+ TFYGL +L+ L L GN L  +       +Q ++ ++LS N +  +L  T   LP+
Sbjct:  308 NSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPR 515          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 75.485 bits (184), Expect = 1.453e-13
Identity = 73/252 (28.97%), Postives = 124/252 (49.21%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            +  + +E NN+RS+    F    NL +L L++N++  I+D+ F  + ++  L L  N+L+ L    F  L  L+ L +  N +  L   + + L  L+   L+ N       +  +  NVF  + KL+ L +   +I  +    F G+  L  L+L  N LTV+   TF  +Q + ++ LS N+I  L P TFR+L  L  L L +N +  +   VF  +  L+ L+L +N +       F+GL  L + +L
Sbjct:  132 LAHLHLERNNLRSLSGLVFQGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGN------YLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKL 377          

HSP 2 Score: 64.3142 bits (155), Expect = 4.455e-10
Identity = 79/268 (29.48%), Postives = 126/268 (47.01%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLR 1352
            N ++ I  N F  LP L  L L  N+I  +  ++F  + +L  L L+ N LT L   TF GL+ L +L + NN I  L     + L+ L+   L  N      Q+  +   VF  +  L+ LN+   +++     TF GL  L  ++L G+    +    F+ + K+  I+L R+ +  +  ++F  L  L  L L +N++S +  + F E+  LQ LDL  N +  I  N F GLK       N+ Y      L +N  A +L  L+
Sbjct:  236 NYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHN------QIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLK-------NLDYLLLSGNLLHNLPAEALLPLQ 490          

HSP 3 Score: 58.151 bits (139), Expect = 3.928e-8
Identity = 70/240 (29.17%), Postives = 114/240 (47.50%), Query Frame = 3
Query:  567 IDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALT-FYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +D N FSNLP     KL++  + F+  +S              ++L SL  + F GL  L  L +  N +  LS  + +   NL    LS+N NQ       + D +F  +  +  LN+   + ++   T F  L  L  L L GN L  + P  FQ + ++  ++L+ N ++ +    F  LPKL  L L  N +  ++   F  + +L+ LDLS N + V+    F+GL+SL + RL+
Sbjct:   89 LDGNLFSNLPAGAFEKLTN--LEFLNLQS--------------SLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVFQGTSNLA--TLSLNNNQMF----RIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLS 306          

HSP 4 Score: 52.7582 bits (125), Expect = 1.686e-6
Identity = 56/208 (26.92%), Postives = 94/208 (45.19%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQ------------------VGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPK 1118
            N+I S+ P TF +L  L  L L  N+I  +  + F+ L +L  L L NN L   ++ TF GL  L ++ +  +    L   + K L  L    L  +    +S                   +  V    F  +++L+ L++   K+  +T+ TFYGL +L+ L L GN L  +       +Q ++ ++LS N +  +L  T   LP+
Sbjct:  308 NSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPR 515          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 72.7886 bits (177), Expect = 1.158e-12
Identity = 79/248 (31.85%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPET---FRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N + SI    FS LP+L  L+LS NR+  +E  +F  L  L SL +  N ++ L    F+GL  +++L +  N +TE+S   L  L  LQ   LS N    IS++   PD   F  +KL  L+++  ++  L   +F GL+ LE+L +  N ++ I+ G F+ +  +  ++L  N I   + +    F  L  L  L L  N +  ++ + F+ +  L+ LDLS+N I  ++ NAF  +K L    LN
Sbjct:   75 NRLNSIPAKIFS-LPHLQHLELSRNRLRRVEGLTFQGLHGLRSLKMQRNGISRLMDGAFWGLNNMEVLQLEFNNLTEVSKGWLYGLLTLQQLHLSHNS---ISRIK--PDAWEF-CQKLAELDLSWNQLSRLEEGSFVGLSVLEQLHIGNNRISFIADGAFRGLTNLQTLDLKFNEISWTIEDMNGPFSALDNLRKLFLQGNRIRSVTRKSFTGLEMLEQLDLSNNAIMSLQANAFSQMKKLSELHLN 315          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lgr4 (Danio rerio leucine-rich repeat containing G protein-coupled receptor 4 (lgr4), mRNA. [Source:RefSeq mRNA;Acc:NM_001353862])

HSP 1 Score: 68.9366 bits (167), Expect = 1.870e-11
Identity = 68/246 (27.64%), Postives = 116/246 (47.15%), Query Frame = 3
Query:  537 ISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGL---TDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            + +  NNI  +  N F NLP L  L+L+ N + FI  ++                          GL +LK+L + NN +  + +  LK L  LQ  +L  N   HI+   +VP++ F  +++L+HL   +   +LT +    L   ++L+ L L  N +T I    F  +  + +++L+ N ++ + PE  + LPKL  L    N+++ I +  F   S L+T+ L DN +  +   AF  L  L
Sbjct:   65 LDISMNNITELPANVFRNLPYLEELRLAGNDLAFIHPEALS------------------------GLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDAN---HIT---SVPEDSFEGLQQLRHL--WLDDNSLTEVPISPLQHQSNLQALTLALNRITHIPDNAFANLSSLVVLDLNFNNLK-IFPEAIQMLPKLKELGFHSNNIASIPEGAFCRNSLLRTIHLFDNPLSFVGTTAFQNLSDL 277          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:100489984])

HSP 1 Score: 77.7962 bits (190), Expect = 4.121e-14
Identity = 73/239 (30.54%), Postives = 110/239 (46.03%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLL 1268
            N+I ++ P  FS + NL  L LS NR+  + +                        +TF+GL  L +L + NN +T L   I K L+    F + +N  Q+                         KIK L   TF GL  LE L L  N++  I PG+F  +  V +INLS N ++ L    F+ L KL SL +  + LS+I  ++F+ +S+++ L L +N I  IE ++F  L  LL
Sbjct:  245 NHISTVAPRAFSGMKNLRWLDLSHNRLTALYE------------------------DTFFGLPSLNVLRLSNNSLTSLRPRIFKDLQ----FLVELNLGQN-------------------------KIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINLSGNCLKSLAEHCFKGLGKLHSLHMESSCLSHIKPQMFAGLSSIRRLFLQNNEIVAIENHSFTDLHGLL 430          

HSP 2 Score: 69.707 bits (169), Expect = 1.145e-11
Identity = 69/253 (27.27%), Postives = 119/253 (47.04%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +  + +E N I+S+ P+TF++  NLVSL L++N +  IED                          F GL  L  L++  N +  L   +   L NL+   L+ N      ++  +  ++F ++ +LK L+++   +K + A  F       +L L  NH++ ++P  F  ++ +  ++LS N +  L  +TF  LP L  L LS N L+ +   +F ++  L  L+L  N I ++    F GL  L L  LN
Sbjct:  117 LAHLHLERNMIKSLAPSTFTHTQNLVSLTLNNNFLTKIED------------------------GLFSGLSNLWYLNLGWNLLVVLPDMVFHDLLNLRELVLAGN------RLVYLQPSLFLSLGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLTSLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLN 339          

HSP 3 Score: 69.707 bits (169), Expect = 1.281e-11
Identity = 74/244 (30.33%), Postives = 122/244 (50.00%), Query Frame = 3
Query:  537 ISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            + +  N + ++  +TF  LP+L  L+LS+N +  +  + F +L  L  L L  N +  L   TF GL +L++LS+ +N + E+       L N+    LS N       + ++ ++ F  + KL  L+M    + ++    F GL+ + RL LQ N +  I   +F  +  +  ++L  N +  L   +F  L  L  L LS N +  IS EVFS +  LQ LDLSDN +  +  + F+ L SL
Sbjct:  264 LDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLTSLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINLSGN------CLKSLAEHCFKGLGKLHSLHMESSCLSHIKPQMFAGLSSIRRLFLQNNEIVAIENHSFTDLHGLLELDLRSNKLTHLTTRSFTGLKNLSYLLLSSNQILTISPEVFSPVQQLQWLDLSDNQLKALTEDIFLPLSSL 501          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: TRIL (TLR4 interactor with leucine-rich repeats [Source:NCBI gene;Acc:100498304])

HSP 1 Score: 73.559 bits (179), Expect = 1.085e-12
Identity = 75/251 (29.88%), Postives = 121/251 (48.21%), Query Frame = 3
Query:  537 ISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNI 1286
            ++V  N + +I   +FSNL  L+ L+L  N I  ++   F  L NL  L+L NN +T++  N F GL KL++LS+  N  + L      PL+ L    ++ N    + Q+G    ++F  +++L  L ++  +I  +   TF GL  L+ L L GN L  +  G    +  + ++NLSRNAI  L PETF+ L +                        L+ LDL  N +  +    F G  + +L+RL +
Sbjct:  134 LNVNGNRLHNISRVSFSNLAALIKLRLDGNDIQNLQGSPFSALSNLLYLHLENNKITNISKNAFTGLGKLRLLSLSGNPQSFLRQPTFLPLRALSTLTMAGN---QLQQLG---PSLFNGLQRLSRLVLSSNQISVIQTKTFLGLDLLQELHLDGNKLVQLPEGVLVPLHNLEVLNLSRNAISHLHPETFKGLMR------------------------LRVLDLQHNMLRYLSGQTFAG--NPVLYRLQL 352          

HSP 2 Score: 60.077 bits (144), Expect = 1.440e-8
Identity = 69/235 (29.36%), Postives = 105/235 (44.68%), Query Frame = 3
Query:  555 NIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGL 1256
            NI ++D   F   P L  L L  NRIG I  K+F+                         L +L+ L + NN +  L+   L PL+ L+   ++ N   +IS+V       F  +  L  L +    I+NL    F  L++L  L L+ N +T IS   F  + K+ +++LS N    L   TF  L  L +L ++ N L  +   +F+ +  L  L LS N I VI+   F+GL
Sbjct:   71 NISALD---FVQFPQLQRLDLQYNRIGSIHPKAFEK------------------------LTELEELYLGNNLLATLAPGALAPLRKLKVLNVNGNRLHNISRVS------FSNLAALIKLRLDGNDIQNLQGSPFSALSNLLYLHLENNKITNISKNAFTGLGKLRLLSLSGNPQSFLRQPTFLPLRALSTLTMAGNQLQQLGPSLFNGLQRLSRLVLSSNQISVIQTKTFLGL 272          

HSP 3 Score: 50.8322 bits (120), Expect = 9.480e-6
Identity = 44/141 (31.21%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  864 VGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            + N+    F    +L+ L++   +I ++    F  LT+LE L L  N L  ++PG    ++K+ ++N++ N +  +   +F NL  L+ L L  ND+  +    FS +S L  L L +N I  I +NAF GL  L L  L+
Sbjct:   69 IANISALDFVQFPQLQRLDLQYNRIGSIHPKAFEKLTELEELYLGNNLLATLAPGALAPLRKLKVLNVNGNRLHNISRVSFSNLAALIKLRLDGNDIQNLQGSPFSALSNLLYLHLENNKITNISKNAFTGLGKLRLLSLS 209          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 73.1738 bits (178), Expect = 1.437e-12
Identity = 73/239 (30.54%), Postives = 115/239 (48.12%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            N I  I P +F  LP+L  L+L  NRI  +E  +F  L +L SL L  N +  L    F+GL+ ++ L +  N +T+++   L  L++LQ   +S N    IS     PD   F  +KL  L+++  ++  L    F GL+ LE++ L  N +  I+ G F+ +  + +++L  N I   + ++                     +EVF+ +S L TL L  N I  I   AF GL SL
Sbjct:  117 NRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRIS-----PDAWEFC-QKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDS---------------------NEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSL 327          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 72.7886 bits (177), Expect = 2.022e-12
Identity = 73/239 (30.54%), Postives = 115/239 (48.12%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            N I  I P +F  LP+L  L+L  NRI  +E  +F  L +L SL L  N +  L    F+GL+ ++ L +  N +T+++   L  L++LQ   +S N    IS     PD   F  +KL  L+++  ++  L    F GL+ LE++ L  N +  I+ G F+ +  + +++L  N I   + ++                     +EVF+ +S L TL L  N I  I   AF GL SL
Sbjct:  130 NRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRIS-----PDAWEFC-QKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDS---------------------NEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSL 340          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 72.0182 bits (175), Expect = 3.212e-12
Identity = 73/239 (30.54%), Postives = 115/239 (48.12%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            N I  I P +F  LP+L  L+L  NRI  +E  +F  L +L SL L  N +  L    F+GL+ ++ L +  N +T+++   L  L++LQ   +S N    IS     PD   F  +KL  L+++  ++  L    F GL+ LE++ L  N +  I+ G F+ +  + +++L  N I   + ++                     +EVF+ +S L TL L  N I  I   AF GL SL
Sbjct:  185 NRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRIS-----PDAWEFC-QKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDS---------------------NEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSL 395          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrrc15 (leucine rich repeat containing 15 [Source:MGI Symbol;Acc:MGI:1921738])

HSP 1 Score: 76.6406 bits (187), Expect = 6.463e-14
Identity = 83/289 (28.72%), Postives = 135/289 (46.71%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNN-FKASSLAKLR----KNTKIKGL 1376
            ++++ +  N +  I P  FS   NL  L+L  N + +I +  FD+                       GL KL   ++ NN  T LS  + + L NLQ  +L  N      ++ ++P   F A+  L+ L +   +I  L+   F+   +L+RL L  NH++ + PG F Q+  +  + L  N+++ L P  F  +P L  L L  N ++ + D  FS ++ LQ L LS N +  I   AF GL +L    L   +  A  +L  N F+  SLA LR    +N +++ L
Sbjct:  127 LETLLLSNNQLVQIQPAQFSQFSNLKELQLYGNNLEYIPEGVFDH---------------------LVGLTKL---NLGNNGFTHLSPRVFQHLGNLQVLRLYEN------RLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISHLPPGIFMQLPHLNKLTLFGNSLKELSPGVFGPMPNLRELWLYNNHITSLPDNAFSHLNQLQVLILSHNQLSYISPGAFNGLTNLRELSL---HTNALQDLDGNVFR--SLANLRNVSLQNNRLRQL 380          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Tril (TLR4 interactor with leucine-rich repeats [Source:MGI Symbol;Acc:MGI:1914123])

HSP 1 Score: 75.485 bits (184), Expect = 2.181e-13
Identity = 97/355 (27.32%), Postives = 149/355 (41.97%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT---MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAF--VGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRK---------NTKIKGLLDYLGITMGYG----------EPPDVDNSK-KYVKDQDWKNSYC----PVAQASDKYW 1505
            +  + +++N IRS+ P TF  L  L  L L +N +  +   +   L  L  LY N N +  L   +F GLE L  L +  N +  L   +  PL NL +  L  N    I  +G    N F  + KL+ LN++   ++     A TF  L  L  L L  N L  + P  FQ + ++ +++LS N +  L PE F  L  L  L L  N L+ +   +   + +L+ LDLS N +  +    F   G    L  R N     A + L  +  A+S A  R          + +++GL  ++G     G           PP +      Y+ DQ  +N  C    P   A  + W
Sbjct:   85 LRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALVPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNVLGALPDAVFAPLGNLLYLHLESN---RIRFLGK---NAFSQLGKLRFLNLSANELQPSLRHAATFVPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRELRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRELSLRDN-----ALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQLLQNGSCVDPSPSPTAGSRQW 428          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Igfals (insulin-like growth factor binding protein, acid labile subunit [Source:MGI Symbol;Acc:MGI:107973])

HSP 1 Score: 73.1738 bits (178), Expect = 7.487e-13
Identity = 76/247 (30.77%), Postives = 111/247 (44.94%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLL 1268
            +  + +  N +RS+  N F +LP L  L L  N I  +  ++F  +  L  L L++N +  L  +TF GL  L +L + +N IT L     K L  L+  QL  N                             +I+ L   TF GL  LE L L  N +  +  G F  +  V ++NLS N +R L    F+ L +L SL L ++ L  I    F+ +S L+ L L DN+I  IE  +  GL  LL
Sbjct:  220 LRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHN-----------------------------RIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELL 437          

HSP 2 Score: 61.6178 bits (148), Expect = 2.968e-9
Identity = 63/250 (25.20%), Postives = 109/250 (43.60%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            ++ ++ NN+ SI    F NL +L  L L  + +  +E ++                          GL+ L  L +  N +  L+  + +   +L    L  N       +G + + +F  +  L  LN+    +  L    F GL +L  L L GN LT + P     + ++  ++LSRNA+R +    F +LP+L  L L  N ++ ++   F  +  L+ LDLS N +  +  + F GL  L + RL
Sbjct:   78 ALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQAL------------------------LGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNN------LLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRL 297          

HSP 3 Score: 54.299 bits (129), Expect = 5.960e-7
Identity = 53/158 (33.54%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGN 1001
            + S+ +E + +  I  +TF+ L  L  L L DN I  IE++S   L  L  L L  N LT L    F GL +L+ L + NN +T LS D+L PL+   +  LS N      ++    + +F ++ +L++LN+    +N +  TF     LERL L  N
Sbjct:  388 LHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGPLQRAFWLDLSHN------RLETPAEGLFSSLGRLRYLNL----RNNSLQTFVPQPGLERLWLDAN 535          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 71.633 bits (174), Expect = 3.298e-12
Identity = 80/246 (32.52%), Postives = 126/246 (51.22%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLL---PETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAF--VGLKSLLL 1271
            N I  I P  F  LP+L  L+L  NRI  +E  +F  L +L SL +  N ++ LK   F+GL  ++ L + +N +T ++   L  L+ LQ   +S N  + IS     PD   F  ++L  L+++  ++  L    F GL+ LERL L  N +T I+ G F+ +  +  ++L  N I   +    E F  L  L  L L  N +  ++ + F  + +L+ LDL++N I  I+ NAF    LK L+L
Sbjct:  201 NRISMIPPKVF-KLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKIS-----PDAWEFC-QRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQTHLKGLVL 439          

HSP 2 Score: 55.4546 bits (132), Expect = 3.316e-7
Identity = 80/274 (29.20%), Postives = 125/274 (45.62%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLT------------------------VISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNI-YVIE--RNAFVGLKSL 1265
            ++S+ +  N I  I  ++F  + +L  L LS+NRI  +E   FDNL                        + L ++ +  N I+ +   + K L +LQF +L  N      ++  V    F  +  L+ L M    I  L    F+GL ++E LEL+ N+LT                         ISP  ++  Q+++ ++LS N +  L    F  L  L  L+L  N +++I+D VF  +S LQTLDL +N+I + IE    AF GLKSL
Sbjct:  145 LESLDLSSNIISEIKTSSFPRM-SLKYLNLSNNRISTLEAGCFDNLS-----------------------DSLLVVKLNRNRISMIPPKVFK-LPHLQFLELKRN------RIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSL 387          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 71.633 bits (174), Expect = 3.480e-12
Identity = 80/246 (32.52%), Postives = 126/246 (51.22%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLL---PETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAF--VGLKSLLL 1271
            N I  I P  F  LP+L  L+L  NRI  +E  +F  L +L SL +  N ++ LK   F+GL  ++ L + +N +T ++   L  L+ LQ   +S N  + IS     PD   F  ++L  L+++  ++  L    F GL+ LERL L  N +T I+ G F+ +  +  ++L  N I   +    E F  L  L  L L  N +  ++ + F  + +L+ LDL++N I  I+ NAF    LK L+L
Sbjct:  201 NRISMIPPKVF-KLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKIS-----PDAWEF-CQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQTHLKGLVL 439          

HSP 2 Score: 55.4546 bits (132), Expect = 3.211e-7
Identity = 80/274 (29.20%), Postives = 125/274 (45.62%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLT------------------------VISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNI-YVIE--RNAFVGLKSL 1265
            ++S+ +  N I  I  ++F  + +L  L LS+NRI  +E   FDNL                        + L ++ +  N I+ +   + K L +LQF +L  N      ++  V    F  +  L+ L M    I  L    F+GL ++E LEL+ N+LT                         ISP  ++  Q+++ ++LS N +  L    F  L  L  L+L  N +++I+D VF  +S LQTLDL +N+I + IE    AF GLKSL
Sbjct:  145 LESLDLSSNIISEIKTSSFPRM-SLKYLNLSNNRISTLEAGCFDNLS-----------------------DSLLVVKLNRNRISMIPPKVFK-LPHLQFLELKRN------RIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSL 387          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q496Z2|TRIL_RAT (TLR4 interactor with leucine rich repeats OS=Rattus norvegicus OX=10116 GN=Tril PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.627e-14
Identity = 99/362 (27.35%), Postives = 152/362 (41.99%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT---MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL--LLFRLNIVYGRAKNELQNNFKASSLAKLRK---------NTKIKGLLDYLGITMGYG----------EPPDVDNSK-KYVKDQDWKNSYC----PVAQASDKYWEDSSQAG 1526
            +  + +++N IRS+ P TF  L  L  L L +N +  +   +   L  L  LY N N +  L   +F GLE L  L +  N +  L   +  PL NL +  L  N    I  +G    N F  + KL+ LN++   ++     A TF  L  L  L L  N L  + P  FQ + ++ +++LS N +  L PE F  L  L  L L  N L+ +   +   + +L+ LDLS N +  +    F     L  L  R N     A + L  +  A+S A  R          + +++GL  ++G     G           PP +      Y+ DQ  +N  C    P   A  + W  S+  G
Sbjct:   85 LRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNVLGALPDAVFAPLGNLLYLHLEAN---RIRFLGK---NAFTQLGKLRFLNLSANELQPSLRHAATFVPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRELRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRELSLRDN-----ALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQLLQNGSCVDPSPSPTAGSRQWPISTAPG 435          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q8R5M3|LRC15_RAT (Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 7.424e-14
Identity = 72/247 (29.15%), Postives = 119/247 (48.18%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            ++S+ +  N +  I P  FS   NL  L+L  N +  I +++FD+                       GL KL   ++  N  T LS  + + L NLQ  +L      H +++ ++P   F A+  L+ L +   +I  L+   F+   +L+RL L  NH++ + PG F Q+ ++  + L  N++R L P  F  +P L  L L  N ++ ++D  FS ++ LQ L LS N +  I   AF GL +L
Sbjct:  127 LESLLLSNNQLVQIQPAQFSQFSNLRELQLHGNNLESIPEEAFDH---------------------LVGLTKL---NLGRNSFTHLSPRLFQHLGNLQVLRL------HENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISQLPPGIFMQLPQLNKLTLFGNSLRELSPGVFGPMPNLRELWLYNNHITSLADNTFSHLNQLQVLILSHNQLTYISPGAFNGLTNL 343          

HSP 2 Score: 62.003 bits (149), Expect = 1.725e-8
Identity = 75/244 (30.74%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNM-TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            N+   + P  F +L NL  L+L +NR+  I   +FD L NL  L L  N + +L    F+    L+ L + NN I++L   I   L  L    L  N  + +S        VF  +  L+ L +    I +L   TF  L  L+ L L  N LT ISPG F  +  +  ++L  NA++ L    FR+L  L ++ L  N L  +   +F+ ++ L T+ L +NN+  +    F  L +L   RL
Sbjct:  183 NSFTHLSPRLFQHLGNLQVLRLHENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISQLPPGIFMQLPQLNKLTLFGNSLRELS------PGVFGPMPNLRELWLYNNHITSLADNTFSHLNQLQVLILSHNQLTYISPGAFNGLTNLRELSLHTNALQDLDSNVFRSLANLQNISLQSNRLRQLPGSIFANVNGLTTIQLQNNNLENLPLGIFDHLVNLCELRL 420          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q80X72|LRC15_MOUSE (Leucine-rich repeat-containing protein 15 OS=Mus musculus OX=10090 GN=Lrrc15 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.521e-13
Identity = 83/289 (28.72%), Postives = 135/289 (46.71%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNN-FKASSLAKLR----KNTKIKGL 1376
            ++++ +  N +  I P  FS   NL  L+L  N + +I +  FD+                       GL KL   ++ NN  T LS  + + L NLQ  +L  N      ++ ++P   F A+  L+ L +   +I  L+   F+   +L+RL L  NH++ + PG F Q+  +  + L  N+++ L P  F  +P L  L L  N ++ + D  FS ++ LQ L LS N +  I   AF GL +L    L   +  A  +L  N F+  SLA LR    +N +++ L
Sbjct:  127 LETLLLSNNQLVQIQPAQFSQFSNLKELQLYGNNLEYIPEGVFDH---------------------LVGLTKL---NLGNNGFTHLSPRVFQHLGNLQVLRLYEN------RLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISHLPPGIFMQLPHLNKLTLFGNSLKELSPGVFGPMPNLRELWLYNNHITSLPDNAFSHLNQLQVLILSHNQLSYISPGAFNGLTNLRELSL---HTNALQDLDGNVFR--SLANLRNVSLQNNRLRQL 380          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|P35859|ALS_RAT (Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.750e-13
Identity = 76/239 (31.80%), Postives = 108/239 (45.19%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLL 1268
            N +RS+  N F +LP L  L L  N I  +   +F  +  L  L L++N +  L  +TF GL  L +L + +N I  L     K L  L+  QL  N                             +I+ L   TF GL  LE L L  N +T +  G F  +  V ++NLS N +R L    F+ L KL SL L ++ L ++    F+ +S L+ L L DN+I  IE  +  GL  LL
Sbjct:  228 NALRSVKANVFVHLPRLQKLYLDRNLITAVAPGAFLGMKALRWLDLSHNRVAGLMEDTFPGLLGLHVLRLAHNAIASLRPRTFKDLHFLEELQLGHN-----------------------------RIRQLGERTFEGLGQLEVLTLNDNQITEVRVGAFSGLFNVAVMNLSGNCLRSLPERVFQGLDKLHSLHLEHSCLGHVRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELL 437          

HSP 2 Score: 55.4546 bits (132), Expect = 1.958e-6
Identity = 64/250 (25.60%), Postives = 110/250 (44.00%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            ++ ++ NN+ SI    F NL +L  L L  + +  +E ++                          GL+ L  L +  N +  L+  +     +L    LS       + +G + + +F  +  L  LN+    +  L    F GL +L  L L GN LT + P  F  + ++  ++LSRNA+R +    F +LP+L  L L  N ++ ++   F  +  L+ LDLS N +  +  + F GL  L + RL
Sbjct:   78 ALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQA------------------------LLGLQNLYYLHLERNRLRNLAVGLFTHTPSLASLSLS------SNLLGRLEEGLFQGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALFCGLGELRELDLSRNALRSVKANVFVHLPRLQKLYLDRNLITAVAPGAFLGMKALRWLDLSHNRVAGLMEDTFPGLLGLHVLRL 297          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q9DBY4|TRIL_MOUSE (TLR4 interactor with leucine rich repeats OS=Mus musculus OX=10090 GN=Tril PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.113e-12
Identity = 97/355 (27.32%), Postives = 149/355 (41.97%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT---MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL--LLFRLNIVYGRAKNELQNNFKASSLAKLRK---------NTKIKGLLDYLGITMGYG----------EPPDVDNSK-KYVKDQDWKNSYC----PVAQASDKYW 1505
            +  + +++N IRS+ P TF  L  L  L L +N +  +   +   L  L  LY N N +  L   +F GLE L  L +  N +  L   +  PL NL +  L  N    I  +G    N F  + KL+ LN++   ++     A TF  L  L  L L  N L  + P  FQ + ++ +++LS N +  L PE F  L  L  L L  N L+ +   +   + +L+ LDLS N +  +    F     L  L  R N     A + L  +  A+S A  R          + +++GL  ++G     G           PP +      Y+ DQ  +N  C    P   A  + W
Sbjct:   85 LRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALVPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNVLGALPDAVFAPLGNLLYLHLESN---RIRFLGK---NAFSQLGKLRFLNLSANELQPSLRHAATFVPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRELRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRELSLRDN-----ALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQLLQNGSCVDPSPSPTAGSRQW 428          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A165FWW9 (IGFALS-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=IGFALS PE=2 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 1.661e-168
Identity = 317/323 (98.14%), Postives = 317/323 (98.14%), Query Frame = 3
Query:  399 RETGIEAFFNPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKI 1367
            RETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISD VFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIV GRAKNEL NNFKASSL  LRKN KI
Sbjct:    1 RETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDVVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVXGRAKNELXNNFKASSLXXLRKNXKI 323          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A068WHU4 (Leucine rich repeat containing protein 15 OS=Echinococcus granulosus OX=6210 GN=EgrG_000500600 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.299e-24
Identity = 149/556 (26.80%), Postives = 250/556 (44.96%), Query Frame = 3
Query:  171 FFISNIGTIPINNEANCSISKLGCNCQNIE------IITEDSVRLCCQPDMNTLLITGYDVKNIS------IDIRNSSCS--ERFLNLMIRETGIEAFF-NPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVN--TFYGLEKLKILSMLNNFITELSTDILKPL-KNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT-MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQT--------LDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKN-ELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDV---------------------DNSKKYVKD-QDWKNSYCP----------------------VAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKR 1622
            FF+  +     + EA CS +   C+C   +      ++ ED   +C +    T L+   DV N+         +R S C   ++   L + +TGI+    N F GL  + ++ +  N    ++    F+ I + +  +    N + S+    F++L NL  L L+ N+IG+IE+  F +        L+        +   TF GL  L+ L +  N +  LS  +  P   +L    +S + +        +P+ +F  +  L+ L+M  +KI NLTA +F GLT+L++L L+GN LTV+  G F  + ++  ++LS N + C+   +  +  KL SLDLS N L++++   FS +++           +++S N I  IE +AF      +   L     +A +  + + +  +  A +   + I+G LD  G+  G    PD                      +NSK   KD ++  NS CP                      V   SD  +  + + GSR YLLIIV +C+ FLL A  +IM YRAWS+R
Sbjct:   12 FFLLILSIASHSAEAGCSCTSKTCSCSGDDASDLSGLLVED---ICTEGGTFTRLVL-QDVPNLINLQQGFTALRESRCDGLKQLEVLELHQTGIQNLSSNLFQGLPVLKSLDLSNNSYLKSYRDGSFTKIGNTLIELVATDNRVHSLTKGVFADLKNLQRLILARNKIGYIEEGVFSSGCCGHLKELSLEGNILTDLEDATFVGLRNLQKLDLRGNPLQRLSPRLFSPFASSLTHLWMSHDDSATFGGFDTLPNALFTKMAMLEELSMVELKITNLTADSFTGLTNLKKLSLRGNRLTVLPKGCFTSLPQLEELDLSANGMVCIPDNSEDHYVKLRSLDLSLNGLTHLTRRTFSMLASSHPTPGFPRLLVNISSNPIRRIEPDAFCSFNGPVKLILAPEGAKAPSWAVMDGWPDNPFALVGNGSVIQG-LDRSGVVEGR---PDAAALCGPEGHLFRAKILTSSLYENSKYTDKDIENSLNSECPWLLPDELSPWQLSKLGVPGLPRVPGGSDGSY--ALEEGSRIYLLIIVAVCITFLLAALTVIMCYRAWSRR 557          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: W6UKB0 (Platelet glycoprotein V OS=Echinococcus granulosus OX=6210 GN=EGR_06534 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.152e-24
Identity = 149/556 (26.80%), Postives = 249/556 (44.78%), Query Frame = 3
Query:  171 FFISNIGTIPINNEANCSISKLGCNCQNIE------IITEDSVRLCCQPDMNTLLITGYDVKNIS------IDIRNSSCS--ERFLNLMIRETGIEAFF-NPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVN--TFYGLEKLKILSMLNNFITELSTDILKPL-KNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT-MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQT--------LDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKN-ELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDV---------------------DNSKKYVKD-QDWKNSYCP----------------------VAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKR 1622
            FF+  +     + EA CS +   C+C   +      ++ ED   +C +    T L+   DV N+         +R S C   ++   L + +TGI+    N F GL  + ++ +  N    ++    F+ I + +  +    N + S+    F++L NL  L L+ N+IG+IE+  F +        L+        +   TF GL  L+ L +  N +  LS  +  P   +L    +S + +        +P+ +F  +  L+ L+M  +KI NLTA +F GLT+L++L L+GN LTV+  G F  + ++  ++LS N + C+   +  +  KL SLDLS N L++++   FS +++           +++S N I  IE +AF      +   L     +A +  + + +  +  A +   + I+G LD  G+  G    PD                       NSK   KD ++  NS CP                      V   SD  +  + + GSR YLLIIV +C+ FLL A  +IM YRAWS+R
Sbjct:   12 FFLLILSIASHSAEAGCSCTSKTCSCSGDDASDLSGLLVED---ICTEGGTFTRLVL-QDVPNLINLQQGFTALRESRCDGLKQLEVLELHQTGIQNLSSNLFQGLPVLKSLDLSNNSYLKSYRDGSFTKIGNTLIELVATDNRVHSLTKGVFADLKNLQRLILARNKIGYIEEGVFSSGCCGHLKELSLEGNILTDLEDATFVGLRNLQKLDLRGNPLQRLSPRLFSPFASSLTHLWMSHDDSATFGGFDTLPNALFTKMAMLEELSMVELKITNLTADSFTGLTNLKKLSLRGNRLTVLPKGCFTSLPQLEELDLSANGMVCIPDNSEDHYVKLRSLDLSLNGLTHLTRRTFSMLASSHPTPGFPRLLVNISSNPIRRIEPDAFCSFNGPVKLILAPEGAKAPSWAVMDGWPDNPFALVGNGSVIQG-LDRSGVVEGR---PDAAALCGPEGHLFRAKILTSSLYKNSKYTDKDIENSLNSECPWLLPDELSPWQLSKLGVPGLPRVPGGSDGSY--ALEEGSRIYLLIIVAVCITFLLAALTVIMCYRAWSRR 557          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A0R3TWY8 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12361 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.185e-23
Identity = 150/541 (27.73%), Postives = 235/541 (43.44%), Query Frame = 3
Query:  210 EANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISID--------------IRNSSCS--ERFLNLMIRETGIEAFFNP-FYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKN-LQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT-MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQT--------LDLSDNNIYVIERNAFVGLKSLLLFRLN------IVYGRAKNELQNNFK----ASSLAKLRKNTKIKGLLDYLGITMGYGE-------PPDVDNSKKYVKD--QDWKNSYCP--------------VAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVD 1652
            EA C      C C   +I+  D   L  +    ++  +GY    + I               ++ S CS  +    L + +TGI+ + +  F GL  +  + I  N   +++    F  +   ++ +    N +RS+    F+ L NL  L LS N+IG+ E+  F +  NL  L L+ NILT L+  TF GL  L+ L +  N +  L   I     N L    +S +          +P  +F  +  L  L+M  +KI NLT  +F GLT+L RL L GN LT++  G F  +  +  ++LS N + C+   +    PKL  L+LS N +++++   FS +S+ +         +++S N I  IE +AF   K  L   L         +    N   N F      S +  L+ +  I G  D        G          D+  + KY +   ++  NS CP              +     K+   + + GSR YLLIIV +C+ FLL A  IIM YR WS+R    +T DV+
Sbjct:   23 EAGCFCDHEACTCSGDDIV--DITGLLSE----SVCPSGYSYSRLVITRVPNLVNIPDGFGILQASPCSGLQELEVLELHQTGIQNWSSTLFQGLPHLKTLDISNNSFLTSYRDGVFEKLGGSLEELIAMDNRVRSLTRRAFAGLRNLKRLILSRNKIGYFEEGVFSSTGNLIELSLDGNILTDLENGTFLGLNNLQSLDLRGNPLQLLYPGIFSSFANTLTHLWMSHDDFVTFGGFDTIPTGLFTGMSSLVELSMVELKITNLTTESFKGLTNLRRLSLHGNRLTLLPKGCFTPLINLEELDLSANGMVCIPDNSDEYYPKLRFLNLSLNGITHLTKRSFSMLSSSKPTAKFPRLIVNISSNPIRRIEPDAFCYFKGPLELILAGEHQEPPSWASMANWPDNPFALVGNESIIHGLKPSEVIGGRSDAAAFCGPEGSLFRDKILASDMYKNSKYTEKDIENSLNSECPWMVPDELSPWQLAKLGVPGGKHGAIALEEGSRIYLLIIVAVCITFLLGALTIIMCYRTWSRRATQKVTMDVE 557          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A0R3VUR5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1083 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.971e-23
Identity = 148/560 (26.43%), Postives = 247/560 (44.11%), Query Frame = 3
Query:  171 FFISNIGTIPINNEANCSISKLGCNCQNIEI------ITEDSVRLCCQPDMNTLLITGYDVKNI------SIDIRNSSCS--ERFLNLMIRETGIEAFFNP-FYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVN--TFYGLEKLKILSMLNNFITELSTDILKPL-KNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMT-MKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQT--------LDLSDNNIYVIERNAFV---GLKSLLLFRLNIVY-------GRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGE--------PPDVDNSKKYVKD-QDWKNSYCPVAQASD-KYWE----------------DSSQA---GSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVD 1652
            FF+  +  +  + EA CS +   C+C   ++      +TED   +C +    + L+   DV N+         +  S C   ++   L + +TG++   +  F GL ++ ++ +  N    ++    F  + S +  +    N + S+    F+ L  L  L L  N+IG+IE+  F +        L+        +   TF GL+ L+ L +  N +  LS  +  P   +L    +S + +        +P+ +F  + +L+ L+M  +KI NLTA +F GLT+L+RL L+GN LTV+    F  + ++  ++LS N + C+   +    PKL SLDLS N L++++   FS I++ Q         +++S N I  IE +AF    G   L++              G   N        S +  L  ++ ++G  D   +    G              NSK   KD ++  NS CP     +   W+                D S A   GSR YLLIIV +C+ FLL A  +IM YRAWS+R    +  D +
Sbjct:   12 FFLLILSVVSPSAEAGCSCTSKVCSCSGDDVSDLTGLLTED---ICTEGGTFSRLVL-QDVPNLINLPQGFSALSKSMCDGLQQLEALELHQTGVQNLSSSLFQGLPTLKSLDLSNNSYLKSYRVGSFKKVGSTLVELVATDNWVHSLTKGVFAGLKKLQRLILGRNKIGYIEEGVFSSGCCEHLNELSLEGNILTVLEDATFVGLKNLQKLDLRGNPLQRLSPRLFSPFASSLTHLWMSHDDSATFGGFDTLPNALFAKMARLEELSMVELKITNLTADSFTGLTNLKRLSLRGNRLTVLPKACFTSLPQLEELDLSANGMVCIPDSSEERYPKLRSLDLSLNGLTHLTRRSFSMIASSQPTPEFPRVIVNISSNPIQRIEPDAFCSFNGPAKLIIAPEGATTPSWASMDGWPDNPFALVGNGSIIQGLNLSSVVEGRSDAATLCGPEGHLFRAKILASSLYKNSKYTDKDIENSLNSECPWLLPDELSPWQLSKLGVPGLSRVPGGSDGSHALEEGSRIYLLIIVAVCITFLLAALTVIMCYRAWSRRATQKMAGDAE 567          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: igfals (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:103036545])

HSP 1 Score: 79.337 bits (194), Expect = 6.531e-15
Identity = 74/252 (29.37%), Postives = 124/252 (49.21%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            +  + +E N++R +    F N PNL +L L +N++  IE++ F  L ++  L L  N L+ L    F+ L  L+ L +  N +  L   + + L  L+   LS N      Q+  +  NVF  + KL+ L +   +I  +    F G+  L  L+L  N LT++   TF  +  + ++ LS N+I  L P TFR+L  L  LD+ +N +  + + VF  +  L+ L L  N +       F+GL  L + +L
Sbjct:  116 LAHLHLERNSLRILPAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGN------QLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLSNNSINSLRPGTFRDLQYLEELDMCHNQIRALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKL 361          

HSP 2 Score: 66.2402 bits (160), Expect = 9.328e-11
Identity = 72/257 (28.02%), Postives = 128/257 (49.81%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL--LLFRLNIV 1289
            +  + +  N +R I  N F  LP L  L L+ N+I  +  ++F  + +L  L L+ N LT L   TF GL  L +L + NN I  L     + L+ L+   +  N      Q+  + + VF  +  L+ L++   K+++  + TF GL+ L  ++L G+    +    F+ + K+  ++L +  +  +  + F  L  L  L L +N++S +  + F E+  LQ LD+  NN+  +  + F GLK+L  LL   N++
Sbjct:  212 LKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLSNNSINSLRPGTFRDLQYLEELDMCHN------QIRALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKLTGSCFRSLPDQVFKGLSKLHSMHLDKGCLTKVSTQGFIGLASLRRLFLQHNNISAVDRQSFVELQGLQQLDMRFNNLASLTSHTFYGLKALEYLLLSKNLI 462          

HSP 3 Score: 65.855 bits (159), Expect = 1.062e-10
Identity = 56/208 (26.92%), Postives = 96/208 (46.15%), Query Frame = 3
Query:  717 VNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINP------------------NQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
             ++F  L  L  L++ +  +T L + + K L NL    L  N                   N H +Q+  + + +F  +  +  LN+    +  L    F+ L  L  L L GN L  + P  FQ + ++  ++LS N +R +    F  LPKL  L L+ N ++ ++   F  + +L+ LDLS N + ++    F+GL SL + RL+
Sbjct:   83 ADSFKNLTNLDFLNLQSGQLTSLDSQVFKRLHNLAHLHLERNSLRILPAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLS 290          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: ENSAMXT00000025596.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:16543202:16552825:-1 gene:ENSAMXG00000024870.2 transcript:ENSAMXT00000025596.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 5.797e-13
Identity = 81/278 (29.14%), Postives = 133/278 (47.84%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLS-----INPNQHISQVGN-------------------------------------VPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGL 1256
            NN+ S++  TF  L  L  L LS NR+  +   +  + PNL+SLYL+ N +T +  N FY L  L++L++ NN +  +    L+ L+ L    LS     + P      VG                                      +P ++F  + KLKHL+M    I  L + TF  L  L  ++L  N LT IS G F+  +K+  ++LS+N +  +  E F+ +P+L  L L  N +S + +  FS ++ L+ LDLS+N + +++ ++  GL
Sbjct:  229 NNLSSVEEGTFLGLHGLRHLDLSKNRLSTVPTGTLKDTPNLTSLYLHQNGITRVPENAFYSLSSLQMLNLNNNPLKVIHAAALRGLRKLHDLDLSSSKLQVLPPSVFQDVGKLKHLCLFDIALTSLPQGLFNNLTLLQELQLDKNKIHIIPPDLFHPLSKLKHLHMDSNLISELNSSTFRTLRRLVHIDLSNNQLTNISSGLFKGTRKLAHLDLSKNMLTAVPTEAFKEIPRLNRLFLQKNAISSVPENAFSGLAGLKKLDLSNNPLEILDEDSLRGL 506          

HSP 2 Score: 56.225 bits (134), Expect = 1.286e-7
Identity = 74/253 (29.25%), Postives = 118/253 (46.64%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMK-IKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +  + ++ N I  I P+ F  L  L  L +  N I  +   +F  L  L  + L+NN LT++    F G  KL  L +  N +T + T+  K +  L    L  N       + +VP+N F  +  LK L+++   ++ L   +  GL  L  L+L  N L  +    FQ + K+  +NL  N +  +    F NL +L  L L  N++S I  E F+ ++ L+ L L +NNI  +  + F  LK L    LN
Sbjct:  365 LQELQLDKNKIHIIPPDLFHPLSKLKHLHMDSNLISELNSSTFRTLRRLVHIDLSNNQLTNISSGLFKGTRKLAHLDLSKNMLTAVPTEAFKEIPRLNRLFLQKNA------ISSVPENAFSGLAGLKKLDLSNNPLEILDEDSLRGLFMLAELDLSFNQLQDLPSCVFQDLGKLKNLNLYNNELDTIPERLFNNLTQLKVLQLDSNNISVIFPETFNPLTELRDLQLDNNNILQLNASLFKNLKHLHSLYLN 611          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:103037077])

HSP 1 Score: 68.5514 bits (166), Expect = 2.278e-11
Identity = 82/248 (33.06%), Postives = 126/248 (50.81%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNM-TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N + SI   TF  L NL  L LS NR+  IE  +F  L  L SL +  N +T L    F+GL  ++IL +  N +TE+S   L  L  LQ   L+ N    IS++   PD   F  +KL  L++ + ++  L   +F GL+ LE+L +  N ++ I+ G F+ +  +  ++L  N I   + +    F  L  L  L L  N +  ++ + F+ +  L+ LDLS+N I  I+ NAF  +K L    LN
Sbjct:  187 NRLNSIPAKTF-QLSNLQHLDLSRNRVRRIEGLTFHGLHRLRSLKMQRNGITRLMDGAFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNA---ISRI--KPDAWEF-CQKLAELDLNSNQLARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLSLLNTLDLKYNEISWTIEDMNGPFSALNNLRKLFLQGNRIRSVTKKSFTGLDLLEQLDLSNNAIMSIQGNAFSQMKKLEELLLN 427          

HSP 2 Score: 55.4546 bits (132), Expect = 2.420e-7
Identity = 74/278 (26.62%), Postives = 127/278 (45.68%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQN-NFKASSLAKLRK 1355
            ++++ +  NN++ +    F  LP L +L L++NRI  +E    +NL                          L +L +  N +  +     + L NLQ   LS N      +V  +    F  + +L+ L M    I  L    F+GL+++E L+L+ N+LT +S G    +  +  ++L+ NAI  + P+ +    KL  LDL+ N L+ + +  F  +S L+ L +  N +  I   AF GL   LL  L++ Y      +++ N   S+L  LRK
Sbjct:  131 LETLDLGNNNLQEVRTGAFPPLP-LKNLYLNNNRISVLEHGCLNNLS-----------------------STLLVLRLNRNRLNSIPAKTFQ-LSNLQHLDLSRN------RVRRIEGLTFHGLHRLRSLKMQRNGITRLMDGAFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNAISRIKPDAWEFCQKLAELDLNSNQLARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLS--LLNTLDLKYNEISWTIEDMNGPFSALNNLRK 375          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: rtn4rl2b (reticulon-4 receptor-like 2 [Source:NCBI gene;Acc:103033432])

HSP 1 Score: 66.6254 bits (161), Expect = 4.983e-11
Identity = 57/187 (30.48%), Postives = 86/187 (45.99%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRN 1109
            NNI  I+   FSNL  L  L L DN                         L  L    F GLE+L+ L M    +TEL  D+   L +LQF  L  N      Q+G++PD +F  +  L HL +   +I+ ++   F GL +L+RL +  N +  +    F+ + ++TI+ L  N +R L  +T R+
Sbjct:  102 NNITWIEAGAFSNLRVLEELDLGDN-----------------------PSLRRLDGGAFRGLERLQSLHMHRCGLTELPADLFLKLYSLQFLYLQEN------QLGHLPDGLFSDLVNLTHLFLHGNRIRVISENAFRGLVNLDRLLVHDNRIRQVHRRAFRDLGRLTILYLFDNQLRELPGQTLRD 259          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 66.6254 bits (161), Expect = 7.463e-11
Identity = 62/245 (25.31%), Postives = 107/245 (43.67%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N IR I+   F+ LPNL +L+L DNR+  +  ++F+                         L KL+ L + NN I  L       + +L+   L       + ++  + D  F  +  L++LN+ M  +K++  LT   L  LE LEL GN L +I PG+FQ ++ +  + L  + +  +     RN                     F ++ +L+ L+LS N+++ +  + F  L+ L    LN
Sbjct:  103 NQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEY------------------------LSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLG-----ELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLT--PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVI----ERN--------------------AFDDLKSLEELNLSHNSLHSLPHDLFTPLQKLERVHLN 292          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 75.8702 bits (185), Expect = 1.596e-14
Identity = 82/248 (33.06%), Postives = 127/248 (51.21%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N I S+ P  F  LP+L  L+L+ NRI  IE  SF  L +L SL L  N +  L    F+ LEKL+IL +  N +T ++   L  L +LQ   +S N       V  +  + +   +KL  L+++   +  +   TF GL  L  L L  NHL+ I+ G F++++ +  ++L+ N I   + +    F  L  L  L LS N +  I+ + F  +  L +LDLS+N +  I+  +F  LK+L   RLN
Sbjct:   75 NRITSLAPKLF-KLPHLQHLELTRNRIKRIESLSFFGLESLQSLRLQRNNIGRLMDGAFWRLEKLEILHLDFNALTNVTKGWLYGLSSLQQLNMSHN------NVSRIDLDAWEFCQKLDELDLSHNHLSRIEEGTFVGLGMLRSLLLAHNHLSNIADGAFKELRSLLTLDLAGNEISWTIEDMHGAFTGLENLNKLVLSENKIKSIAKKAFIGLERLHSLDLSNNALMSIQDGSFSSLKALTEMRLN 315          

HSP 2 Score: 49.6766 bits (117), Expect = 2.746e-6
Identity = 46/190 (24.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM----KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRC 1085
            ++ + ++FN + ++       L +L  L +S N +  I+  +++    L  L L++N L+ ++  TF GL  L+ L + +N ++ ++    K L++L    L+ N      ++    +++  A   L++LN  +    KIK++    F GL  L  L+L  N L  I  G+F  ++ +T + L+ +++ C
Sbjct:  138 LEILHLDFNALTNVTKGWLYGLSSLQQLNMSHNNVSRIDLDAWEFCQKLDELDLSHNHLSRIEEGTFVGLGMLRSLLLAHNHLSNIADGAFKELRSLLTLDLAGN------EISWTIEDMHGAFTGLENLNKLVLSENKIKSIAKKAFIGLERLHSLDLSNNALMSIQDGSFSSLKALTEMRLNSSSLLC 321          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.783e-14
Identity = 73/251 (29.08%), Postives = 121/251 (48.21%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +I +  N I +I  N F NL +L ++ L  N I   + ++F    +L  + L  N + SL+   F G+  LK L +  N I   ++   + L  L    + +N       + ++P   F     L  L++   KI+ ++   F GL +L+ L L  N +T I+PGT Q +Q + ++ L+ N I+ +   TF+ L  L  L  S N +S ++ + F+    L  L +SDN I VIE   F  L  L +  L+
Sbjct:   63 TIKLANNEITNIGANAFQNLNHLKNIHLESNHISGFDSRAFAGAKSLQMINLYGNNIRSLQSKAFQGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMN------NITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFSTLSGLQMIYLH 307          

HSP 2 Score: 50.447 bits (119), Expect = 8.415e-7
Identity = 50/195 (25.64%), Postives = 80/195 (41.03%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNL 1112
            +  + +  NNI S+    F + P+LV L L+ N+I  I  K+                        F GL+ L  L++ NN IT ++   L+ L+NL+   L+ N                              IK +T+ TF GLT+L  L    N ++V++   F    K+T + +S N I+ +   TF  L
Sbjct:  157 LSDLDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKA------------------------FVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNN-----------------------------NIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFSTL 298          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 72.4034 bits (176), Expect = 2.174e-13
Identity = 62/181 (34.25%), Postives = 99/181 (54.70%), Query Frame = 3
Query:  744 LKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            LKIL + NN IT L+T + + L +LQ   LS N  Q +  +       F  +  L++L +   +I +L    F+GL  +++++LQ N LT +S G    +Q +  +++SRNAI  +  E ++    L  LDLS+N L+ +++  F E+  LQ+L L+ N I  I   AF GL SL +  L 
Sbjct:   22 LKILKLSNNRITVLTTKLFQ-LPSLQHLDLSRNRLQRVEGL------AFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLG 195          

HSP 2 Score: 60.4622 bits (145), Expect = 1.135e-9
Identity = 69/236 (29.24%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  588 NLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
             LP+L  L LS NR+  +E  +F  L +L  L L  N ++SL    F+GL +++ + + +N +TE+ST  L  L++L+   +S N       +  +    +   + L  L+++   +  L    F  L  L+ L L  N ++ I  G F+ +  + I++L  N I   + +    F  L  L  L L  N +  I+ + F  +  L  LDL  N I  I+ NAF  LK L   +LN
Sbjct:   41 QLPSLQHLDLSRNRLQRVEGLAFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNA------ITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSKLSLHGNQIKSIAKKAFVGLERLGQLDLMGNAIVSIQANAFNTLKLLHQMKLN 270          

HSP 3 Score: 51.9878 bits (123), Expect = 4.034e-7
Identity = 50/218 (22.94%), Postives = 99/218 (45.41%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQ------------------VGNVPDNVFFAVKKLKHLNM-----TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNL 1112
            +  + +  N ++ ++   FS L +L  L+L  NRI  + D +F  L  +  + L +N LT +     YGL+ L+ L +  N IT + ++  K  +NL    LS N    +++                  + ++ +  F  +  L+ L++     +  ++++    F GL+ L +L L GN +  I+   F  ++++  ++L  NAI  +    F  L
Sbjct:   45 LQHLDLSRNRLQRVEGLAFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQG-AFTGLSALSKLSLHGNQIKSIAKKAFVGLERLGQLDLMGNAIVSIQANAFNTL 261          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 63.5438 bits (153), Expect = 1.012e-10
Identity = 66/251 (26.29%), Postives = 113/251 (45.02%), Query Frame = 3
Query:  534 SISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNM-TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
             +S+ +N+++S+  N FS L  L  L L  N I  + + +F                         G  +LK L++ +N +  L      PL N++   +S N      Q+  +    F  ++KL++L+M + +++ +    F     +E L+L  N L V++   F  + ++T ++L  N    L    F  L  L +L L +N +S +   +    S+LQTLDLS N I +I    F GL  L   RL+
Sbjct:   63 GLSLRYNSLKSLPENHFSGLKQLTWLYLDHNHIQLVAEGAF------------------------VGARRLKELTLSSNKLIRLPNATFHPLVNMRSLDISFN------QLQMLEAGQFRGLRKLQYLHMRSNQLRTVPVRIFQDCRSIELLDLGYNRLRVLARNAFTGLGRLTELHLEHNQFAKLNLAHFPRLISLRTLYLQWNRISVLMQGMAWTWSSLQTLDLSGNEIQLIGPGFFQGLSKLHNLRLD 283          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: tlr21 (toll-like receptor 21 [Source:ZFIN;Acc:ZDB-GENE-040220-4])

HSP 1 Score: 58.9214 bits (141), Expect = 4.311e-9
Identity = 73/252 (28.97%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDP-NTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELS-TDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNM-TMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIER---NAFVGLKSL 1265
            + S+ +++N +  ++P +T   LP+L +L L+ N+I  +++ +F ++P+L SL L  N++ S+  N F GL +L  L + NN I E   +     L+NLQ   L  N      ++  +   VF  + +LK L++ +  I +L   TF GL  L  L L  N +  ++P  F  ++ + I++L +N I         N P                   F ++S L TL LS    Y I+R   N F GL+ L
Sbjct:  253 LRSLMLDYNRLNVLEPCDTCMRLPHLETLSLAWNKITLVQNSAFVHVPSLRSLILKGNLIFSISQNPFRGLRELTELRLDNNLIHEFHVSSPFAALENLQTLNLRRN------RIKRLHRQVFGNLTQLKILDLGSNMISSLKEHTFVGLEGLRNLYLDENSIGWVTPPMFTGLESLRILDLVKNMI-SYSTRLLDNPP-------------------FVKLSNLITLKLSAQQPYGIQRIPENLFAGLRLL 478          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO49136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ6])

HSP 1 Score: 50.447 bits (119), Expect = 2.307e-6
Identity = 45/148 (30.41%), Postives = 74/148 (50.00%), Query Frame = 3
Query:  852 HISQVGN----VPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
            H+  +GN    V       +++L  LN+ M +I  + + TF  +  LE L+L GN LT IS G F  ++ +T + L  N I  L    F   P L  L ++ N+++ +   +F     L+ L + DNN+  I+ N F G ++L +  L
Sbjct:   55 HLDLLGNLLITVTRGYLRNLRQLLELNLGMNQIDYIASGTFTDMAKLELLDLSGNQLTFISEGMFTGLRNLTTLFLFMNEILDLPASLFWGTPNLKILSINRNNITKLHQHLFRNSLHLEYLFMDDNNLTTIKPNTFKGARALEILSL 202          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 50.0618 bits (118), Expect = 4.236e-6
Identity = 69/244 (28.28%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  564 SIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPE---TFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            SI  + F+ L +L  LKLS NRI  I                            F+G  KL+ L +  N  T + T     L++LQ   L  N    IS +       + +   L+ LN+   ++ ++   TF  L  L+ L L  N +  IS G+F  ++ +  ++LS N I   + E    FR L  L SL L  N ++ I+   F  +  ++ L+LS N I  I+ N+F G+  L    LN
Sbjct:  262 SILASAFNRLSSLEVLKLSKNRISTIR-------------------------GAFWGQNKLQQLYLDRNNFTAIQTSSFFGLRDLQNLYLQSN---QISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQKLWLN 477          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: igfals (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:101172904])

HSP 1 Score: 77.411 bits (189), Expect = 2.576e-14
Identity = 72/253 (28.46%), Postives = 124/253 (49.01%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +  + +E N +R++    F N PNL SL L +N+I  I+++ F  L ++  L L  N LT L    F+ L  L+ L +  N +  L   + + L  L+   L+ N       V  +  NVF  + KL+ L +   +I  +    F G+  L  L+L  N LT +   TF  +  + ++ LS N++  + P TFR+L  L  L LS+N +  + + +F  +  L+ L+L  N +   +  +F GL  + +  L+
Sbjct:  118 LAHVHLERNRLRALPGTIFQNTPNLASLSLHNNQISRIDERLFAGLSHMWLLNLGWNSLTVLPETVFHDLHSLRELILAGNRLAYLQPQLFQNLVELKELDLTGN------HVKVIKANVFVKLTKLQKLYLARNQIVTIVPRAFVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNNSVTGIRPRTFRDLQYLEELQLSHNKIRVLGERIFDGLGHLEVLELQHNQVQEAQMGSFTGLSHVAVINLS 364          

HSP 2 Score: 74.7146 bits (182), Expect = 1.976e-13
Identity = 76/234 (32.48%), Postives = 111/234 (47.44%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFV 1250
            N +  + P  F NL  L  L L+ N +  I+   F  L  L  LYL  N + ++    F G++ L+ L + NN +T L  D    L +L   +LS N       V  +    F  ++ L+ L ++  KI+ L    F GL  LE LELQ N +     G+F  +  V +INLS +    L  + F+ L KL SL L    L+ I  + F  +S L+ L L  NNI V+E  +F 
Sbjct:  198 NRLAYLQPQLFQNLVELKELDLTGNHVKVIKANVFVKLTKLQKLYLARNQIVTIVPRAFVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNN------SVTGIRPRTFRDLQYLEELQLSHNKIRVLGERIFDGLGHLEVLELQHNQVQEAQMGSFTGLSHVAVINLSGSCFSSLPDQMFKGLSKLHSLHLDRGCLTRIPAQAFVGLSGLRRLFLQHNNISVVEYRSFA 425          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:101155735])

HSP 1 Score: 74.7146 bits (182), Expect = 2.753e-13
Identity = 76/248 (30.65%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPET---FRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            N + +I P  F  LP+L  L LS NRI  +E  +F  L +L  L +  N +  L    F+GLE +++L + NN +T ++   L  L  LQ   L  N       +G +    +   +KL  L+++   +  L   +F GL+ L+ L +  N ++ I+ G F+ +  +  ++L  N I   + +    F  L  L  L L  N +  ++ + FS +  LQ LDLS N I  I+ +AF  LK+L   RLN
Sbjct:  159 NRLSAITPKIF-QLPSLQHLDLSRNRIRHVEGLTFLGLQSLRFLKMQRNGVVRLMDGAFWGLENVEVLQLDNNNLTVVTKRWLYGLLTLQQLHLGHN------AIGAIEPEAWDFCQKLSQLDLSSNHLTRLEESSFVGLSLLDELHIGNNSISFIADGAFRGLPSLKTLDLKNNEISWTIEDMNGPFSALHNLKRLFLHGNRIRSVTAKSFSGLDALQHLDLSRNAIMAIQVDAFAPLKNLQELRLN 399          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: ENSORLT00000036623.1 (carboxypeptidase N subunit 2-like [Source:NCBI gene;Acc:105353900])

HSP 1 Score: 73.9442 bits (180), Expect = 4.693e-13
Identity = 80/265 (30.19%), Postives = 135/265 (50.94%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQL------SINPN--QHISQ----------VGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSL 1265
            ++++ ++FN +  +    F  L  L  L+L +N+I  IED+ F  L NL  L L  N LTS+  + F  L+KLK+L + +N +T +  D+LK   NL+   L      S+ PN   H ++          +  +P+  F    KLK L +   K+ +L ++ F  +  L  L LQ N+L+ +  G F  ++KV  ++LS+N    L  + F    KL  L+L +N +  +   +F  + +L +L LS+NN++ +  N F  L  L
Sbjct:   43 LETLILKFNKLSGLQNGLFEGLGKLRDLQLHENKIQVIEDQVFQGLDNLEKLSLAKNNLTSVSTDWFSDLKKLKVLRIYDNQLTTIPEDLLKNFPNLEEVGLQGNQITSLPPNLFPHKNKLTKLYLDNNLLTGLPEGYFVGFPKLKVLTLNKNKLNSLPSVLFGEMPKLTELSLQLNNLSTLPTGIFSPLKKVKKLDLSKNHFVTLSADYFLGPEKLTDLNLQHNQIKTLDANLFENLQSLTSLKLSNNNLHALPGNIFEPLVKL 307          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: tlr21 (toll-like receptor 13 [Source:NCBI gene;Acc:101155055])

HSP 1 Score: 62.3882 bits (150), Expect = 1.665e-9
Identity = 69/260 (26.54%), Postives = 112/260 (43.08%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQ-KVTIINLSRNAIRCLLPET------FRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLN 1283
            +  +S  +N I S+  N F   PN+  L+L+ N I F++  +                          GL++L+ L + NN +T+L  D       L+   L  N      +V  + +  F+ +KKL  L++   KI +  A  F GLT L +L L GN+L  I    +   Q  + +++LSRN IR L  +       F  L  L         L+ +   +F  + +L++L L +N I  I  +AF  L  L    L+
Sbjct:  382 LKKLSYRYNRILSVKANAFHLTPNIKVLQLNINNIAFLDHHALK------------------------GLKQLQELRLDNNLLTDLFKDTFANTCKLKILNLRNN------RVSVIFNGTFYCLKKLTTLDLGGNKITHFQAAGFDGLTKLSKLYLDGNNLKTIKTSFYYAFQDTLKVLDLSRNKIRFLTKDKSSPFMNFSKLTDLKVASQRPYGLTLLPPTLFRGLHSLKSLYLGNNRITHIPCDAFDDLTGLHFLTLD 611          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lrrtm4l1 (leucine-rich repeat transmembrane neuronal protein 4-like [Source:NCBI gene;Acc:101154965])

HSP 1 Score: 62.003 bits (149), Expect = 1.825e-9
Identity = 69/254 (27.17%), Postives = 114/254 (44.88%), Query Frame = 3
Query:  531 DSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCL---LPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRL 1280
              +S+ +N + ++ P  F++L  ++ + L  N+I  I+ ++F  +  L  L L++N +TSL  +TF+G+  L+ L +  N +  L       L+ LQ   L  N       + N+P  VF   + L+ L++   +IK LT  TF GL  L  L L+ N  T I+   F ++  +  + L  N IR +   LP  +                            TLQ LDLS N I  ++   F  L +L +  L
Sbjct:   82 QGLSLRYNELHTLLPYQFAHLSQILWIYLDHNQISAIDSRAFQGVRRLKELILSSNRITSLHNSTFHGIPNLRSLDLSFNKLEILQPGQFHGLRKLQNLHLRSN------GLSNIPIRVFLECRSLEFLDLGYNRIKALTRTTFLGLQRLMELHLEHNQFTRINFFLFPRLANLRSLYLQWNRIRVVNQGLPWIW---------------------------YTLQKLDLSGNEIQTLDPAVFHCLPNLQVLNL 302          

HSP 2 Score: 50.8322 bits (120), Expect = 4.354e-6
Identity = 57/223 (25.56%), Postives = 99/223 (44.39%), Query Frame = 3
Query:  552 NNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTM-KIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDN 1217
            N I S+  +TF  +PNL SL LS N++  ++                           F+GL KL+ L + +N ++ +   +    ++L+F  L  N      ++  +    F  +++L  L++   +   +    F  L +L  L LQ N + V++ G       +  ++LS N I+ L P  F  LP L  L+L  N LS +S E  S   +L ++ L+ N
Sbjct:  137 NRITSLHNSTFHGIPNLRSLDLSFNKLEILQP------------------------GQFHGLRKLQNLHLRSNGLSNIPIRVFLECRSLEFLDLGYN------RIKALTRTTFLGLQRLMELHLEHNQFTRINFFLFPRLANLRSLYLQWNRIRVVNQGLPWIWYTLQKLDLSGNEIQTLDPAVFHCLPNLQVLNLESNKLSNVSQEAVSAWISLTSISLAGN 329          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000047911.1 (SMESG000047911.1)

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 598/599 (99.83%), Postives = 599/599 (100.00%), Query Frame = 3
Query:  135 MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCSERFLNLMIRETGIEAFFNPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV 1931
            MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCS+RFLNLMIRETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV
Sbjct:    1 MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCSDRFLNLMIRETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV 599          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000045664.1 (SMESG000045664.1)

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 598/599 (99.83%), Postives = 599/599 (100.00%), Query Frame = 3
Query:  135 MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCSERFLNLMIRETGIEAFFNPFYGLNSIINIYIEXXXXXXXXXXXXXXXXXXXIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKXXXXXXXXXXXXXXXXEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV 1931
            MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCS+RFLNLMIRETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV
Sbjct:    1 MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVRLCCQPDMNTLLITGYDVKNISIDIRNSSCSDRFLNLMIRETGIEAFFNPFYGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYGLEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQQVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDEVFSEISTLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKASSLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVAQASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNGLTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVILDKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGV 599          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.166e-6
Identity = 52/172 (30.23%), Postives = 74/172 (43.02%), Query Frame = 3
Query:  528 IDSISVEFNNIRSIDPNTFSNLPNLVSLKLSDNRIGFIEDKSFDXXXXXXXXXXXXXXXXXXKVNTFYGLEKLKILSMLNNFI----TELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDNVFFAVKKLKHLNMTMKIKNLTALT--FYGLTDLERLELQGNHLTVISPG 1025
            +  I +E  N+  ID     NLPNLV+L L+ N+I  +                          N F  + +L  L +  N I      + +  L  LK L    LS NP      +G VPD  F  +K+L+ LN++   K     T   YGLT+L+ L+L  NH T +S G
Sbjct:   65 VAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSP------------------------NAFTHVPQLISLRLSGNQIYLGENSMPSSSLIYLKKLHTLDLSENP------LGFVPDYYFQLLKQLRILNLSTANKGFYIETNGLYGLTNLQVLDLTNNHFTTLSEG 206          
The following BLAST results are available for this feature:
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IGFALS9.205e-1327.33insulin like growth factor binding protein acid la... [more]
IGFALS1.137e-1227.33insulin like growth factor binding protein acid la... [more]
LRIG32.029e-1232.26leucine rich repeats and immunoglobulin like domai... [more]
LRIG32.297e-1232.26leucine rich repeats and immunoglobulin like domai... [more]
LRIG33.167e-1232.26leucine rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egg-62.575e-825.00Leucine-rich repeat-containing protein egg-6 [Sou... [more]
lron-14.724e-832.64ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
let-41.264e-626.10Leucine-rich repeat-containing protein let-4 [Sou... [more]
lron-94.981e-630.77ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-95.198e-630.77ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG78964.652e-1226.61gene:FBgn0039728 transcript:FBtr0085545[more]
CG423464.770e-1231.87gene:FBgn0259677 transcript:FBtr0333178[more]
CG423464.770e-1231.87gene:FBgn0259677 transcript:FBtr0333177[more]
atk1.953e-1030.58gene:FBgn0036995 transcript:FBtr0331569[more]
atk1.953e-1030.58gene:FBgn0036995 transcript:FBtr0331570[more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1j5.41.196e-1434.85si:dkey-1j5.4 [Source:ZFIN;Acc:ZDB-GENE-130603-91][more]
igfals1.453e-1328.97insulin-like growth factor binding protein, acid l... [more]
igfals1.453e-1328.97insulin-like growth factor binding protein, acid l... [more]
lrig31.158e-1231.85leucine-rich repeats and immunoglobulin-like domai... [more]
lgr41.870e-1127.64Danio rerio leucine-rich repeat containing G prote... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IGFALS4.121e-1430.54insulin like growth factor binding protein acid la... [more]
TRIL1.085e-1229.88TLR4 interactor with leucine-rich repeats [Source:... [more]
LRIG21.437e-1230.54leucine-rich repeats and immunoglobulin like domai... [more]
LRIG22.022e-1230.54leucine-rich repeats and immunoglobulin like domai... [more]
LRIG23.212e-1230.54leucine-rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc156.463e-1428.72leucine rich repeat containing 15 [Source:MGI Symb... [more]
Tril2.181e-1327.32TLR4 interactor with leucine-rich repeats [Source:... [more]
Igfals7.487e-1330.77insulin-like growth factor binding protein, acid l... [more]
Lrig23.298e-1232.52leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig23.480e-1232.52leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q496Z2|TRIL_RAT5.627e-1427.35TLR4 interactor with leucine rich repeats OS=Rattu... [more]
sp|Q8R5M3|LRC15_RAT7.424e-1429.15Leucine-rich repeat-containing protein 15 OS=Rattu... [more]
sp|Q80X72|LRC15_MOUSE4.521e-1328.72Leucine-rich repeat-containing protein 15 OS=Mus m... [more]
sp|P35859|ALS_RAT6.750e-1331.80Insulin-like growth factor-binding protein complex... [more]
sp|Q9DBY4|TRIL_MOUSE2.113e-1227.32TLR4 interactor with leucine rich repeats OS=Mus m... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A165FWW91.661e-16898.14IGFALS-like protein (Fragment) OS=Schmidtea medite... [more]
A0A068WHU42.299e-2426.80Leucine rich repeat containing protein 15 OS=Echin... [more]
W6UKB04.152e-2426.80Platelet glycoprotein V OS=Echinococcus granulosus... [more]
A0A0R3TWY81.185e-2327.73Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3VUR51.971e-2326.43Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfals6.531e-1529.37insulin like growth factor binding protein acid la... [more]
ENSAMXT00000025596.25.797e-1329.14pep primary_assembly:Astyanax_mexicanus-2.0:1:1654... [more]
lrig32.278e-1133.06leucine rich repeats and immunoglobulin like domai... [more]
rtn4rl2b4.983e-1130.48reticulon-4 receptor-like 2 [Source:NCBI gene;Acc:... [more]
lrrc4ba7.463e-1125.31leucine-rich repeat-containing protein 4B-like [So... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig31.596e-1433.06leucine-rich repeats and immunoglobulin-like domai... [more]
ENSPMAT00000010345.11.783e-1429.08pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
lrig32.174e-1334.25leucine-rich repeats and immunoglobulin-like domai... [more]
LRRTM41.012e-1026.29leucine rich repeat transmembrane neuronal 4 [Sour... [more]
tlr214.311e-928.97toll-like receptor 21 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO491362.307e-630.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481794.236e-628.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfals2.576e-1428.46insulin like growth factor binding protein acid la... [more]
lrig32.753e-1330.65leucine rich repeats and immunoglobulin like domai... [more]
ENSORLT00000036623.14.693e-1330.19carboxypeptidase N subunit 2-like [Source:NCBI gen... [more]
tlr211.665e-926.54toll-like receptor 13 [Source:NCBI gene;Acc:101155... [more]
lrrtm4l11.825e-927.17leucine-rich repeat transmembrane neuronal protein... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000047911.10.000e+099.83SMESG000047911.1[more]
SMESG000045664.10.000e+099.83SMESG000045664.1[more]
SMESG000006317.11.166e-630.23SMESG000006317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010360 ID=SMED30010360|Name=Leucine Rich repeat-containing domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2491bp
CAGCTTTAAACAACAAACAAAAATGCATGCATCCAGTTGGCGTAGTCATT
TTAAATCTTGTCATTCAATATTGAAATTATTGTAAAAATTGTTTAAATTG
GGACCGAATTCGATTTGCTTTGTCAATCAAAATTATGGTTATTGCAATCT
TTCCAATTTTAATTAATATTTTCTTTATATCCAACATTGGAACAATACCG
ATTAATAATGAAGCAAACTGTTCTATATCAAAATTGGGATGTAATTGTCA
GAACATAGAAATTATTACTGAAGATTCCGTAAGATTGTGCTGCCAACCAG
ATATGAATACGTTACTAATTACTGGTTATGATGTCAAAAATATTTCAATT
GATATTAGGAATTCTTCATGTTCTGAAAGATTTCTAAATTTAATGATTCG
AGAAACAGGAATTGAAGCGTTTTTTAATCCATTCTATGGGCTCAATAGTA
TCATTAATATATATATCGAGAAAAATCAAAATTTTAGTAATTTCAATAAA
TTTAGATTTTCCAATATAAATTCGAAGATTGATTCCATTTCAGTGGAATT
TAATAATATTAGATCTATTGATCCTAATACTTTTTCCAATTTACCAAATT
TGGTAAGTCTCAAGTTATCAGACAATAGAATTGGATTTATTGAAGATAAG
AGTTTCGACAATCTACCAAATCTGAGCTCGTTGTATTTAAATAATAATAT
TTTAACTTCACTAAAAGTCAATACGTTTTACGGATTAGAAAAACTAAAAA
TTTTAAGTATGCTCAACAATTTTATTACTGAATTGTCAACTGATATTCTC
AAGCCATTAAAAAATCTTCAATTTTTTCAATTGTCTATTAATCCCAATCA
ACATATATCTCAAGTAGGGAATGTTCCAGATAATGTATTTTTTGCTGTTA
AAAAGCTTAAGCATCTGAATATGACAATGAAAATAAAAAATCTTACAGCT
TTGACATTTTACGGACTTACTGATTTAGAAAGATTAGAATTACAAGGGAA
CCACCTTACAGTAATTTCACCCGGGACATTTCAACAGGTGCAGAAAGTAA
CTATTATAAATTTATCTAGGAATGCAATTCGATGCTTGTTGCCAGAAACT
TTTCGAAATCTTCCAAAATTATTGTCTTTAGACCTAAGTTATAATGATCT
CAGTTATATATCTGATGAAGTGTTTTCAGAAATATCAACTCTACAAACCT
TAGATTTGTCTGACAACAACATTTATGTTATAGAAAGAAATGCATTTGTT
GGTCTCAAGTCGTTGCTTTTGTTCAGATTGAATATAGTTTATGGTAGAGC
AAAAAATGAATTGCAGAATAATTTTAAAGCAAGTTCCTTGGCTAAATTAC
GGAAAAACACAAAAATAAAGGGATTACTAGATTACTTAGGTATAACAATG
GGATATGGTGAGCCACCAGATGTAGATAATTCCAAAAAATATGTTAAAGA
TCAAGATTGGAAAAATAGTTATTGCCCAGTTGCACAAGCTAGTGATAAAT
ACTGGGAAGATTCATCTCAAGCTGGTTCACGTAAGTATCTTTTAATTATT
GTGGGAATATGTGTTGTATTTCTGTTGATTGCATTTGCCATTATTATGTC
ATATCGAGCATGGAGTAAACGGAAAATGAATGGTTTGACTTTTGATGTGG
ACAATCACGAAAAACAGGAAATGCTTTTAAATAAACCAAGTGCACACAAT
GGCCGAGTTGATAATCAACATCATTCGAAGTCAAATTCTACAAGGAAATC
ATTAAATGGTACTTATGTAGCTGACGTAATACTGGATAAAAACGACGCTA
AGACAGACTGTTCAACTGCAAATCAGACGCAACAGTCTAACATAGAGGCA
TCAGTAAATCCAGCAACTTGCCCTTTATCTAATGAGCGTAATCAAAGCGA
TGATGAATCAGCGTTAACCCCTCTGGGAGTGTTGTAGATAGATATATTAA
TAGACTAATTCGTTAATCGACAGTTTGAGATTGAAAACAACAGTATAAAT
AACAGACGATGACGATCTCGCTTGCCCGCTGCACACATGCAAACAAGCAA
GCATACCTGAATTTGTGACTTTTACTCACCGTAACAATGCTGGCTAACTT
TCTGTTCCTACTCATGTGTGCGTATGATTGACACGTGAGAGGTAGTGATA
CAATAATTATTGCTTGTATTTATCTCTCTCAGACTACCACACACACACAT
GCATATTGATAAGATCGTTTGTTTTAACCTTTAAACAATGTAACTATTAT
TATGTACTTATCATGTTTCAATTTTAAGATTTTAATTTATGATTTTCGTT
TGTGTTGCATTTATAAAAATGAATCATATGTATCGTTGAATTTTTGACTC
AAATTATTATTATTAATGCATCTTTTTGTTAGTTGTGTATTATAGTCTTT
ATTTTGAACTCTGACAATCATTCTTGTAAATAGAAAGTTTTTATATTTTA
TTTTAAAACCAAAATCCGGTTATGCAGTCAGATCGGAAGAG
back to top

protein sequence of SMED30010360-orf-1

>SMED30010360-orf-1 ID=SMED30010360-orf-1|Name=SMED30010360-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MVIAIFPILINIFFISNIGTIPINNEANCSISKLGCNCQNIEIITEDSVR
LCCQPDMNTLLITGYDVKNISIDIRNSSCSERFLNLMIRETGIEAFFNPF
YGLNSIINIYIEKNQNFSNFNKFRFSNINSKIDSISVEFNNIRSIDPNTF
SNLPNLVSLKLSDNRIGFIEDKSFDNLPNLSSLYLNNNILTSLKVNTFYG
LEKLKILSMLNNFITELSTDILKPLKNLQFFQLSINPNQHISQVGNVPDN
VFFAVKKLKHLNMTMKIKNLTALTFYGLTDLERLELQGNHLTVISPGTFQ
QVQKVTIINLSRNAIRCLLPETFRNLPKLLSLDLSYNDLSYISDEVFSEI
STLQTLDLSDNNIYVIERNAFVGLKSLLLFRLNIVYGRAKNELQNNFKAS
SLAKLRKNTKIKGLLDYLGITMGYGEPPDVDNSKKYVKDQDWKNSYCPVA
QASDKYWEDSSQAGSRKYLLIIVGICVVFLLIAFAIIMSYRAWSKRKMNG
LTFDVDNHEKQEMLLNKPSAHNGRVDNQHHSKSNSTRKSLNGTYVADVIL
DKNDAKTDCSTANQTQQSNIEASVNPATCPLSNERNQSDDESALTPLGVL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 326..349
e-value: 0.019
score: 24.1
coord: 302..325
e-value: 12.0
score: 12.5
coord: 201..224
e-value: 32.0
score: 9.1
coord: 130..152
e-value: 300.0
score: 1.1
coord: 278..301
e-value: 0.0017
score: 27.6
coord: 350..373
e-value: 4.7
score: 16.0
coord: 177..200
e-value: 0.046
score: 22.8
coord: 153..176
e-value: 0.17
score: 20.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 242..414
e-value: 5.8E-30
score: 106.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 24..241
e-value: 3.9E-24
score: 87.1
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 281..339
e-value: 1.9E-16
score: 59.5
coord: 132..188
e-value: 4.6E-14
score: 51.9
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 227..248
score: 4.616
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 280..301
score: 6.796
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 131..152
score: 5.178
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 179..200
score: 6.78
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 155..176
score: 7.034
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 352..373
score: 7.543
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 328..349
score: 7.296
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 304..325
score: 4.971
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 203..224
score: 5.979
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 581..600
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 518..537
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 245..447
coord: 99..236
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.609
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 98..381
NoneNo IPR availableTMHMMTMhelixcoord: 468..490