FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30010353
Length (bp)1576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30010353) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30010353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30010353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30010353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010353SMESG000078360.1 SmedASXL_003453SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010353SMESG000078360.1 SmedASXL_003454SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010353SMESG000078360.1 SmedASXL_000160SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010353SMESG000078360.1 dd_Smed_v6_28097_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: G7Y609 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_101553 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.008e-78
Identity = 75/152 (49.34%), Postives = 106/152 (69.74%), Query Frame = 3
Query:  252 RVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHN-YIYSEHACQLTTIQ 704
            +V+Y+ GSK  +  C  +GHW +  HA Y+NC+S  +  + R+H++++ +++YLD       C DCF  E+KSQLSGA+VVVH +DTYPDINQE +N+QPG+LTE  +K I +  K PPYGRCS  T   I+L+    Y YSEHAC+++TIQ
Sbjct:   11 KVLYSEGSKRVLNDCHQVGHWRRFVHAQYLNCYSYDLLEKFRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQ 162          

HSP 2 Score: 158.688 bits (400), Expect = 1.008e-78
Identity = 102/218 (46.79%), Postives = 141/218 (64.68%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDC----ISSKTKKVLNNKT-------CDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNE-GHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIH 1324
            +IND C CNAIE+P  N SLPFC A+ SF+    C    + +   K  N+ T       C  E+  V N++ CK+++T  +  DVV  CTLPC F+SY +DRSTSTWPTKS+QL  + +   R + ++ +  PY +  ++  +   +  A  +L + N+LE+NLL IMI RPN  +H VEEKEVLSLTS LSQTGGL SI+IG++I+SV+E  ELL+H
Sbjct:  164 QINDRCGCNAIEFPYRNSSLPFCLAMGSFVHEGSCDVQKLQADGSKATNSTTIGSLKSQCLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWLGTRAGRMILDRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVH 381          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2L707 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.754e-77
Identity = 74/153 (48.37%), Postives = 106/153 (69.28%), Query Frame = 3
Query:  249 ERVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHN-YIYSEHACQLTTIQ 704
            ++V+Y+ GSK  +  C  +G W +  HA Y+NC+S  +  + R+H++++ +++YLD       C DCF  E+KSQLSGA+VVVH +DTYPDINQE +N+QPG+LTE  +K I +  K PPYGRCS  T   I+L+    Y YSEHAC+++TIQ
Sbjct:   24 KKVLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQ 176          

HSP 2 Score: 157.532 bits (397), Expect = 1.754e-77
Identity = 102/218 (46.79%), Postives = 141/218 (64.68%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDC----ISSKTKKVLNN-------KTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGH-ETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIH 1324
            +IND C CNAIE+P  + SLPFC A+ SF+    C    +     KV N+         C  E+  V N++ CK+++T  +  DVV  CTLPC F+SY +DRSTSTWPTKS+QL  + +   R + N+ +  PY +  ++  + + +  A  +L + N+LE+NLL IMI RPN  +H VEEKEVLSLTS LSQTGGL SI+IG++I+SV+E  ELL+H
Sbjct:  178 QINDRCGCNAIEFPYRSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWLGTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVH 395          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4V3SD10 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.486e-77
Identity = 74/151 (49.01%), Postives = 104/151 (68.87%), Query Frame = 3
Query:  255 VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHN-YIYSEHACQLTTIQ 704
            V+Y+ GSK  +  C  +G W +  HA Y+NC+S  +  + R+H++++ +++YLD       C DCF  E+KSQLSGA+VVVH +DTYPDINQE +N+QPG+LTE  +K I +  K PPYGRCS  T   I+L+    Y YSEHAC+++TIQ
Sbjct:  197 VLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQ 347          

HSP 2 Score: 157.532 bits (397), Expect = 3.486e-77
Identity = 102/218 (46.79%), Postives = 141/218 (64.68%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDC----ISSKTKKVLNN-------KTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGH-ETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIH 1324
            +IND C CNAIE+P  + SLPFC A+ SF+    C    +     KV N+         C  E+  V N++ CK+++T  +  DVV  CTLPC F+SY +DRSTSTWPTKS+QL  + +   R + N+ +  PY +  ++  + + +  A  +L + N+LE+NLL IMI RPN  +H VEEKEVLSLTS LSQTGGL SI+IG++I+SV+E  ELL+H
Sbjct:  349 QINDRCGCNAIEFPYRSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWLGTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVH 566          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3W5S0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5486 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.291e-75
Identity = 77/153 (50.33%), Postives = 101/153 (66.01%), Query Frame = 3
Query:  255 VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLH-NHNYIYSEHACQLTTIQGK 710
            V+Y  GS   I+ C  +G W    HALY+NCHS  I P +   + ++ ++ YL+E      C DCF  E+KSQLSGA+VVVHT+ TYPD+NQE +NLQPGTLTE  +K I N  K PPYGRC++ T T I  H N +Y YSE+ C++ TIQ +
Sbjct:  173 VLYLEGSSRIIEPCEKVGRWRHFFHALYLNCHSFDIDPGISQRVLTIELFSYLNERHDEVECHDCFASEIKSQLSGAVVVVHTASTYPDVNQEGINLQPGTLTEIKIKAIENIQKEPPYGRCARDTPTEIPGHDNLSYAYSEYGCRMYTIQAE 325          

HSP 2 Score: 154.066 bits (388), Expect = 1.291e-75
Identity = 106/266 (39.85%), Postives = 154/266 (57.89%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNK----------TCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNE------GHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQ 1456
            EIN  C CNAIE+PI N SLPFC ++  F+    C+  K  K    +          TC+ ++    + + CK  +  +++ DVV  CTLPC+FYSY +DRSTS WPTKS+QL  ++++  R +    +   Y + + + ++        + E L +LE+ N +ERNLL I++ RPN  +H V EKEV SLTS+LSQTGGL SI+IGL++I VVE LEL+I+CV  FK        K RN  +NE+     +  +   + G  + Q
Sbjct:  325 EINKNCNCNAIEFPIINGSLPFCMSMVDFVKKNRCVYEKMVKQAGMRNSTGPSEEFLTCEAQLNMARDRILCKALVMQEFQGDVVPTCTLPCAFYSYETDRSTSMWPTKSWQLTWLSTDVGRTILEMPEMAEYRRAVEMLSQPDGDTGASKREVLRILEQNNAVERNLLAIIVVRPNFNLHKVAEKEVFSLTSFLSQTGGLLSIWIGLTMICVVEVLELIINCVFVFKA-------KKRNRELNESESPRANPKHKGSRRGSEKVQ 583          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A564Y5L5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2931 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.473e-75
Identity = 119/262 (45.42%), Postives = 164/262 (62.60%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLN--NKT--------CDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKAR---ELRNKEDFKPYLKLINISNEGHET---EALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGK 1444
            EIN  C CNAIE+PI N  LPFC ++  F+    C   +  K +   N T        C+ ++      L CK+ +T +Y+ DVV  CTLPCSFYSY +DRSTSTWPTKS+QL  +N+   R   ++    +++  L+L+N S++ ++T   E L +LE+ N LERNLL I + RPN  +H V EKEVLSLTS+LSQTGGL SI+IGL++I VVE LEL+I+C   F   RR+  Q+HR S+   A+ ++ +     PKN K
Sbjct:  325 EINKKCNCNAIEFPIVNGDLPFCMSMVDFVKEDMCNHEQMVKSVQMPNSTEPSNEFLVCEQQLNTAREKLICKSQVTGEYQGDVVPACTLPCSFYSYETDRSTSTWPTKSWQLAWLNTSIGRTVLQMSEMSEYRRALELLNQSSDVNKTTTREILRILEQNNALERNLLAITVVRPNWNLHKVAEKEVLSLTSFLSQTGGLLSIWIGLTMICVVEILELIINCCYVFMFKRRE-NQEHRISSKELASPQIQT---PPPKNSK 582          

HSP 2 Score: 147.902 bits (372), Expect = 2.473e-75
Identity = 68/151 (45.03%), Postives = 99/151 (65.56%), Query Frame = 3
Query:  261 YNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHN-HNYIYSEHACQLTTIQGK 710
            +  GS      C  +G W +  HALY+NCH+L + P + +   S+ ++ YL+E     +C DCF  ++KSQLSGA++VVH++ TYP+IN+E +N+QPGTLTE   K I N  K PPYGRC + T+T I  H+  +Y YSE+ C++ TIQ +
Sbjct:  175 FQEGSSIIADYCERVGRWRRILHALYLNCHTLDVDPNISHRAVSLELFSYLNERHDEVICHDCFAADIKSQLSGAVIVVHSAQTYPEINKEGINVQPGTLTEIKFKAIENIQKEPPYGRCDRDTKTEIPSHDGASYAYSEYGCRMYTIQDE 325          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000078360.1 (SMESG000078360.1)

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 288/288 (100.00%), Postives = 288/288 (100.00%), Query Frame = 2
Query:  704 REINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQLTIRKNTLELFQSKYYDLNLSPQPSQSSDLWILQSHI 1567
            REINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNKVHVVEEKEVLSLTSYLSQTGGLFSIFIGLSIISVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQLTIRKNTLELFQSKYYDLNLSPQPSQSSDLWILQSHI
Sbjct:  387 REINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNKVHVVEEKEVLSLTSYLSQTGGLFSIFIGLSIISVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQLTIRKNTLELFQSKYYDLNLSPQPSQSSDLWILQSHI 674          

HSP 2 Score: 316.235 bits (809), Expect = 0.000e+0
Identity = 150/150 (100.00%), Postives = 150/150 (100.00%), Query Frame = 3
Query:  255 VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ 704
            VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ
Sbjct:  237 VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ 386          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000069611.1 (SMESG000069611.1)

HSP 1 Score: 173.711 bits (439), Expect = 2.542e-81
Identity = 115/233 (49.36%), Postives = 157/233 (67.38%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRRKCAQKHRNSAVNEATEK 1405
            EIN+ C CNAIEYP+ N +L FCSALP+FI    C ++   K    + C  EI      L CK+++T+ Y +D++  C LPC +YSY SDRS STWPTKS+QL  +NS +   +R+K++ KPY        EG E +A+E+L K +ILE  L+ ++INRPN  +H VEEKEVLSLTS+LSQ GGLFSI+IGL++IS+VE +ELL+   E  KV  R C +  R S +N +T++
Sbjct:  362 EINNKCHCNAIEYPVVNRNLSFCSALPTFIKFGSCETNSHDK--EQEKCFEEIKTSLKRLECKSSVTVLYHNDIIDTCFLPCEYYSYESDRSISTWPTKSWQLTWLNSSRGSNVRSKKELKPYKIAAEYFKEGKEDKAIEILNKQDILESKLIAVVINRPNKNLHRVEEKEVLSLTSFLSQLGGLFSIWIGLTLISIVEIIELLMRISE--KVLDR-CCKSRRLSLINVSTQE 589          

HSP 2 Score: 148.673 bits (374), Expect = 2.542e-81
Identity = 68/150 (45.33%), Postives = 97/150 (64.67%), Query Frame = 3
Query:  255 VIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ 704
            + +  GSK  +  C ++G W  T HA +INC S  I  E    + ++ +Y+YL+E    + C DCF+  +KSQLSGAL+V+H S+++P+INQEA+NLQPGTLTE  LK   N  K  PYGRC   T +++++ N  Y Y+EH C+  TIQ
Sbjct:  211 ITFRNGSKHHVDLCQNIGQWKVTPHAQFINCFSYNIKAEFIEEVTTIELYLYLNEETNVSRCIDCFISNVKSQLSGALLVIHKSNSFPNINQEAINLQPGTLTEVRLKTFFNVMKTAPYGRCKPNTPSNLEMGNETYSYTEHLCKEKTIQ 360          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000028687.1 (SMESG000028687.1)

HSP 1 Score: 161.77 bits (408), Expect = 5.323e-81
Identity = 106/232 (45.69%), Postives = 150/232 (64.66%), Query Frame = 2
Query:  707 EINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFK---VTRRKCAQKHRNSAVNE 1393
            ++N  C CNAIEYP    SL FCSALPSF     C        LN++ C+ E+      + CK    + Y +D+V  C LPCSFYSY +DRSTSTWPTKS+QL  I+++ A+ L +K++   Y   + +  +G+ +EAL++L K N +E+ +L +MINRPN  VH+VEEKEVLSLTS+LSQ GGLFSI+IG+++ S+VE  E+  +C   F+   V       K++ S++NE
Sbjct:  353 DLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSC-----NNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCFWRFRKMFVKNGFTNDKNQASSLNE 579          

HSP 2 Score: 159.844 bits (403), Expect = 5.323e-81
Identity = 73/152 (48.03%), Postives = 99/152 (65.13%), Query Frame = 3
Query:  252 RVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQG 707
            RV Y +GSK   + C  LG W +  HA Y+NC+   +   L N   ++ M++YLDE +    C DCF  ++KSQLSGAL+++H S+T+P+ N++ +NLQPGTLTE  LK I N++K PPYGRCS  T   IK+    Y YSE  C+L TIQG
Sbjct:  201 RVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQG 352          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045054.1 (SMESG000045054.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.426e-65
Identity = 106/257 (41.25%), Postives = 151/257 (58.75%), Query Frame = 2
Query:  695 DHSREINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARE--LRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRR-KCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQ 1456
            D  RE    C+C AIEYP     LPFC    +FI+  +C SS +K    N TC   +  +  N+ CK  IT +Y  D +  CT+PCSF SY SDRSTS WP KSFQ+ LI+    +E  + +K +F+PY K+  +  +G   EA ++L+  N+LERNL+ +++ +PN  +H VEEK VLSLTS+LSQ GGL SI+IGL++IS+VE  EL++         R+ K   K++ +     T    +    +P N K+ N 
Sbjct:  372 DFERE----CKCVAIEYPYNTSRLPFCGQGSAFINKNEC-SSPSKS--ENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQTWTYDFLNPHCVNPSNSKSSND 621          

HSP 2 Score: 127.872 bits (320), Expect = 1.426e-65
Identity = 58/151 (38.41%), Postives = 91/151 (60.26%), Query Frame = 3
Query:  252 RVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ 704
            ++ Y  GSK     C  +G WT   HA YINC++  +  + R   K++ +Y+YL+E +    C DC   ++KSQ+SGA++ +   +T+ +IN++ ++L PGTLTE  LK   N    PPYGRCS+ T   +K+ +  ++YSE  C+  TIQ
Sbjct:  220 QITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQ 370          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 166.007 bits (419), Expect = 2.180e-44
Identity = 120/278 (43.17%), Postives = 165/278 (59.35%), Query Frame = 2
Query:  551 GNAN*I*LEVYTKQKQSPPLW-------KMFKIYRNSY*IA*S*LYLFGAC--LSINDHSREINDICRCNAIEYPIFNLSLPFCSALPSFISHKDCISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNXXXXXXXXXXLSLTSYLSQTXXXXXXXXXXXXXXVVEFLELLIHCVEAFKVTRRK 1357
            G    I L+++    + PP         K  KIY + Y       Y   AC  L+I     +IN  C CNAIEYPI N +L FCS LP FI  K C   ++     +  C  ++  V   + CK+N++ +Y+ D+V  C+LPC  YSY SDRSTS+WPTK++Q+  I S  AR LR K + K Y+        G   ++  +L + NILE+NLL +MINRPN  VH+VEEKEVLSLTS+LSQ GGL SI+IGL++IS+VE +E+L++C    K  R++
Sbjct:  277 GTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLY------SYSEHACKLLTI---QHDINKQCGCNAIEYPIDNFNLSFCSNLPRFIEGKLCHDDQS-----DMKCKHQLDAVVKKIICKSNVSSQYQKDIVKSCSLPCDIYSYESDRSTSSWPTKTWQMPWIKSNAARRLRKKPELKGYIDAYREYLNGSVNKSFRILNQQNILEQNLLAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLCSIWIGLTMISIVEVIEMLLNCFSQLKTARKR 540          

HSP 2 Score: 146.362 bits (368), Expect = 1.584e-37
Identity = 69/151 (45.70%), Postives = 96/151 (63.58%), Query Frame = 3
Query:  252 RVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQ 704
            +V Y  GS    + C  +G W    HA YINC+S  +Y     +  ++ +Y YLD+ +  ++C DCF  ++KSQLSGALV++H   T+P+ N + +NLQPGTLTE  LK   N +K PPYGRCS  +   +K++N  Y YSEHAC+L TIQ
Sbjct:  177 QVTYMNGSSPHYKVCSDIGKWRVIIHAQYINCYSYNLYENYSRNTNTMELYFYLDQGIPDSMCLDCFSSDVKSQLSGALVLIHRRLTFPNFNHDIINLQPGTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLYSYSEHACKLLTIQ 327          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y6091.008e-7849.34FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4S2L7071.754e-7748.37Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SD103.486e-7749.01Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0R3W5S01.291e-7550.33Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A564Y5L52.473e-7545.42Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078360.10.000e+0100.00SMESG000078360.1[more]
SMESG000069611.12.542e-8149.36SMESG000069611.1[more]
SMESG000028687.15.323e-8145.69SMESG000028687.1[more]
SMESG000045054.11.426e-6541.25SMESG000045054.1[more]
SMESG000044381.12.180e-4443.17SMESG000044381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010353 ID=SMED30010353|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1576bp
ATTTAATGTTTCTTTTCACATAGTATTCCTTAAATAATATTTTCCAAGAT
TTGAAATTGCAAACGGTCATTCTCCTTTCGATACTATAAGTTTTTTAGAT
TCTACTTTTCTCTTCGCATAATTAAGTGGTCGCAGAATACAGATTAAAAT
ACCCAAATTTTTTTAACAGTTTCATCATTTTCCCAAAGCGAACTTGCAAA
AACTATATGTGAACCCCTTAATCGAAAGAATATTACTTCAACCCCATTGA
ACGTGTTATCTATAATGTTGGAAGCAAAAGTGAAATTCAAAAGTGCGGTA
GTTTAGGGCATTGGACGAAAACTACTCATGCTCTTTACATAAACTGTCAC
AGTCTTACAATTTATCCAGAACTGAGAAATCATATAAAATCCGTAATCAT
GTATATTTATTTAGATGAAATCTTAAAAACGAATTTATGTGCTGACTGTT
TCATGCAAGAATTAAAGTCCCAGCTATCTGGAGCATTGGTAGTTGTCCAT
ACATCTGATACATACCCTGACATCAATCAAGAAGCAGTTAATTTGCAACC
GGGAACGCTAACTGAATTTAACTTGAAGTTTATACTAAACAAAAACAAAG
CCCCCCCTTATGGAAGATGTTCAAAATATACAGAAACTCATATTAAATTG
CATAATCATAATTATATTTATTCGGAGCATGCTTGTCAATTAACGACCAT
TCAAGGGAAATAAATGATATTTGCAGATGCAATGCTATTGAATATCCTAT
TTTTAATTTGTCTTTGCCATTTTGCAGTGCGTTACCGAGTTTTATATCGC
ATAAAGACTGCATCTCTTCAAAAACCAAAAAAGTCCTTAACAATAAAACA
TGTGACATGGAGATTCTGAAGGTTTTCAATAATTTAGGGTGTAAAAATAA
CATAACCATAAAATATAGAAGTGACGTTGTAGCAAAATGTACACTTCCTT
GCTCTTTTTATTCCTATGCCTCTGATAGGTCAACTAGTACATGGCCAACA
AAAAGCTTTCAATTAAATTTAATAAATTCAGAAAAAGCGAGAGAATTAAG
GAATAAAGAGGATTTTAAACCGTATTTGAAACTCATAAATATATCTAATG
AAGGCCATGAAACTGAGGCTTTAGAAATGCTTGAAAAATTAAATATTTTA
GAAAGAAACCTTCTTGGAATTATGATAAACAGACCAAATAATAAAGTCCA
TGTTGTTGAAGAAAAAGAAGTATTATCATTGACAAGTTATTTAAGTCAAA
CTGGGGGACTTTTTAGCATTTTTATAGGATTATCCATTATAAGCGTTGTT
GAATTTCTTGAACTTTTAATTCACTGCGTCGAAGCTTTTAAAGTAACCAG
AAGAAAGTGTGCTCAAAAACATAGAAATTCTGCAGTAAATGAAGCGACGG
AAAAACTAACCTCGGAATGCAATTCATCACCGAAAAACGGGAAAACAGAA
AATCAGTTGACGATTCGAAAGAACACTTTAGAATTGTTTCAATCAAAATA
TTATGATCTTAATCTCTCCCCACAACCCTCACAATCAAGTGATCTGTGGA
TTTTACAGTCACACATCTGAGATCAC
back to top

protein sequence of SMED30010353-orf-1

>SMED30010353-orf-1 ID=SMED30010353-orf-1|Name=SMED30010353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=238bp
MEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKS
FQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILER
NLLGIMINRPNNKVHVVEEKEVLSLTSYLSQTGGLFSIFIGLSIISVVEF
LELLIHCVEAFKVTRRKCAQKHRNSAVNEATEKLTSECNSSPKNGKTENQ
LTIRKNTLELFQSKYYDLNLSPQPSQSSDLWILQSHI*
back to top

protein sequence of SMED30010353-orf-2

>SMED30010353-orf-2 ID=SMED30010353-orf-2|Name=SMED30010353-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQ
PGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTT
IQGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 19..104
e-value: 3.8E-13
score: 49.2
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 29..65
e-value: 9.0E-10
score: 40.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 66..105
e-value: 9.0E-10
score: 40.0