GCR017

Overview
NameGCR017
Smed IDSMED30010349
Length (bp)1604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR017 (SMED30010349) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR017 (SMED30010349) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR017 (SMED30010349) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR017 (SMED30010349) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of GCR017 vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 176.792 bits (447), Expect = 9.143e-49
Identity = 136/393 (34.61%), Postives = 206/393 (52.42%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQ-------------------------KHRIDRIQSKNIISKLA-----------------IRKSKLIRYR-----ERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG+  C ++LA+DVL CT+SI+HLC IS+DRY+SI + I+Y   RTP R+ A+II  W+IS +I  PPL               E +CE+   + YV+ S IGSF+ P LI+I+VY++++  AKRR       + P+    P    ++    +  E +          + ++ ++    +  P+   + + L+ +                         K R  +++  + + +                   +  +K  R+R     E+R   VL VV+G F+VCW PFF +Y +      +   LF FFFW GYCNS LNP+IYT++N DFR+AF++IL
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQ-LNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of GCR017 vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 163.31 bits (412), Expect = 3.418e-44
Identity = 130/377 (34.48%), Postives = 207/377 (54.91%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXX-----XNPELFRKKEVV--------EVDIEYTEIQQNCNCNQV----DSEAISCIVDDDDPSVTNNQE--PLNSQKHRID----RIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--CMNEHLFGFFF-WLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            GN+ V+ AI+ +  L+N+ N+ +GSLA+ DL++ +L+LP +   ++  +W  G++ C L++A+DVL CT+SI+HLC I++DRY++I  PI Y   RTP R  A+I   W+I  LI +PP+ GW          S+   C ++++  Y +YS+ G+FYIPLL+++++Y ++F  A+ R  +     +          +P    KK V          + +E       C    V    D  A+  I   +   V N++E  PL S+           + KN   + A  K K+   RER+T+  LG+++G FI+CWLPFF   L++ FC+  C    L G    WLGY NS LNP+IY  +N+DF+ AF++I+    C
Sbjct:   53 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGW----RTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVI---EVHRVGNSKEHLPLPSEAGPTPCAPASFERKN--ERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC 420          
BLAST of GCR017 vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 151.369 bits (381), Expect = 4.089e-40
Identity = 104/307 (33.88%), Postives = 163/307 (53.09%), Query Frame = 1
Query:  601 IFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVL---YSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            + GRW  G+++C  WL+ D+  CTASI+HLC+I++DRY++I   ++Y   RTP R   MI   W+ S  I LPP F W          + E+  E   N  ++L   YS++G+FY P L++I +Y ++++EA+ R  ++   +  +     +L                    +   ++S         D PS + +   +N  K R         +S   + K KL+  RER+    LG+++GAFIVCWLPFF   L++  CK  C  +  +F FF WLGY NS +NPIIYT+ N DF++AF +++
Sbjct:  111 VTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-W------RQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSP-----------GSTSSVTSINSRV------PDVPSESGSPVYVNQVKVR---------VSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 384          
BLAST of GCR017 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 145.591 bits (366), Expect = 7.663e-38
Identity = 122/364 (33.52%), Postives = 193/364 (53.02%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC-IVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM--NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMI 1548
            GN LV+++++    L ++ ++++ +LA+ADLLL   +LPFS   E+ G W FGR+ C++W A+DVL CTASIM LC+ISIDRY  +  P++Y T  T  R L  ++  W +S +I + PLFGW           +E  C++ +   YVL+S++GSFY+PL II+++Y +V++ AKR                              E   ++     ++ DSE ++  I   + P+  +      ++ H              ++R  K    RE++    LG+VVG F++CWLPFF    I  F      +E +F   FWLGY NS +NPIIY   +++F+KAFQ +L +     K  S+  +
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGW-----RQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKR------------------------------ESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTH-------------FSVRLLKF--SREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of GCR017 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 145.591 bits (366), Expect = 7.937e-38
Identity = 122/364 (33.52%), Postives = 193/364 (53.02%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC-IVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM--NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMI 1548
            GN LV+++++    L ++ ++++ +LA+ADLLL   +LPFS   E+ G W FGR+ C++W A+DVL CTASIM LC+ISIDRY  +  P++Y T  T  R L  ++  W +S +I + PLFGW           +E  C++ +   YVL+S++GSFY+PL II+++Y +V++ AKR                              E   ++     ++ DSE ++  I   + P+  +      ++ H              ++R  K    RE++    LG+VVG F++CWLPFF    I  F      +E +F   FWLGY NS +NPIIY   +++F+KAFQ +L +     K  S+  +
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGW-----RQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKR------------------------------ESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTH-------------FSVRLLKF--SREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHAL 356          
BLAST of GCR017 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 188.734 bits (478), Expect = 3.478e-54
Identity = 142/379 (37.47%), Postives = 220/379 (58.05%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLK-NIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRA-NRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC-------------IVDDDDPSV-------TNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKA-------FQRILSMIM 1515
            GN LV++ +  D +L+   QNW + SLA+AD+L+G+L++P +L  EI G W  G +LC +WLA+DVL  TASI+H+C IS+DRY+S+  P+ Y  +RTP R+   I  +WI+S LICLPP+FGW            E +C ++ +  YVLYSS+GSFYIP++I+IIVY +++    R +  R    ++ +   N    R       ++EY E+++N +  + + E +                + ++ P         TN+  P  S   R  +++ K    K   RK KL + +ER+  ++LG+++ AFI+ WLPFF  Y+I  F       +F FFFWLGYCNSG+NP+IYTV+NR+F++        F+R +  +M
Sbjct:   38 GNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA-------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEY-ELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTR--KLEEKKFCEK---RKRKL-KAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFERFIHPLM 402          
BLAST of GCR017 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 187.578 bits (475), Expect = 7.235e-54
Identity = 142/381 (37.27%), Postives = 220/381 (57.74%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLK-NIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRA-NRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC-------------IVDDDDPSV---------TNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKA-------FQRILSMIM 1515
            GN LV++ +  D +L+   QNW + SLA+AD+L+G+L++P +L  EI G W  G +LC +WLA+DVL  TASI+H+C IS+DRY+S+  P+ Y  +RTP R+   I  +WI+S LICLPP+FGW            E +C ++ +  YVLYSS+GSFYIP++I+IIVY +++    R +  R    ++ +   N    R       ++EY E+++N +  + + E +                + ++ P           TN+  P  S   R  +++ K    K   RK KL + +ER+  ++LG+++ AFI+ WLPFF  Y+I  F       +F FFFWLGYCNSG+NP+IYTV+NR+F++        F+R +  +M
Sbjct:   38 GNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA-------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEY-ELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTR--KLEEKKFCEK---RKRKL-KAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFERFIHPLM 404          
BLAST of GCR017 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 141.354 bits (355), Expect = 1.083e-36
Identity = 116/352 (32.95%), Postives = 191/352 (54.26%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFG-RWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPEL---FRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEH--LFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN+LV++A+ +   LK +QN+FL SLA +DL + I ++P  +   + G +W+ G  +C  +   D+LLCT+SI++LC I++DRY++I  PI Y   RT   V  +I+  WI+S LI +PP+ GW++   N      E  C L+  +A+V++S+ GSF++PLL++++VY+++FI A++R             +N E    +RK  +    +E               E    ++ D   +VT      N     + R            ++ K+   +E+R    + V++  F  CWLPFF +Y+I  FC+    H  +   F WLGY NS LNP +Y + N +FR+AF++IL
Sbjct:   74 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMM----EDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVG------EKTPLVIADGQTTVTTLAAHSNPNPTAVLR------------KREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 403          
BLAST of GCR017 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 134.42 bits (337), Expect = 2.871e-34
Identity = 111/352 (31.53%), Postives = 192/352 (54.55%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFG-RWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPEL---FRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEH--LFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN+LV++A+ +   LK +QN+FL SLA +DL + I ++P  +   + G +W+ G  +C  +   D+LLCT+SI++LC I++DRY++I  PI Y   RT   V  +I+  WI+S LI +PP+ GW++   N      E  C L+  +A+V++S+ GSF++PLL++++VY+++FI A++R             +N E    +RK  +    +E        +   +  +      +       +N      +   +   +     + +  ++ K+   +E+R    + V++  F  CWLPFF +Y+I  FC+    H  +   F WLGY NS LNP +Y + N +FR+AF++IL
Sbjct:   63 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMM----EDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKD------ETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 404          
BLAST of GCR017 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 134.42 bits (337), Expect = 3.103e-34
Identity = 111/352 (31.53%), Postives = 193/352 (54.83%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFG-RWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPEL---FRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEH--LFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN+LV++A+ +   LK +QN+FL SLA +DL + I ++P  +   + G +W+ G  +C  +   D+LLCT+SI++LC I++DRY++I  PI Y   RT   V  +I+  WI+S LI +PP+ GW++   N      E  C L+  +A+V++S+ GSF++PLL++++VY+++FI A++R             +N E    +RK  +    +E        +   +  +  +  +        +N      +   +   +     + +  ++ K+   +E+R    + V++  F  CWLPFF +Y+I  FC+    H  +   F WLGY NS LNP +Y + N +FR+AF++IL
Sbjct:   71 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMM----EDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMK------YHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 412          
BLAST of GCR017 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0100322)

HSP 1 Score: 147.902 bits (372), Expect = 5.754e-39
Identity = 113/350 (32.29%), Postives = 182/350 (52.00%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPL-FGWXXXXX-XXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KCMNEHLF-GFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV++++    +L+ I N+F+ SLA+AD+L+ +  + F+    I G+W+FG ++C +W + DV   TASIMHLC IS+DRYY+IV+P+ Y    T  RV  M++  W+   L+   P+  GW + +     + SN   CE   N+AY + SS  SF+IP ++++ +Y +++ EA R+                 ++R K    +  ++ +I Q               +    PS+   Q  +++ +                         RER+    LG+++ AF++CWLPFF  Y++   C  C+   L  G  FW+GY NS LNPIIY  +NRDFR AF++ L
Sbjct:  124 GNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERL--------------VYRSKVAALLLEKHLQISQ---------------IPKPRPSIQVEQSTISTMR-------------------------RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of GCR017 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0301484)

HSP 1 Score: 147.517 bits (371), Expect = 7.973e-39
Identity = 113/350 (32.29%), Postives = 182/350 (52.00%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPL-FGWXXXXX-XXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KCMNEHLF-GFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV++++    +L+ I N+F+ SLA+AD+L+ +  + F+    I G+W+FG ++C +W + DV   TASIMHLC IS+DRYY+IV+P+ Y    T  RV  M++  W+   L+   P+  GW + +     + SN   CE   N+AY + SS  SF+IP ++++ +Y +++ EA R+                 ++R K    +  ++ +I Q               +    PS+   Q  +++ +                         RER+    LG+++ AF++CWLPFF  Y++   C  C+   L  G  FW+GY NS LNPIIY  +NRDFR AF++ L
Sbjct:  124 GNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERL--------------VYRSKVAALLLEKHLQISQ---------------IPKPRPSIQVEQSTISTMR-------------------------RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of GCR017 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0331930)

HSP 1 Score: 147.517 bits (371), Expect = 3.263e-38
Identity = 113/350 (32.29%), Postives = 182/350 (52.00%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPL-FGWXXXXX-XXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KCMNEHLF-GFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV++++    +L+ I N+F+ SLA+AD+L+ +  + F+    I G+W+FG ++C +W + DV   TASIMHLC IS+DRYY+IV+P+ Y    T  RV  M++  W+   L+   P+  GW + +     + SN   CE   N+AY + SS  SF+IP ++++ +Y +++ EA R+                 ++R K    +  ++ +I Q               +    PS+   Q  +++ +                         RER+    LG+++ AF++CWLPFF  Y++   C  C+   L  G  FW+GY NS LNPIIY  +NRDFR AF++ L
Sbjct:  124 GNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERL--------------VYRSKVAALLLEKHLQISQ---------------IPKPRPSIQVEQSTISTMR-------------------------RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of GCR017 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0084260)

HSP 1 Score: 147.517 bits (371), Expect = 3.263e-38
Identity = 113/350 (32.29%), Postives = 182/350 (52.00%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPL-FGWXXXXX-XXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KCMNEHLF-GFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV++++    +L+ I N+F+ SLA+AD+L+ +  + F+    I G+W+FG ++C +W + DV   TASIMHLC IS+DRYY+IV+P+ Y    T  RV  M++  W+   L+   P+  GW + +     + SN   CE   N+AY + SS  SF+IP ++++ +Y +++ EA R+                 ++R K    +  ++ +I Q               +    PS+   Q  +++ +                         RER+    LG+++ AF++CWLPFF  Y++   C  C+   L  G  FW+GY NS LNPIIY  +NRDFR AF++ L
Sbjct:  124 GNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERL--------------VYRSKVAALLLEKHLQISQ---------------IPKPRPSIQVEQSTISTMR-------------------------RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419          
BLAST of GCR017 vs. Ensembl Fly
Match: Octalpha2R (gene:FBgn0038653 transcript:FBtr0332809)

HSP 1 Score: 147.902 bits (372), Expect = 1.225e-37
Identity = 88/155 (56.77%), Postives = 112/155 (72.26%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGS 930
            GN LV+IAI+T+  LKNIQNWF+ SLA+AD  LG++I+PFSL NE+ G WIFG   C +  A+DVLLCTASIM+LCLIS+DRY+SI + + Y  SRTP R   MI A WI+S LIC+PPL GW        +     KCEL+++  YVLYS++GS
Sbjct:  132 GNMLVIIAIATEKSLKNIQNWFIASLAVADFFLGLIIMPFSLANELMGYWIFGSWWCDIHSAMDVLLCTASIMNLCLISLDRYWSITKAVDYLKSRTPARAAVMITAVWIMSALICIPPLLGWKVKMPEGPL----PKCELSEDIGYVLYSALGS 282          

HSP 2 Score: 87.4261 bits (215), Expect = 8.287e-18
Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 1
Query: 1258 RKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC---MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             K ++ R +E+R  ++LG+++G+FI CWLPFF  Y++V  C     + E  F   FWLGY NS LNP IYT++N+DFR+AF+RIL
Sbjct:  584 EKRRIARKKEKRATLILGLIMGSFIACWLPFFFLYILVPACSSHCNIPESAFAVAFWLGYMNSALNPAIYTIFNKDFRRAFRRIL 668          
BLAST of GCR017 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 191.43 bits (485), Expect = 7.896e-55
Identity = 154/392 (39.29%), Postives = 216/392 (55.10%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKR----------------RANRXXXXXXXXXXXNP-------ELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC---IVDDDDPSVTN---------NQEPLNSQKHRIDRIQSKNIISKLAIRKS--------KLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM---NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN +V+IA+ T   L+  QN FL SLA AD+L+  L++PFSL  E+ G W F  L C + LA+DVL CT+SI+HLC IS+DRY SI RP+QY T RTP ++   I+  W+IS +I  PPL          +       CEL +++ Y+LYS+IGSF+ P LI+I+VY++++  AK+                R  +       +   NP       E  ++  V+    + T+  + C  N+ +S +      +V   D + TN         N+ P  SQ +R     SK   S+LA  K+        K +  RE+R   VL VV+G FI+CW PFF SY +   C  M    E LF FFFW+GYCNS LNP+IYT++NRDFRKAF++IL
Sbjct:   35 GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVS--MDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKG--SQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKIL 422          
BLAST of GCR017 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 191.43 bits (485), Expect = 7.896e-55
Identity = 154/392 (39.29%), Postives = 216/392 (55.10%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKR----------------RANRXXXXXXXXXXXNP-------ELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC---IVDDDDPSVTN---------NQEPLNSQKHRIDRIQSKNIISKLAIRKS--------KLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM---NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN +V+IA+ T   L+  QN FL SLA AD+L+  L++PFSL  E+ G W F  L C + LA+DVL CT+SI+HLC IS+DRY SI RP+QY T RTP ++   I+  W+IS +I  PPL          +       CEL +++ Y+LYS+IGSF+ P LI+I+VY++++  AK+                R  +       +   NP       E  ++  V+    + T+  + C  N+ +S +      +V   D + TN         N+ P  SQ +R     SK   S+LA  K+        K +  RE+R   VL VV+G FI+CW PFF SY +   C  M    E LF FFFW+GYCNS LNP+IYT++NRDFRKAF++IL
Sbjct:   35 GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVS--MDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKG--SQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKIL 422          
BLAST of GCR017 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 183.726 bits (465), Expect = 6.845e-52
Identity = 149/414 (35.99%), Postives = 225/414 (54.35%), Query Frame = 1
Query:  385 VNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEI-QQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL-------------------------------------AIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             N  +Y P     ++  V  L++  + GN LV+IA+ T   LK  QN FL SLA AD+L+  LI+PFSL NE+ G W FG + C+++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP RV  MI+  W+IS +I  PPL          ++      C+L  +  Y+LYSSIGSF+ P +I+I+VY++++  AK R          E +++P+       +E  +   +  ++N +C+    E       +D+P    + E  +S   +  R Q++   SK                                       I + K+ + RE+R   VL VV+G F+VCW PFF SY +   C+    + + LF FFFW+GYCNS LNP+IYT++N+DFR+AFQ+IL
Sbjct:   25 TNSTSYSPATIIGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLIS----MDRNTVDERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRN-----MSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPA---EDNPDA--DLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRRNTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of GCR017 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 183.726 bits (465), Expect = 6.916e-52
Identity = 149/414 (35.99%), Postives = 225/414 (54.35%), Query Frame = 1
Query:  385 VNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEI-QQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL-------------------------------------AIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             N  +Y P     ++  V  L++  + GN LV+IA+ T   LK  QN FL SLA AD+L+  LI+PFSL NE+ G W FG + C+++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP RV  MI+  W+IS +I  PPL          ++      C+L  +  Y+LYSSIGSF+ P +I+I+VY++++  AK R          E +++P+       +E  +   +  ++N +C+    E       +D+P    + E  +S   +  R Q++   SK                                       I + K+ + RE+R   VL VV+G F+VCW PFF SY +   C+    + + LF FFFW+GYCNS LNP+IYT++N+DFR+AFQ+IL
Sbjct:   25 TNSTSYSPATIIGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLIS----MDRNTVDERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRN-----MSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPA---EDNPDA--DLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRRNTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of GCR017 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 183.726 bits (465), Expect = 6.916e-52
Identity = 149/414 (35.99%), Postives = 225/414 (54.35%), Query Frame = 1
Query:  385 VNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEI-QQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL-------------------------------------AIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             N  +Y P     ++  V  L++  + GN LV+IA+ T   LK  QN FL SLA AD+L+  LI+PFSL NE+ G W FG + C+++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP RV  MI+  W+IS +I  PPL          ++      C+L  +  Y+LYSSIGSF+ P +I+I+VY++++  AK R          E +++P+       +E  +   +  ++N +C+    E       +D+P    + E  +S   +  R Q++   SK                                       I + K+ + RE+R   VL VV+G F+VCW PFF SY +   C+    + + LF FFFW+GYCNS LNP+IYT++N+DFR+AFQ+IL
Sbjct:   25 TNSTSYSPATIIGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLIS----MDRNTVDERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRN-----MSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPA---EDNPDA--DLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRRNTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of GCR017 vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 184.496 bits (467), Expect = 3.387e-52
Identity = 152/382 (39.79%), Postives = 223/382 (58.38%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDD----DPSVTNNQEPLNSQ-------------KHR-------IDRIQS-KNII--------SKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  LI+PFSL NE+ G W FG+  C ++LA+DVL CT+SI+HLC IS+DRY+S+ + I+Y + RTP R+  +I+  W ++ LI LPPL     +       + + +C+L +   Y+L SSI SF+ P LI+I+VYL++++ AKRR NRK    K   K  P LF +     ++  +T+ Q    C  + S+  + +  DD     P +++ +E  N               KH        +D + + K ++        S L+  K K    RE+R   VL VV+G F++CW PFF +Y +   C   C + + +F FFFW+GYCNS LNP+IYT++N+DFRKAF+RIL
Sbjct:   34 GNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISLPPLI----YKGKSKDQNAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRR-NRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQ----CGIISSQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAICTELCYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFRRIL 406          
BLAST of GCR017 vs. Ensembl Xenopus
Match: ENSXETT00000026158.1 (alpha-2Db adrenergic receptor-like [Source:NCBI gene;Acc:100493940])

HSP 1 Score: 175.252 bits (443), Expect = 5.654e-49
Identity = 146/385 (37.92%), Postives = 219/385 (56.88%), Query Frame = 1
Query:  385 VNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRX--------XXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILS 1506
            +N   Y  LE TLI ++V+ +++  V GN LV++AI T   L+  QN FL SLA AD+L+G LI+PFSL  E+ G W FG + CS++LA+D+L CT+SI+HLC ISIDRY+S+ + ++Y   RTP R+   I   W++S +I  PPL               E +C L  +  YVL+S   SF++P LI+I++Y +++  AK R +                  + +  +    E  E+D+E     ++ +      +       D   S    +   +S + +  R QS      + I + +L + RE+R   VL VV+G F++CW PFF +Y +   C+    +++ LF FFFW+GYCNS LNPIIYTV+NRDFRKAF+RIL+
Sbjct:   23 LNVWPYTALECTLIIIAVVSIILSTVLGNILVVLAIFTSRALRAPQNLFLVSLASADILVGALIIPFSLAREVMGYWHFGSVWCSMYLALDILFCTSSIVHLCAISIDRYWSVTKAVKYNLKRTPKRIKRSIAIIWVVSAIISFPPLL---------KSKHKEWECLLNDDTWYVLFSCTVSFFVPCLIMILLYCRIYRVAKHRVSSLRNGVSDCNSAAAGGTCETHHTIQNNHEAEELDLE-----ESTSSVHKFPKKHHHKTKDKPSSAKAKRLSWSSNRGQQHRDQS------ICISQMRLTQLREKRLTFVLAVVIGGFVICWFPFFFTYSLESVCRKRCGISDALFNFFFWIGYCNSSLNPIIYTVFNRDFRKAFRRILT 387          
BLAST of GCR017 vs. Ensembl Xenopus
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145449])

HSP 1 Score: 167.933 bits (424), Expect = 7.574e-46
Identity = 137/384 (35.68%), Postives = 213/384 (55.47%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXX--XXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDD--------------------DDPSVTNNQE-----PLNSQKHRIDRIQSKNI--------ISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN  V+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG + C ++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP R+  +I+  W+IS +I  PPL      + +        +C+L  +  Y+L S IGSF+ P +I+I+VY++++  AK R       K            F K   V++  +    ++N +C    S   +  V+D                    D+   +  ++       + Q  R+ R  +K++          + ++ + KL + RE+R   VL VV+G F+VCW PFF SY +   C+  C + E LF FFFW+GYCNS LNP+IYT++N+DFR++F++I+
Sbjct:   48 GNVFVVIAVLTSRALKAPQNLFLVSLASADILVAALVMPFSLANELMGYWYFGNVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVWLISAVISFPPLISMDRDTEDDVY----PQCKLNDDTWYILSSCIGSFFAPCIIMILVYIRIYQVAKLRTRTLSEKKPTRDGSSHTENGFSKGTTVKMPGD----KENGHCPPRPSPPKATDVEDLELEESSMSESKRRKSSSKEDNTDSSKERKCSKGNSFSKQSSRLSRTSNKSMELFSSRKKKKRSSVSRRKLSQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREACEVPETLFKFFFWIGYCNSSLNPVIYTIFNQDFRRSFKKII 423          
BLAST of GCR017 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 157.532 bits (397), Expect = 2.550e-42
Identity = 125/371 (33.69%), Postives = 207/371 (55.80%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISC----IVDDDDPSV---------TNNQEPLNSQKHRIDRI-----QSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK-CMNEH-LFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            GN+ V+ AI+ +  L+ + N+ +GSLA+ DL++ +L+LP +  N++  +W  G++ C +++++DVL CT+SI+HLC I++DRY++I  PI Y   RTP R   +I   WI+   I +PP+ GW          S+   C+++++  Y +YS+ G+FYIPL++++++Y ++F  A+ R  +     + +   +  L     V E      E  +N     V+ +  +C    I   +D +V          N++  L+   H  D       + +N  +  A RK  L   RER+T+  LG+++G FI CWLPFF   L++ FC+ C   H LF    WLGY NS LNPIIY  +N+DF+ AF++I+    C
Sbjct:   46 GNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGW----RTPEDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADTCLSVSPAVAERK-SNGEPSKNWK-RTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRNDRATDAKRKVALA--RERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCKFC 408          
BLAST of GCR017 vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 149.828 bits (377), Expect = 6.604e-40
Identity = 104/312 (33.33%), Postives = 167/312 (53.53%), Query Frame = 1
Query:  601 IFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCEL-TQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSN 1524
            + G+W  G+++C +WL+ D+  CTASI+HLC+I++DRY++I   ++Y   RTP R + MI   W+ S  I +PPLF W               C + T +  Y +YS++G+FYIP L++I +Y ++++EA+ R  ++      +      L             T+   + + +  +S  +    D   P   N               Q K  +S   + K K++  RER+    LGV++GA+IVCWLPFF   L++  CK  C  +  +F FF WLGY NS +NPIIYT+ N DF++AF ++++   CS+
Sbjct:   80 VTGKWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRAVVMIALVWVFSISISMPPLF-WRQSKAEEIAV-----CAVNTDHILYTVYSTVGAFYIPTLLLIALYGRIYVEARSRILKQSPKTTGKRLTKAHLI------------TDSPGSSSVSSTNSRTLEMPSDAGSPVYLN---------------QVKVKVSDALLEKKKIMAARERKATKTLGVILGAYIVCWLPFFIISLVMPICKDACWFHPAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLINRFKCSS 358          
BLAST of GCR017 vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 165.236 bits (417), Expect = 3.650e-45
Identity = 123/374 (32.89%), Postives = 205/374 (54.81%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRR----ANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIV--DDDDPSV----------TNNQEPLNSQKHRIDRIQS----KNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC---MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            GN+ V+ AI+ +  L+N+ N+ +GSLA+ DL++ +L+LP +   ++  +W  G++ C L++A+DVL CT+SI+HLC I++DRY++I  PI Y   RTP R  A+I   W+I  LI +PP+ GW          SN  +C ++++  Y +YS+ G+FYIPLL+++++Y ++F  A+ R      +                  K+ +       + +++     V +   +  V   +DD ++          +    PL S+      + +    KN   + A  K K+   RER+T+  LG+++G FI+CWLPFF   L++ FC+    M E L     WLGY NS LNP+IY  +N+DF+ AF++I+    C
Sbjct:   53 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGW----RTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKN--ERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC 420          
BLAST of GCR017 vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 154.066 bits (388), Expect = 2.046e-41
Identity = 106/307 (34.53%), Postives = 166/307 (54.07%), Query Frame = 1
Query:  601 IFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCEL---TQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            + GRW  G+++C  WL+ D+  CTASIMHLC+I++DRY++I   ++Y   RTP R   MI+  W+ S  I LPP F W          + E+  +    T +  Y +YS++G+FY+P L++I +Y ++++EA+ R  ++   K  +     +L                    +   ++S A       D PS + +   +N  K R         +S   + K KL+  RER+    LG+++GAFIVCWLPFF   L++  CK  C  +  +F FF WLGY NS +NPIIYT+ N DF++AF +++
Sbjct:  107 VTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFF-W------RQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQLITDSP-----------GSTSSVTSINSRA------PDVPSESGSPVYVNQVKVR---------VSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of GCR017 vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 154.066 bits (388), Expect = 2.046e-41
Identity = 106/307 (34.53%), Postives = 166/307 (54.07%), Query Frame = 1
Query:  601 IFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCEL---TQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            + GRW  G+++C  WL+ D+  CTASIMHLC+I++DRY++I   ++Y   RTP R   MI+  W+ S  I LPP F W          + E+  +    T +  Y +YS++G+FY+P L++I +Y ++++EA+ R  ++   K  +     +L                    +   ++S A       D PS + +   +N  K R         +S   + K KL+  RER+    LG+++GAFIVCWLPFF   L++  CK  C  +  +F FF WLGY NS +NPIIYT+ N DF++AF +++
Sbjct:  107 VTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFF-W------RQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQLITDSP-----------GSTSSVTSINSRA------PDVPSESGSPVYVNQVKVR---------VSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of GCR017 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 144.05 bits (362), Expect = 2.015e-37
Identity = 123/361 (34.07%), Postives = 194/361 (53.74%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMN--EHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRR 1542
            GN LV+++++    L ++ ++++ +LA+ADLLL   +LPFS   EI G W FGR+ C++W A+DVL CTASIM LC+ISIDRY  +  P++Y T  T  R +  ++  W +S +I + PLFGW           +E  C++ +   YVL+S++GSFY+PL II+++Y +V++ AKR                              E   ++     ++ DSE ++  +   +  V      ++S K++          +  ++R  K    RE++    LG+VVG F++CWLPFF    I  F       E +F   FWLGY NS +NPIIY   +++F+KAFQ +L  I C  +  S +
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGW-----RQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKR------------------------------ESRGLKSGLKTDKSDSEQVTLRIHRKN--VPAEGSGVSSAKNK----------THFSVRLLKF--SREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLR-IQCLRRRQSSK 353          
BLAST of GCR017 vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 142.51 bits (358), Expect = 2.260e-37
Identity = 127/389 (32.65%), Postives = 218/389 (56.04%), Query Frame = 1
Query:  355 LNITDKNYSFVNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNR-AYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELF---RKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KC-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            LN +D+N +   EL  R     L+SL++  L ++    NSLV+ AI    +L +  N+ + SLA+ D L+ +L++PFS+   +   WI G++LC +WL++D++ CT SI+HL  I++DRY +I   ++Y   RTP     MI   W+IS  I +PPLF W     +      + +C +  +     +YS+ G+FYIPL++I+I+Y +++  A+   +++   +  + + N ++F    +K +  V   Y  ++++ +    D + I   V          + P +  KH            + + R+ K+   RER+    LG+++GAF++CWLPFF   L+V  C KC ++E +  F  WLGY NS +NP+IYT++N DF+KAFQ+++
Sbjct:    4 LNASDQNLT-SEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLF-WRHQGTS-----RDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVFLESGEKSIKLVSTSYM-LEKSLSDPSTDFDRIHSTV----------KSPRSELKH------------EKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLV 362          
BLAST of GCR017 vs. UniProt/SwissProt
Match: sp|Q90WY6|ADA2C_DANRE (Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.221e-51
Identity = 149/414 (35.99%), Postives = 225/414 (54.35%), Query Frame = 1
Query:  385 VNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEI-QQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL-------------------------------------AIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             N  +Y P     ++  V  L++  + GN LV+IA+ T   LK  QN FL SLA AD+L+  LI+PFSL NE+ G W FG + C+++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP RV  MI+  W+IS +I  PPL          ++      C+L  +  Y+LYSSIGSF+ P +I+I+VY++++  AK R          E +++P+       +E  +   +  ++N +C+    E       +D+P    + E  +S   +  R Q++   SK                                       I + K+ + RE+R   VL VV+G F+VCW PFF SY +   C+    + + LF FFFW+GYCNS LNP+IYT++N+DFR+AFQ+IL
Sbjct:   25 TNSTSYSPATIIGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLIS----MDRNTVDERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRN-----MSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPA---EDNPDA--DLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRRNTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of GCR017 vs. UniProt/SwissProt
Match: sp|Q28838|ADA2A_BOVIN (Alpha-2A adrenergic receptor OS=Bos taurus OX=9913 GN=ADRA2A PE=2 SV=3)

HSP 1 Score: 184.111 bits (466), Expect = 9.231e-51
Identity = 145/396 (36.62%), Postives = 210/396 (53.03%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKE--------------VVEVDIEYTEIQQN-----------CNCNQVDSEAISCIVDDDDPSVTNNQE--PLNSQKHRIDRIQSKNIISKLAIRKSKLI-----------------------RYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG+  C ++LA+DVL CT+SI+HLC IS+DRY+SI + I+Y   RTP R+ A+I+  W+IS +I  PPL  +          S E +CE+   + YV+ SSIGSF+ P LI+I+VY++++  AKRR  R    ++       EL    E               V  ++E  ++Q N            + + +D E  S     + P  +   E  P    K R  +++  + + +     + L                        + RE+R   VL VV+G F+VCW PFF +Y +      +   LF FFFW GYCNS LNP+IYT++N DFR+AF++IL
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSGQPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRR-TRVPPSRRGPDATAAELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGPPDADALDLEESSSSEHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 459          
BLAST of GCR017 vs. UniProt/SwissProt
Match: sp|P18871|ADA2A_PIG (Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823 GN=ADRA2A PE=1 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 1.630e-48
Identity = 146/394 (37.06%), Postives = 204/394 (51.78%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRR----ANRXXXXXXXXXXXNPE-----LFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDP--------SVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKS--------------------------KLIRY-----RERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG+  C ++LA+DVL CT+SI+HLC IS+DRY+SI + I+Y   RTP R+ A+I+  W+IS +I  PPL      +        E +CE+   + YV+ S IGSF+ P LI+I+VY++++  AKRR     +R+       +    E     L  ++ V  V  E   +      N    E       D D         S    + P   +  R  R +SK   S++    S                          K  R+     RE+R   VL VV+G F+VCW PFF +Y +      +   LF FFFW GYCNS LNP+IYT++N DFR+AF++IL
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGGQQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAAALPGGAERRPNGLGPERGVGRVGAEAEPLP--VQLNGAPGEPAPAGPRDADGLDLEESSSSEHAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of GCR017 vs. UniProt/SwissProt
Match: sp|P22909|ADA2A_RAT (Alpha-2A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2a PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 1.698e-48
Identity = 143/394 (36.29%), Postives = 201/394 (51.02%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELF-----------RKKEVVEVDIEYTEIQQNCNCNQV------DSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKS--------------------------KLIRYR-----ERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG++ C ++LA+DVL CT+SI+HLC IS+DRY+SI + I+Y   RTP R+ A+I+  W+IS +I  PPL               E  C++   + YV+ SSIGSF+ P LI+I+VY++++  AKRR       + P+    P              R       + E    Q N    +       D +A+              Q P   +  R  R + K   S++    S                          K  R+R     E+R   VL VV+G F+VCW PFF +Y ++     +   LF FFFW GYCNS LNP+IYT++N DFR+AF++IL
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGP--GKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of GCR017 vs. UniProt/SwissProt
Match: sp|P08913|ADA2A_HUMAN (Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4)

HSP 1 Score: 176.792 bits (447), Expect = 4.391e-48
Identity = 136/393 (34.61%), Postives = 206/393 (52.42%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQ-------------------------KHRIDRIQSKNIISKLA-----------------IRKSKLIRYR-----ERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG+  C ++LA+DVL CT+SI+HLC IS+DRY+SI + I+Y   RTP R+ A+II  W+IS +I  PPL               E +CE+   + YV+ S IGSF+ P LI+I+VY++++  AKRR       + P+    P    ++    +  E +          + ++ ++    +  P+   + + L+ +                         K R  +++  + + +                   +  +K  R+R     E+R   VL VV+G F+VCW PFF +Y +      +   LF FFFW GYCNS LNP+IYT++N DFR+AF++IL
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQ-LNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of GCR017 vs. TrEMBL
Match: A0A193KU63 (GCR017 OS=Schmidtea mediterranea OX=79327 GN=gcr017 PE=2 SV=1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 1
Query:  352 MLNITDKNYSFVNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK 1551
            MLNITDKNYSFVNELAYRPLEATLISLSVILLLVLIVAGNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK
Sbjct:    1 MLNITDKNYSFVNELAYRPLEATLISLSVILLLVLIVAGNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK 400          
BLAST of GCR017 vs. TrEMBL
Match: A0A1I8HM96 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 6.622e-65
Identity = 157/356 (44.10%), Postives = 219/356 (61.52%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNC---------NCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILS 1506
            GN LV++AI+ D ++  +QNWFL SLA ADLLLG+L++PFSL N++ G W+FG   C LWLAIDVL+CTASIM+LCLIS+DRY+ + R + Y   RT +R   MI   W +S  +CLPPL GW           +E +CELT    YV+YSS+GSFYIP+LI+++VY ++F  A++R          +     +  R  E  + D   TE +                VDSEA       +   V    EPL               +S+   RK +L + +ERR  +VLG+++GAF++CW PFFT+YL+ I C+C++  +F FFFWLGYCNS +NP+IYTV+N+DFR+AF+RIL+
Sbjct:   50 GNLLVIVAIARDRKVATLQNWFLASLAFADLLLGLLVMPFSLTNQLLGAWVFGAKWCELWLAIDVLMCTASIMNLCLISLDRYWCVSRALVYHRQRTRSRAALMIAVVWFLSAGVCLPPLLGW------RKPQVSEVRCELTDEIGYVVYSSMGSFYIPMLIMVVVYAKIFQRARQRTRTSSKPSSSKSVSPGDTDRADE--KSDFAVTERRNQSEEEEEDADEGIVPVDSEADGGGGGGNSTVV----EPLTE-------------LSEALQRKRRLAKAKERRATLVLGLIMGAFVLCWFPFFTTYLLHILCRCVSHLVFDFFFWLGYCNSAINPVIYTVFNKDFRQAFRRILT 380          
BLAST of GCR017 vs. TrEMBL
Match: V3ZDW8 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_64845 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.376e-59
Identity = 157/378 (41.53%), Postives = 210/378 (55.56%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEV----------------------------DIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAI---RKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK-CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN +V+ AI TD  LK  QN F+ SLA AD+ LGIL++PFSL NE+ G W FG + C LW A+DVLLCTASI  LCLIS+DRY+SI R + Y   RTP R   MI+  W +S  +C+PPL GW     +         C L+ +  YV YSSIGSFYIP  I++ VY +++  AK RA +    K P +  N      ++   +                              +  E +QN N   +D + +        P +T +    N  K +++   S +           K KL + RERR  +VLG+V+ AFI+CW PFFT YLI  FCK C+ E +F  FFW+GYCNS LNP+IYTV+NRDF+KAFQR++
Sbjct:   25 GNFMVIWAIITDRNLKGPQNLFIASLAFADMFLGILVIPFSLANELMGYWYFGVIWCELWKAVDVLLCTASISSLCLISLDRYWSITRAMSYSRQRTPKRAALMIMIVWCVSATVCIPPLIGWKQPVQHSVW----PMCNLSDDIGYVFYSSIGSFYIPAFIMVFVYFKIWQAAKARARKTMNRKDPGIADNDTESSTEQTKALLDHSARDTTDTADTDGGNSTEAGNGKLHKFQIVEPKQNGNPTVLDKDKVKVKRQGILPGITRHLFQKNRNKKKVNSGGSDSKTPDYMSADKHKRKLAKARERRATLVLGLVMAAFILCWGPFFTMYLISSFCKDCIGEMVFTVFFWIGYCNSALNPLIYTVFNRDFKKAFQRMI 398          
BLAST of GCR017 vs. TrEMBL
Match: J9PFH2 (Adrenergic receptor protein OS=Crassostrea angulata OX=558553 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.489e-57
Identity = 172/434 (39.63%), Postives = 237/434 (54.61%), Query Frame = 1
Query:  352 MLNITDKNYS---------FVNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRX-------------XXXXXXXXXXNPELFRKKEVVE-----------VDIEYT-EIQQNCNCNQVDS----EAISCIVDDDD------------PSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            M+N+T  NYS          V    Y  +  TL    V +++++IV GN LV++AI TD  LK+ QNW + SLA+AD LLG++I+PFSL NE+ G W FG + C LW AIDVLLCTASI+ +CLIS+DRY+ I + + Y   RT  R   MI A WI+S ++C+PPL GW     N    ++   C L+    Y++ S +GSFYIP +I++IVY +++  A  RA ++                +   + KN +   K+E V             D E T  + Q    N+ DS    E  +  +D+ D             S T     L   +  I   +  + +  L   K KL + RERR  +VLG+V+ AFIVCW PFFT Y+I   C C+ + +F   FW GYCNS LNPIIYTV+NRDFR AF+RIL
Sbjct:    1 MMNLTGSNYSNTTISSGSERVLPPGYSTVHLTLTVTIVTIIILIIVGGNLLVVVAIYTDKNLKSKQNWLIASLAVADCLLGLIIMPFSLTNEVMGYWYFGSVWCDLWKAIDVLLCTASILSICLISLDRYWCITKALTYPRQRTATRAALMIAAVWILSLIVCVPPLIGW----KNPLPVNDYPLCLLSSELGYIISSCMGSFYIPGVIMVIVYYKIYKAATERARKQRGNNNKKAKKKDKTDKELYGLLKNTDTKEKQETVTNMPTKVNSMTLTDDESTWPMYQKQGVNREDSGQEPETGNGTIDEQDIDLDEANEKESTKSDTTGTTNLTPNQEEIKHAEVYDAVKDLERHKRKLAKARERRATIVLGIVMAAFIVCWAPFFTLYIITALCNCIPDIVFDVCFWAGYCNSALNPIIYTVFNRDFRHAFKRIL 430          
BLAST of GCR017 vs. TrEMBL
Match: R7U1G5 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_83790 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.062e-57
Identity = 156/395 (39.49%), Postives = 219/395 (55.44%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXX-----------XXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQV-----------DSEAISCIVDDDDP-------SVTNN--------------QEPLNSQKHRIDRIQSKNI-----ISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IAI+ D +LK +QNWF+ SLA++DL +G+LI+P SL NE+ G W FG +LC LWLA DVLLCTASI++LCLIS+DRY+SI R I Y   RT  R + MI   W++S ++C PPL GW               C L++   YV+YS++GSFYIPL+++I+VY ++F+ A+ RA R                      NP   R+ E         E+  +   +Q+           D+E  S +    DP       SVTN+               E  +S  H+    ++K+I         ++    + R RERR  +VLG+++  FI CWLPFF+ YLI    K    + +F   FWLGY NS LNPIIYT++N+DFRKAF++I+
Sbjct:   12 GNGLVVIAIAKDRQLKGLQNWFIASLAVSDLFVGLLIMPLSLANELMGYWYFGTVLCELWLATDVLLCTASILNLCLISLDRYWSITRAISYVRQRTKTRAIVMITLVWLLSMILCFPPLAGW---KRPQPSIHGLPLCVLSKEPGYVVYSTVGSFYIPLIVMILVYFKIFLAARERARRNLKKPNALPPTNGKSSSTTSFSNPS--RQMEDHGKLSPTAEMNSDDEMSQMDTMMPDTTAVPDTEVTSGVESTTDPEMGYKMISVTNHGAKLLTHDEQRKLLSEDTDSDAHKSLGDKTKHIHFSEETDSDSLSIKHIARARERRATIVLGIIMATFIGCWLPFFSIYLIASLAKLKAPDSVFAVIFWLGYVNSALNPIIYTIFNQDFRKAFKKII 401          
BLAST of GCR017 vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 184.882 bits (468), Expect = 6.940e-53
Identity = 146/389 (37.53%), Postives = 222/389 (57.07%), Query Frame = 1
Query:  463 AGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTN--NQEPLNSQKHRI-----------------DRIQSKNIISKL--AIRKSKLIRY-----RERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRM 1545
            +GN L +IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG + C ++LA+DVL CTASI HLC IS+DRY+SI R ++Y   RTP R+  +I+  W+I+ +I  PPL    +        ++   C++ +++ Y++ S IGSF++P +I+++VY++++  AK R               P   RK++         E ++N +C++  +   +   D DD    N  + E  +S  H++                  +I+  + I+K   A R +K  R+     RE+R   VL VV+G F++CW PFF +Y +   C+  C+NE LF FFFW GYCNS LNPIIYT++N DFR+AF++IL       + DSRR+
Sbjct:   28 SGNLLAVIAVFTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGPVWCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPL----TIMKEDEPINDPPSCQINKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSRTR-----------TPPGDRRKRD--------DEKKENGHCHERLNGDAANGNDKDDKGDVNAVDMEESSSSDHKVTNPCASKKKRAKGKTKLSQIKPGDDINKRENANRGTKSSRWKGRQNREKRFTFVLAVVIGVFMICWFPFFFTYTLRALCESCCVNETLFKFFFWFGYCNSSLNPIIYTIFNNDFRRAFKKILC------RGDSRRV 387          
BLAST of GCR017 vs. Ensembl Cavefish
Match: adra2b (adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751])

HSP 1 Score: 177.948 bits (450), Expect = 5.340e-50
Identity = 148/381 (38.85%), Postives = 208/381 (54.59%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRR---------------ANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQ------EPLNSQKHRIDRIQSKNIISKLAIRKS-----------KLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   L+  QN FL SLA AD+L+  LI+PFSL NE+ G W F  + C ++LA+DVL CT+SI+HLC IS+DRY SI R + Y   RTP R+   I+  W+IS +I  PPL     +    +  +   +CEL   R Y+LYS+IGSF+ P LI+I+VY++++  AK+R               A ++           P       +   D +      N   +  DS+     V  + P   + +       P   QK+R     +K   ++LA RKS           K +  RE+R   VL VV+G F+VCW PFF SY +   C   C + E LF FFFW+GYCNS LNP+IYT++N+DFR+AF++IL
Sbjct:   37 GNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGFWYFKSVWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRAVTYGAQRTPRRIKCAILIVWLISAVISFPPLLS--MNKKKGTDEAGCPQCELNNERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTRCPPGEPRKEIPASAKQQPATTPTTNNLLPPPSLGTALTPPDKK--PDNNNGESSTSDSDTEQGGVGTEMPMTPSGEPSAGIHSPATIQKYRDMIATAKG--TRLASRKSKQDGTPNSARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAVCPRTCNLPEPLFKFFFWIGYCNSCLNPVIYTIFNKDFRRAFKKIL 411          
BLAST of GCR017 vs. Ensembl Cavefish
Match: adra2db (alpha-2Da adrenergic receptor-like [Source:NCBI gene;Acc:103025929])

HSP 1 Score: 170.244 bits (430), Expect = 6.433e-47
Identity = 132/386 (34.20%), Postives = 204/386 (52.85%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRA--------------------------------NRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQV-DSEAISCIVDDDDPSVTNNQEPLNSQKHRI--DRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK---CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSM 1509
            GN+LV++A+ T   L+  QN FL SLA AD+L+  L++PFSL NE+ G W FG + CSL+LA+DVL CT+SI+HLC IS+DRY+S+ R ++Y   RTP RV   I   W++S +I  PP+               E +C L +   Y+L S++ SF+ P  I++ VY +++  AK+R+                                 R    +      +    R++E+ ++D+E     ++C   +V D  +               + P  + +  I  +R    +   +    +S+  + RE+R   VL VV+G F++CW PFF +Y +   C+      E LF  FFW+GYCNS +NPIIYT++NRDFRKAF++IL +
Sbjct:   68 GNALVIVAVLTSRALRAPQNLFLVSLACADVLVAALVIPFSLANEVMGYWYFGSVWCSLYLALDVLFCTSSIVHLCAISLDRYWSVTRAVRYNLKRTPRRVRCAIAVVWLVSAVISFPPI---------VLTRHGEGECLLNEEPWYILSSALVSFFAPGFIMVTVYCKIYRVAKQRSATVCAAQNGTIAAAVAKATAAAAMRADACAVRRRAADTESASSHSSGSEARREELDDIDLE-----ESCVGGRVRDIGSGGAGGGAGGGGKVGGRAPWATSRALIPPNRPPYHHQAPRTGAYRSRAAQMREKRFTFVLAVVMGGFVLCWFPFFFTYSLSALCRESCAAPEGLFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKILGL 439          
BLAST of GCR017 vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 153.68 bits (387), Expect = 4.456e-41
Identity = 120/363 (33.06%), Postives = 203/363 (55.92%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPP-LFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXX--XXXNPELFRKK----EVVEVDIEYTEIQQNCNC---NQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC--MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            GNS V+ AI+ +  L+N+ N+ +GSLA+ DL++ +L+LP +   ++  RW  G++ C +++++D+L CT+SI+HLC I++DRY++I  PI Y   RT  R   +I   W++   I +PP L   S         +N + C ++ +  Y +YS+  +FYIPL++++++Y ++F  A+ R  +     +    +  +P LF+K     +     +E   I    N       D E++  IV++  P    +  PL +   ++   ++++   K    K KL   RER+T+  LG+++G FI+CWLPFF   L++ FC    M   L     WLGY NS LNPIIY  +N+DF+ AF++I+    C
Sbjct:   54 GNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLDRWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGVTWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKSEKVKCLTVSPALFKKSNGELKSWRSSVEPKPIADCSNGAAKRHDDGESLE-IVEEVQPGGAKSSLPLPNAPGQVPLFENRH--EKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPSCQMPVWLMDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCHFC 413          
BLAST of GCR017 vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 5.419e-41
Identity = 123/361 (34.07%), Postives = 199/361 (55.12%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVV----EVDIEYTEIQQNCNCNQVDSEAISCIVDD---DDPSVTNNQEPLNSQ--KHRIDRIQSKNIISKLA---IRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC---MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN+ V+ AI+ +  L+ I N+ +GSLA+ DLL+ +L+LP +   ++  RW  G++ C L++A+DVL CT+SI+HLC I++DRY++I  P+ Y T RT  R   +I   W++   I +PP+ GW          +N  +C ++Q+  Y ++S+ G+FYIPL +++++Y ++F  A+ R  R       ++K   +   +K             T +    + N+V S       DD   D P  T    P ++      + R+ +   IS      ++ S+    RERRT+  LG+++G FI+CWLPFF   L++ FC     M   L     WLGY NS LNP+IY  +NRDF+ AF+++L
Sbjct:   50 GNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPPMLGW----RTPEDRANPLECTISQDPGYTIFSTFGAFYIPLALMLVLYGRIFRAARFRIRRSAKKNTDKMKMKEKEKDRKGTGLTGNGAPSPCTSVTGTPDVNRVSSP------DDPRIDTPDGTRASTPDSTSLGSPEVTRVGTPEGISLEGTELLQDSRGALARERRTVKTLGIIMGTFILCWLPFFIVALVLPFCGSSCPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKML 400          
BLAST of GCR017 vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 179.104 bits (453), Expect = 1.349e-50
Identity = 148/391 (37.85%), Postives = 207/391 (52.94%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRAN--RXXXXXXXXXXXNPELFRKKEV----------VEVDIEYTEIQQNCN------------------CNQVDSEAISCIVD-------DDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL--AIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK----CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSM 1509
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSLFNE+ G W FGR+ C ++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP R+  +I+  W I+  I LPPL   +  +           CEL  N  Y+L S IGSF+ P LI+++VY +++   K RA   R+         +  E  R  EV                    ++NCN                    +VD E  S   D        D      +++P +  K   D      I+ +   A  + K+ + RERR   VL V++G F++CW PFF +Y +   C      + E LF FFFW GYCNS LNP+IYTV+NRDFR+AF++IL M
Sbjct:   68 GNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHLVKWRAAKLRRDKEAPITSCRPMESIRMSEVNGNGGGGGGGGGGGEGNGNGEKNCNGAGDKSRHHPHHHPPSHHHPEVDVEETSVSSDKNERRRDGDSAGAKASRKPCSPTKD--DYNPEMEILERQNKARERRKIAQARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKILCM 456          
BLAST of GCR017 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 145.591 bits (366), Expect = 1.077e-38
Identity = 114/365 (31.23%), Postives = 193/365 (52.88%), Query Frame = 1
Query:  469 NSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRA-YVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTE----------------IQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILS 1506
            N+LV+ AIS   +L+   N+ +GSLA+ADLL+  L++P +    + G W  G  LC LWL++DV  CTASI+HLC I++DR+++I    +Y   RTP R   MI A+W+++  I +PPLF W            + +C +  +   Y +YS+ G+FY+PL +++ +Y ++F  AKR   ++   ++ ++  + E     E         +                + +  + +Q  ++A          S    +   + +  R  R  S  +  +    + ++   RERR    LG+++GAF+VCWLPFF   L+V  CK   ++  +     WLGY NS +NP+IYT++N DF+ AF++++S
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLF-WRRRDPA------KPRCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQREKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLVS 422          
BLAST of GCR017 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 1.858e-27
Identity = 61/155 (39.35%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGS 930
            GNS V+ AI+ +  L+N+ N+ +GSLA+ DLL+ IL+LP +   ++  RW  G+++C +++A+DVL CT+SI+HLC+I++DRY++I  PI Y   RTP R + MI   W++   I +PP+ GW          ++   C+++Q+  Y +YS+ G+
Sbjct:   53 GNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGW----RTPEDRADPNACKISQDHGYTIYSTFGA 203          

HSP 2 Score: 52.373 bits (124), Expect = 1.333e-7
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 1354 TSYLIVIFC--KC-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            T+ LI  FC  +C +   +F    WLGY NS LNPIIY  +N+DF+ AF++I+    C
Sbjct:  329 TALLISPFCGERCHLPPGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCKFC 386          
BLAST of GCR017 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 2.499e-26
Identity = 60/156 (38.46%), Postives = 97/156 (62.18%), Query Frame = 1
Query:  463 AGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGS 930
            AGN+ VL AI  +  L+ + N+ +GSLA+ DLL+ +L+LP +   ++ GRW  G+ +C  ++A+DVL CT+SI+HLC I++DRY++I  P+ Y   RTP R   MI   W++   I +PP+ GW          ++   C ++Q+  Y +YS+ G+
Sbjct:   18 AGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPMLGW----RQAEDRADPDACNISQHLGYTIYSTFGA 169          
BLAST of GCR017 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 3.941e-26
Identity = 65/122 (53.28%), Postives = 86/122 (70.49%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFG 831
            GNSLV IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W+FG   C ++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP RV   I+  W+I+ LI  PPL G
Sbjct:   50 GNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVG 171          

HSP 2 Score: 89.7373 bits (221), Expect = 2.016e-19
Identity = 49/90 (54.44%), Postives = 62/90 (68.89%), Query Frame = 1
Query: 1243 SKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM---NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            +K+A RK  L   RE+R   VL VV+G F+ CW PFF SY +   C+      E+LF FFFW GYCNS LNP+IYTV+N+DFR+AF+ IL
Sbjct:  376 TKMARRK--LTAAREKRFTFVLAVVMGVFVACWFPFFFSYSLTKICEASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNIL 463          
BLAST of GCR017 vs. Ensembl Nematostella
Match: EDO44740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ8])

HSP 1 Score: 80.4925 bits (197), Expect = 1.402e-16
Identity = 77/317 (24.29%), Postives = 138/317 (43.53%), Query Frame = 1
Query:  607 GRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC--KCMN---EHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRR 1542
            G W  GR+ C LW  + +L+   SI++LC +++DR+  +  P++Y T  TP + +  I+  W  + +    P+ GW   + ++ +      C     + YV+  +I +F +P++ + + +  +F  AK+   R             +L R   +VE     T +  + N N+           +  PS++   +    +KH               ++ SK I            ++VG F +CWLP+    L V  C  KC       +      +GY NS LNP +Y+ ++R F++AF+ IL  I     +D  R
Sbjct:   62 GIWTHGRITCQLWTTLYLLVVPGSIINLCAVTLDRFIVLHMPLRYTTIITPRKAIVAIVCLWTYALVTACLPVLGWKDQNYDYILF---NACYFPLLQEYVMLINITNFLLPMIFMAVFWSLIFKIAKKHQRRV-----------KKLERSMSMVE-----TTMSLSINGNE---------AQNGRPSMSEGGKKKTIRKH---------------LKGSKYI-----------AIIVGTFFICWLPYTLLSLGVSICGTKCFRGTPREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNILFNIQSHKVWDLLR 324          
BLAST of GCR017 vs. Ensembl Nematostella
Match: EDO49367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG65])

HSP 1 Score: 67.3958 bits (163), Expect = 1.761e-12
Identity = 53/124 (42.74%), Postives = 75/124 (60.48%), Query Frame = 1
Query:  463 AGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGW 834
            AGNSLV +AI  D+RL+N  NWF+ SLA+ADLL G++ LPF +  +  G  +F    C LW+  D++   ASI +L +IS+DRY  I +P QY    T  R L  ++A WI S ++    +  W
Sbjct:   12 AGNSLVCLAICLDHRLRNSTNWFIASLAVADLLYGLIGLPFRIV-QTSGTRVFTLNECFLWIWADMVCAAASIANLAVISVDRYLKITKPFQYHIRMTHKRALLAVVAVWIYSAILASLSIMPW 134          
BLAST of GCR017 vs. Ensembl Nematostella
Match: EDO41142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S551])

HSP 1 Score: 67.3958 bits (163), Expect = 5.973e-12
Identity = 35/104 (33.65%), Postives = 55/104 (52.88%), Query Frame = 1
Query: 1213 IDRIQSKNIISKLAIRKSKLIRYR-ERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK-----CMNEHLFGFF-FWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            + RI+ + +  +      + +R R  +R +     V+    +CWLPF ++YL  +F       C +    GF  F+LGYCN  LNP++YT +N  FRK F+ IL
Sbjct:  220 MTRIKLRKVPGQAVSEAGQRVRNRTNKRVLHQGLAVITVHYLCWLPFLSTYLTCLFSDRRLSVCKHSFYTGFMIFFLGYCNGALNPLLYTAFNEKFRKGFKSIL 323          
BLAST of GCR017 vs. Ensembl Nematostella
Match: EDO46681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPG1])

HSP 1 Score: 62.003 bits (149), Expect = 1.348e-11
Identity = 38/123 (30.89%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGW 834
            GN L++IA+ST+ RL+ + N+   +LA++D   G + +P  L  ++ G  +   + C++ + + V    AS ++L LISIDR+ ++ RP++YK   TP +    ++  W+++ ++ + P  GW
Sbjct:   24 GNLLIIIAVSTNRRLQTVSNFLFLNLAVSDFFQGSVSIPLRLAEQLNGSLVKPLVPCNVVIPLAVFFYGASNLNLTLISIDRFVALYRPMKYKNMVTPFKATFCVVLCWLVAFVLSVLPALGW 146          
BLAST of GCR017 vs. Ensembl Nematostella
Match: EDO44578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVH5])

HSP 1 Score: 65.855 bits (159), Expect = 1.501e-11
Identity = 44/140 (31.43%), Postives = 70/140 (50.00%), Query Frame = 1
Query: 1117 NQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIR----YRERRTIXXXXXXXXAFIVCWLPFFTSYLI--VIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            N+V+ +A   +V  +  SV+NN+ PLN     + R + +   SK   +  K +     +RE R I +L   + AF VCW PF  +  +  V F +    +      WL + N+  NP+IY + N  F+KAF +IL  + C
Sbjct:  329 NEVEEDATEPVVIQNPASVSNNELPLN-----LSRFEKR---SKPQAKVQKFVNWRRLFRETRLIKLLLFTLLAFYVCWTPFAVASFMQTVGFLEPRPPYFDVVSMWLAFSNAVCNPVIYALLNSQFKKAFSKILKRLFC 460          
BLAST of GCR017 vs. Ensembl Medaka
Match: ENSORLT00000007440.2 (alpha-2A adrenergic receptor-like [Source:NCBI gene;Acc:101170540])

HSP 1 Score: 183.341 bits (464), Expect = 3.038e-52
Identity = 146/399 (36.59%), Postives = 226/399 (56.64%), Query Frame = 1
Query:  355 LNITDKNYSFVNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEP-LNSQKHRIDRIQS-------------KNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--CMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            LN+T  N +F+ +  +    +  ++  V +L++L V GN +V+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG++ C +  A+DVL CT+SI+HLC IS+DRY+S+ + I+Y   RT   +   I   W+I+ +I  PPL             +N   C++ + + Y+L+SSI SF+ P +I+I+VY++++    RR                    +K+V   +   T+ +   + N V S+ I+ +  D++PS ++  E  L S   +ID  ++                +S L + + K  +YRERR   VL VV+G F++CW PFF +Y +   C   C+ E LF  FFW GYCNS LNP+IYT++N DFRK+F+RIL
Sbjct:    4 LNLTGGNETFLGKHPFSVQISVSLTFLVCMLILLTVFGNVMVVIAVITCRALKAPQNLFLVSLACADILVATLVMPFSLANELMGYWYFGKVWCEIHSALDVLFCTSSIIHLCAISLDRYWSVTKAIKYNLKRTQRMIKCTIGLVWVIAAIISFPPLI----TMKKNRGEANSPVCKINEEKWYILFSSIASFFAPCVIMIMVYVKIYQIVIRRTRAPPG--------------EKQVKNGNSPQTKDRNVDDLNDVKSQGINGLDMDEEPSSSDGNETCLRSLSRKIDVRKTDVTEAKPGEASPKAEALSPLRVSRWKGRQYRERRFTFVLAVVMGVFVLCWFPFFFTYTLTAVCDICCVPETLFKMFFWFGYCNSSLNPVIYTIFNDDFRKSFKRIL 384          
BLAST of GCR017 vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 177.948 bits (450), Expect = 4.464e-50
Identity = 138/377 (36.60%), Postives = 213/377 (56.50%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNP-----------------ELFRKKEVVEVDIEYTE-IQQNCNCNQVD------SEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRY-----RERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKC--MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   L+  QN FL SLA AD+L+  L++PFSL NE+ G W FG++ C ++LA+DVL CTASI HLC IS+DRY+SI + I+Y   RTP R+ ++I+  W+I+ +I  PPL      ++     S    C++   + YV+ S IGSF++P +I+++VY++++  AK+R       ++ +    P                  L  +K   E D+E  E +++  +  +V+       E+ S     D P     +      K R+ +++  +   +   + +K  R+     RE+R   VL VV+G F+VCW PFF +Y++   C    +   LF FFFW GYCNS LNPIIYT++N DFR+AF++IL
Sbjct:   33 GNVLVVIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGFWYFGKVWCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFPPLI-----TMEKENGSESPVCKINDEKWYVISSCIGSFFLPCIIMVLVYVRIYQIAKKRTRAPPGDRQQKGLSGPGAAAAGQRENGVGEPDDGLCHEKLNGEQDVELKEGVERGADEAKVEVNGGDMEESSSSDHKADHPCSIPKKS--AKGKTRLSQVKPGDADPQRRAQSAKASRWKGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYMLKTLCSSCYVPTALFNFFFWFGYCNSALNPIIYTIFNHDFRRAFKKIL 402          
BLAST of GCR017 vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 173.711 bits (439), Expect = 3.335e-48
Identity = 145/384 (37.76%), Postives = 215/384 (55.99%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKE----VVEVDIEYTEIQQNCNCNQVDSEAISCI------VDDDDPSVT----NNQEPLNSQKHR-------------IDRIQSKNI--------ISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCK--C-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN LV+IA+ T   LK  QN FL SLA AD+L+  L++PFSL NE+ G W FG++ C ++LA+DVL CT+SI+HLC IS+DRY+S+ + ++Y   RTP R+   I+  W++S  I  PPL          +  S++ +CEL     Y+L SSI SF+ P LI+I+VY++++  AK R          E K  P+   + E     V   +       +C+C    S+           VD ++ S +    +N +  +SQ+ R             I R+ +K++          + +  + K+ + RE+R   VL VV+G F++CW PFF SY +   C+  C + + LF FFFW+GYCNS LNP IYT++NRDFR AFQ+IL
Sbjct:   52 GNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSPPLVS----IDRNNDISSQPQCELNDETWYILSSSIASFFAPCLIMILVYIRIYQVAKTRTR-----SMSEKKPKPDGVTQTENGLSKVSSPLHGEAENGHCHCPPTPSQRTVTTGPQTQEVDVEESSSSEGKGHNPQRQDSQRARKARKSSFSKHSAHISRVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTFVLAVVMGVFVMCWFPFFFSYSLYGVCRDSCRIPDPLFKFFFWIGYCNSSLNPAIYTIFNRDFRHAFQKIL 426          
BLAST of GCR017 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 2.821e-45
Identity = 123/369 (33.33%), Postives = 206/369 (55.83%), Query Frame = 1
Query:  466 GNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXN------PELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPS--------VTNNQEPL------NSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC--KC-MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            GN+ V+ AI+ +  L+N+ N+ +GSLA+ DL++ +L+LP +   ++  +W  G+ +C L++++DVL CT+SI+HLC I++DRY++I  PI Y   RTP R + +I A W+I   I +PP+ GW     +    +N   C ++Q+  Y +YS+ G+FYIPL++++++Y ++F  A+ R  +     +     +      P  F KK   +         + C+ ++  S  ++  V   D          ++N++  L       S  H  + +  +N     +  K KL   RER+T+  LG+++G FI CWLPFF   L++ FC   C M + L     WLGY NS LNPIIY  +N+DF+ AF++I+
Sbjct:   59 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGW----RSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKIETAKVSDKCLAVSPAFFHKKSNGQSG---GRGWKRCDGSKPSSPCVNGAVMHGDEGESLEIIEVISNSKTHLPLPNTPQSSSHGYENMNERN-----SGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 415          
BLAST of GCR017 vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 160.614 bits (405), Expect = 2.252e-43
Identity = 120/352 (34.09%), Postives = 192/352 (54.55%), Query Frame = 1
Query:  469 NSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCEL-TQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFC-KCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMC 1518
            N+ V+  IS   +L+   N+ + SLAI DLL+ IL++P  +   +   W  G+++C +WL+ D+  CTASI+HLC+I++DRY++I   ++Y   RTP R   M+  AW+I+  I LPPLF W               C + T +  Y +YS+ G+FYIP L++I++Y ++++EA++R  +          ++P    K+      +    +  N   +   + ++ C           +  P +         Q K  +S   + K ++   RER+    LG+++GA+IVCWLPFF   L+V  C  C N+ LF FF WLGY NS +NPIIYT+ N DF+KAFQ+++    C
Sbjct:  111 NAFVIATISQSKKLQTPANFLIASLAITDLLVSILVMPICVLYTVIHTWTLGQIVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAAGMVATAWVIAISISLPPLF-WRQVKAEEL-----TSCSVNTDHIFYTIYSTFGAFYIPTLLLIVLYGRIYVEARKRILK----------QSPRKVGKR------LTSAHLVTNSPGSVASTTSLQC---------GRHDTPSSDTGSSTSDNQVKVTVSDALLEKKRISAARERKATKTLGIILGAYIVCWLPFFIYTLLVATCVACFNQELFDFFTWLGYLNSLINPIIYTMSNEDFKKAFQKLVRFRCC 431          
BLAST of GCR017 vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 399/400 (99.75%), Postives = 400/400 (100.00%), Query Frame = 1
Query:  352 MLNITDKNYSFVNELAYRPLEATXXXXXXXXXXXXXXAGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK 1551
            MLNITDKNYSFVNELAYRPLEATLISLSVILLLVLIVAGNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKL+RYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK
Sbjct:    1 MLNITDKNYSFVNELAYRPLEATLISLSVILLLVLIVAGNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLVRYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK 400          
BLAST of GCR017 vs. Planmine SMEST
Match: SMESG000056795.1 (SMESG000056795.1)

HSP 1 Score: 179.104 bits (453), Expect = 3.901e-51
Identity = 127/352 (36.08%), Postives = 200/352 (56.82%), Query Frame = 1
Query:  463 AGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCM-----NEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             GN LV++++     L+ +QN+ + SLA ADL +  L++PF+L N I GRWIFG +LC  WL  DV  CTASI++LC I++DRY++I  P+ Y   RT   +L++I  A+I+SGLI +PPL GW           N   C L+ NR YVL+S+ GSF IP ++I  VY++++   ++R       K   + +N  L  KKE V+               + DS+  S + ++           +N++      + + + +++    + K+   +ER++   +G+++G F++CW PFF  Y+IV FC        N+ +  F  WLGY NS LNPIIYT++N+DFR AF ++L
Sbjct:   31 VGNILVILSVIYHRPLRKVQNFLIISLAAADLSVASLVMPFALINYILGRWIFGSVLCDFWLTSDVFCCTASILNLCAIALDRYWAINYPLDYVNKRTIRTILSVICGAYILSGLISIPPLLGW------KEEMKNLYVCSLSDNRIYVLFSAFGSFIIPTVVIFFVYIRIYFAIRKRLRD----KIKFINQNDRLLMKKETVK-------------NKRKDSKENSSLENETCKITPTCSNKVNNENTNFSSVNNSDKLNQFWNERQKISLSKERKSARTMGIIMGVFVICWSPFFLMYVIVPFCSASVCQNRNQRVEVFLVWLGYVNSALNPIIYTIFNKDFRDAFHKLL 359          
BLAST of GCR017 vs. Planmine SMEST
Match: SMESG000017736.1 (SMESG000017736.1)

HSP 1 Score: 141.354 bits (355), Expect = 1.782e-36
Identity = 122/356 (34.27%), Postives = 183/356 (51.40%), Query Frame = 1
Query:  463 AGNSLVLIAISTDYRLKNIQNWXXXXXXXXXXXXXXXXXXXXXXNEIFG-RWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYL---IVIFCKCMNEHL-----FGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             GN LV++AI    +L+   NW + SLA +D  + +L++P +++N++   RW F  L C  ++  DVLLCT+SI++LC ISIDRY  I RP+QY   RTP  +   I  AWIISGLI +PP+  W               C+LT+N  Y +Y+++G+FYIPL+I++++Y ++F  A+  A               +L   +   E            N  + D + +       DP+    Q P    +     ++      K   RK K     E + I  LGV++G F +CWLPFF   +   I+I  K  +E       +  F WLGY NS LNP+IY  +NR+FR  F++IL
Sbjct:   53 GGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-------KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKR---------KLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRF-----DPT----QRPSEGNQGNGFDVEKTGTGPKTNPRKKKQ-SNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 382          
BLAST of GCR017 vs. Planmine SMEST
Match: SMESG000017113.1 (SMESG000017113.1)

HSP 1 Score: 137.887 bits (346), Expect = 1.091e-34
Identity = 107/313 (34.19%), Postives = 161/313 (51.44%), Query Frame = 1
Query:  607 GRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLN-SQKHRIDRIQSKNII----SKLAIR-KSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMNEHLFGFF--------FWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
             RW F  +LC ++++ DV+LCT+SI++LC ISIDRY  I RP+QY  +RTP R+  MI  +WI S LI +PPLFGW    +         +C  ++N  Y +Y++ G+FYIPLL+++I+Y                           +F+   V+  +    +I  + N +  + +    IVD    S  N Q  L+      +  I+S N      +KL  R ++K+    E + I  LGV++G F +CWLPFF   +     K  + +   +F         WLGY NS LNPIIY  +NR+FR  F++IL
Sbjct:  103 SRWPFSEILCDVFISFDVILCTSSILNLCAISIDRYLVITRPLQYAVNRTPARISLMIAISWIASALISIPPLFGWKETFI-------PGQCSYSENLLYQIYATFGAFYIPLLVMLILYG-------------------------RIFKLARVLAQNDAKMKIGISPNSSDREHQPNLRIVDSHLCSTPNGQMNLSLYSGSLVSIIKSTNFSESSQNKLNNRSRAKIKSSTETKAITTLGVIMGCFTICWLPFFIIQIAKPILKVASVNSVNYFPIWLIEICLWLGYFNSFLNPIIYAKFNREFRTPFKQIL 383          
BLAST of GCR017 vs. Planmine SMEST
Match: SMESG000045237.1 (SMESG000045237.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.047e-33
Identity = 96/308 (31.17%), Postives = 162/308 (52.60%), Query Frame = 1
Query:  607 GRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWXXXXXXXXXXXNEQKCELTQNRAYVLYSSIGSXXXXXXXXXXXXXXXXXEAKRRANRXXXXXXXXXXXNPELFRKKEVVEVDIEYTEIQQN-CNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLIRYRERRTIXXXXXXXXAFIVCWLPFFTSYLIVIFCKCMN--------EHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 1503
            G W F    C +++ +DVLLC++SI++LC ISIDRY  I +P+QY + RT  ++  MI+  W +SGLI +PP+ GW    +         KC  ++N  Y +Y++ G+FYIPL+I++++Y ++F   +    +   + K   +   ++ +  ++ +  +    +++N C    +  ++ +  +D    +++N +E    Q                  +K++   Y E + I  LGV++G F +CWLPFF   LI    K  N        + +   F WLGY NS LNPIIY  +NR+FR  F+ IL
Sbjct:   97 GHWPFSETFCDIFICLDVLLCSSSILNLCAISIDRYLIITKPLQYGSRRTLKQMFLMILLVWFLSGLISIPPVIGWKEGFI-------PGKCIYSENLGYQIYATCGAFYIPLIIMLVLYGRIFKLTQSMVKKDAKLHKRASRYASDVLKMPDLNDDSV----VKENMCKRLSLSDQSSNDWMDSKKLAISNAKEEFIKQ-----------------YKKTEKANYAENKAITTLGVIMGCFTICWLPFFVIQLIKPLLKVANIDSNLYISQWIQDMFLWLGYLNSFLNPIIYAKFNREFRTPFKLIL 376          
The following BLAST results are available for this feature:
BLAST of GCR017 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA2A9.143e-4934.61adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
HTR1A3.418e-4434.485-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1B4.089e-4033.885-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
ADRA1A7.663e-3833.52adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A7.937e-3833.52adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR017 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
octr-13.478e-5437.47OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-17.235e-5437.27OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
ser-21.083e-3632.95Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-22.871e-3431.53Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-23.103e-3431.53Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of GCR017 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Octbeta1R5.754e-3932.29gene:FBgn0038980 transcript:FBtr0100322[more]
Octbeta1R7.973e-3932.29gene:FBgn0038980 transcript:FBtr0301484[more]
Octbeta1R3.263e-3832.29gene:FBgn0038980 transcript:FBtr0331930[more]
Octbeta1R3.263e-3832.29gene:FBgn0038980 transcript:FBtr0084260[more]
Octalpha2R1.225e-3756.77gene:FBgn0038653 transcript:FBtr0332809[more]
back to top
BLAST of GCR017 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FP236542.17.896e-5539.29alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
FP236542.17.896e-5539.29alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
adra2c6.845e-5235.99adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
adra2c6.916e-5235.99adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
adra2c6.916e-5235.99adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
back to top
BLAST of GCR017 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA2B3.387e-5239.79adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
ENSXETT00000026158.15.654e-4937.92alpha-2Db adrenergic receptor-like [Source:NCBI ge... [more]
adra2c7.574e-4635.68adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145... [more]
ENSXETT00000046867.12.550e-4233.695-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
HTR1B6.604e-4033.335-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
back to top
BLAST of GCR017 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a3.650e-4532.895-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr1b2.046e-4134.535-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1b2.046e-4134.535-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Adra1a2.015e-3734.07adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Htr1f2.260e-3732.655-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
back to top
BLAST of GCR017 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90WY6|ADA2C_DANRE5.221e-5135.99Alpha-2C adrenergic receptor OS=Danio rerio OX=795... [more]
sp|Q28838|ADA2A_BOVIN9.231e-5136.62Alpha-2A adrenergic receptor OS=Bos taurus OX=9913... [more]
sp|P18871|ADA2A_PIG1.630e-4837.06Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823... [more]
sp|P22909|ADA2A_RAT1.698e-4836.29Alpha-2A adrenergic receptor OS=Rattus norvegicus ... [more]
sp|P08913|ADA2A_HUMAN4.391e-4834.61Alpha-2A adrenergic receptor OS=Homo sapiens OX=96... [more]
back to top
BLAST of GCR017 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU630.000e+0100.00GCR017 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A1I8HM966.622e-6544.10G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
V3ZDW81.376e-5941.53G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
J9PFH21.489e-5739.63Adrenergic receptor protein OS=Crassostrea angulat... [more]
R7U1G55.062e-5739.49G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
back to top
BLAST of GCR017 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2a6.940e-5337.53adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
adra2b5.340e-5038.85adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751... [more]
adra2db6.433e-4734.20alpha-2Da adrenergic receptor-like [Source:NCBI ge... [more]
htr1ab4.456e-4133.065-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSAMXT00000006138.25.419e-4134.07pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
back to top
BLAST of GCR017 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2c1.349e-5037.85adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
HTR1F1.077e-3831.235-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000009127.11.858e-2739.35pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000001357.12.499e-2638.46pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
ENSPMAT00000008360.13.941e-2653.28pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
back to top
BLAST of GCR017 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR017 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447401.402e-1624.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493671.761e-1242.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411425.973e-1233.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466811.348e-1130.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445781.501e-1131.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR017 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007440.23.038e-5236.59alpha-2A adrenergic receptor-like [Source:NCBI gen... [more]
adra2a4.464e-5036.60adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
ADRA2C3.335e-4837.76adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
ENSORLT00000005282.22.821e-4533.33pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
HTR1B2.252e-4334.095-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
back to top
BLAST of GCR017 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044639.10.000e+099.75SMESG000044639.1[more]
SMESG000056795.13.901e-5136.08SMESG000056795.1[more]
SMESG000017736.11.782e-3634.27SMESG000017736.1[more]
SMESG000017113.11.091e-3434.19SMESG000017113.1[more]
SMESG000045237.11.047e-3331.17SMESG000045237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010349 ID=SMED30010349|Name=GCR017|organism=Schmidtea mediterranea sexual|type=transcript|length=1604bp
TTCCGATCTGAAATAAATCTGCTGCTTCTGCTTTCTGTAAAAGATTCGAC
AAGACAATTACTCAAAGTTGTATCGGATTACTTCGAATGCAAACAGACTG
TTTGTGATTTGATTGGCTGCCTCATCGACCAATAGCAAGCAAAGAAAATC
GACATCTCTAATTTCTATTATATTTTGAATTAATCCAAACCTATAACTCG
AAGATGGTAAATCACTGGTGCAATATTTATGAAACAATATTAATTTGGAA
TATTTAAACAGATTGTAACAGACAATCGTAAAGCCATTCTATGTCCGGGT
TGAATTTCTAACTTTGTCCTTTGTGGATCTGGCATATATATCCGAGTTCC
AATGTTGAATATTACTGACAAAAACTATTCTTTTGTCAACGAGTTAGCCT
ATCGCCCATTGGAAGCCACCCTCATAAGCTTGTCTGTGATTTTACTATTA
GTATTAATAGTTGCCGGAAATTCTTTAGTTCTAATAGCTATTTCTACTGA
TTATCGCCTGAAGAACATTCAGAACTGGTTTCTTGGATCTTTGGCCATTG
CAGATTTACTGTTAGGAATTTTGATCTTGCCATTTTCATTATTTAATGAG
ATATTCGGCCGTTGGATATTTGGAAGACTTTTGTGCTCTCTTTGGTTGGC
AATTGACGTCCTTTTGTGTACTGCGTCTATAATGCATTTGTGTTTGATTA
GTATAGATAGATACTATTCCATTGTCAGGCCCATACAGTACAAGACATCA
AGGACTCCCAACCGAGTGCTTGCCATGATTATTGCGGCATGGATTATATC
TGGATTAATATGCTTACCGCCACTTTTTGGTTGGAGTAGTCATTCTTTAA
ATTTTTCCATCTCCTCGAATGAACAGAAATGTGAATTGACCCAAAACCGA
GCCTATGTTCTATACTCATCAATTGGATCGTTTTACATTCCACTACTCAT
CATTATCATTGTGTATTTGCAAGTCTTTATTGAAGCCAAGCGAAGAGCCA
ATCGAAAGTATGTTGTCAAAAAACCGGAAGTGAAAAAAAATCCGGAGCTC
TTCAGAAAAAAGGAAGTTGTTGAAGTAGATATTGAATATACGGAAATCCA
ACAGAATTGTAATTGCAATCAGGTAGATTCTGAAGCAATTTCTTGTATTG
TTGACGATGACGACCCGTCTGTGACAAATAATCAGGAACCGTTGAATTCT
CAGAAGCATCGAATAGACAGAATCCAATCGAAAAACATCATATCAAAACT
GGCGATTCGAAAAAGTAAACTTATTCGTTATCGAGAACGTCGGACAATAG
TTGTATTGGGGGTCGTTGTGGGGGCATTTATTGTGTGTTGGCTGCCGTTT
TTCACCTCCTATTTGATTGTGATTTTCTGTAAATGCATGAATGAGCATTT
ATTTGGATTTTTCTTCTGGTTGGGTTACTGCAATAGCGGCTTGAATCCAA
TTATATATACTGTATACAATCGAGACTTTAGAAAAGCTTTTCAAAGAATA
TTGTCCATGATAATGTGTTCAAATAAATACGATTCCAGGCGAATGATCAA
GAATTTCAATTTATAATAATTGTTTGATATTTTTCTAATAAATGTGCAGA
TCGG
back to top

protein sequence of SMED30010349-orf-1

>SMED30010349-orf-1 ID=SMED30010349-orf-1|Name=SMED30010349-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MLNITDKNYSFVNELAYRPLEATLISLSVILLLVLIVAGNSLVLIAISTD
YRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLA
IDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIIS
GLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLI
IIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQ
QNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNSQKHRIDRIQSKNIISKL
AIRKSKLIRYRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHL
FGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIMCSNKYDSRRMIK
NFNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002233ADR_fam
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0071875adrenergic receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004935adrenergic receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002233Adrenoceptor familyPRINTSPR01103ADRENERGICRcoord: 375..384
score: 67.97
coord: 130..138
score: 40.11
coord: 205..212
score: 43.43
coord: 77..88
score: 46.89
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 315..339
score: 32.43
coord: 102..124
score: 37.48
coord: 138..159
score: 27.04
coord: 24..48
score: 26.69
coord: 57..78
score: 36.28
coord: 351..377
score: 37.04
coord: 186..209
score: 30.38
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 33..384
e-value: 1.3E-4
score: -41.5
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 39..369
e-value: 6.7E-77
score: 258.4
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 108..124
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 217..306
e-value: 3.1E-108
score: 364.1
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 31..381
e-value: 3.1E-108
score: 364.1
NoneNo IPR availablePANTHERPTHR24248ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 17..385
NoneNo IPR availablePANTHERPTHR24248:SF66coord: 17..385
NoneNo IPR availableCDDcd150597tmA_alpha2_ARcoord: 38..380
e-value: 1.96629E-102
score: 302.339
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 11..396
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 39..369
score: 47.614