major facilitator superfamily domain-containing protein 1

Overview
Namemajor facilitator superfamily domain-containing protein 1
Smed IDSMED30010337
Length (bp)1825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of major facilitator superfamily domain-containing protein 1 (SMED30010337) t-SNE clustered cells

Violin plots show distribution of expression levels for major facilitator superfamily domain-containing protein 1 (SMED30010337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of major facilitator superfamily domain-containing protein 1 (SMED30010337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for major facilitator superfamily domain-containing protein 1 (SMED30010337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010337

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010337SMESG000017192.1 Contig2643GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30010337SMESG000017192.1 dd_Smed_v4_1829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30010337SMESG000017192.1 dd_Smed_v4_1829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010337SMESG000017192.1 dd_Smed_v4_1829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Match: MFSD1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 436.802 bits (1122), Expect = 7.997e-148
Identity = 243/438 (55.48%), Postives = 306/438 (69.86%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   34 CDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Match: MFSD1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 436.802 bits (1122), Expect = 7.997e-148
Identity = 243/438 (55.48%), Postives = 306/438 (69.86%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   34 CDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Match: MFSD1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 436.417 bits (1121), Expect = 5.228e-147
Identity = 243/438 (55.48%), Postives = 306/438 (69.86%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   83 CDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 513          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Match: MFSD1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 354.369 bits (908), Expect = 2.651e-116
Identity = 210/438 (47.95%), Postives = 269/438 (61.42%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL F  +       A+  L+   L L                                   G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   34 CDPSRLAHRLLVLLLMCFLGFAIF-------AMIILLPFRLKLN--------------------------------EWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 425          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Match: MFSD1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 353.984 bits (907), Expect = 1.817e-115
Identity = 210/438 (47.95%), Postives = 269/438 (61.42%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL F  +       A+  L+   L L                                   G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   83 CDPSRLAHRLLVLLLMCFLGFAIF-------AMIILLPFRLKLN--------------------------------EWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 474          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Match: mrva (gene:FBgn0035763 transcript:FBtr0076884)

HSP 1 Score: 418.313 bits (1074), Expect = 7.327e-141
Identity = 220/465 (47.31%), Postives = 308/465 (66.24%), Query Frame = 2
Query:   89 DSESQEILYQDDETLTGCGA-----SLP----CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYG--FLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEE 1450
            D+E      ++D+ ++  G      SLP    C P    HR++ L  +C L FGSYFCYD P AL++    DLNLT++ +   YS YSWPNVVL F+GGFLIDR+FGIRLG II+ + +L GQ  FA G  +D++++ + GRF+FG+G ESLAVAQN+YA  WFK  ELN +FGLQLS++R GSTVN   M PIY  +      GH  LG  L +A+ TCV S+ CAL+L + DKRAE+IL+R +  +  +   L D+  F   FW++S ICV YYVA+FPFI+L + F + ++ LS  +A  + SL+Y+I+A  SPV GF+ID  G+N+ WV T TL T+GAHAL  FT   P   MI +G+SYS+LA+SLWP+VAL++P +Q GTA+G  QS+QNLGLAV+ I+AG+I D  G   + L++FF  WL +A+    +++ ++ +N   LN +   R + ++ E 
Sbjct:   11 DNEEVSRPTEEDQVVSRAGRRDNELSLPSGGCCMPSSTSHRFMALVFMCLLGFGSYFCYDAPGALQNYFKKDLNLTSAQFTLIYSIYSWPNVVLCFVGGFLIDRLFGIRLGTIIYMMILLVGQLIFACGGILDAFWMMILGRFIFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGSTVNFWVMQPIYEYVS-NFYKGHTALGVVLLLATLTCVMSMTCALILGWMDKRAERILQRNNNPA-GQIPKLTDVFSFKPPFWMVSIICVAYYVAIFPFIALGQNFFVDRFGLSPAEANTVDSLVYLIAAVSSPVFGFIIDKLGRNVTWVFTATLTTIGAHALLTFTQLTPYVGMIIMGLSYSMLAASLWPLVALIIPEYQLGTAYGFCQSIQNLGLAVITIVAGIIVDHSGGEHMWLQLFFMGWLTIALISTGVIWAYNNKNRGNLNMTPQQRAQFVSAEN 473          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Match: mrva (gene:FBgn0035763 transcript:FBtr0332734)

HSP 1 Score: 418.313 bits (1074), Expect = 7.327e-141
Identity = 220/465 (47.31%), Postives = 308/465 (66.24%), Query Frame = 2
Query:   89 DSESQEILYQDDETLTGCGA-----SLP----CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYG--FLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEE 1450
            D+E      ++D+ ++  G      SLP    C P    HR++ L  +C L FGSYFCYD P AL++    DLNLT++ +   YS YSWPNVVL F+GGFLIDR+FGIRLG II+ + +L GQ  FA G  +D++++ + GRF+FG+G ESLAVAQN+YA  WFK  ELN +FGLQLS++R GSTVN   M PIY  +      GH  LG  L +A+ TCV S+ CAL+L + DKRAE+IL+R +  +  +   L D+  F   FW++S ICV YYVA+FPFI+L + F + ++ LS  +A  + SL+Y+I+A  SPV GF+ID  G+N+ WV T TL T+GAHAL  FT   P   MI +G+SYS+LA+SLWP+VAL++P +Q GTA+G  QS+QNLGLAV+ I+AG+I D  G   + L++FF  WL +A+    +++ ++ +N   LN +   R + ++ E 
Sbjct:   11 DNEEVSRPTEEDQVVSRAGRRDNELSLPSGGCCMPSSTSHRFMALVFMCLLGFGSYFCYDAPGALQNYFKKDLNLTSAQFTLIYSIYSWPNVVLCFVGGFLIDRLFGIRLGTIIYMMILLVGQLIFACGGILDAFWMMILGRFIFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGSTVNFWVMQPIYEYVS-NFYKGHTALGVVLLLATLTCVMSMTCALILGWMDKRAERILQRNNNPA-GQIPKLTDVFSFKPPFWMVSIICVAYYVAIFPFIALGQNFFVDRFGLSPAEANTVDSLVYLIAAVSSPVFGFIIDKLGRNVTWVFTATLTTIGAHALLTFTQLTPYVGMIIMGLSYSMLAASLWPLVALIIPEYQLGTAYGFCQSIQNLGLAVITIVAGIIVDHSGGEHMWLQLFFMGWLTIALISTGVIWAYNNKNRGNLNMTPQQRAQFVSAEN 473          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Match: CG12194 (gene:FBgn0031636 transcript:FBtr0332476)

HSP 1 Score: 406.371 bits (1043), Expect = 4.353e-136
Identity = 215/440 (48.86%), Postives = 296/440 (67.27%), Query Frame = 2
Query:  113 YQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYG--FLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSR 1426
            +Q D    GC     CDP    HR+L L  +C L FGSYFCYDNP AL+D+   +L L+++ +   YS YSWPN+VL F+GGFLIDRVFGIRLG II+ L VL GQ  FA G  +  ++L + GRF+FG+G ESLAVAQN+YA  WFK  E+N +FGLQLS++R GSTVN   M P+Y  +     +G+K LG ALF+AS+TCV SL+C L+L + DKRAE+ILKR + +   E   L DI  F + FW++S +CV YYVA+FPF++L + F +  + ++  +A  + S++Y+ISA  SP+ GF+ID  G+N+ WV   T++TL AH L  FT  +P   M  +G+SYS+LA+SLWP+V+L+VP +Q GTA+G  QSVQNLGLAVV I AG+I D  G     L+VFF  +L +++     ++ ++ ++   LN S   R
Sbjct:   42 HQKD---AGC-----CDPTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIYSIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGHFWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGSTVNFWIMQPLYGYVS-KSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDKRAERILKR-NNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALGQAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCATISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLGTAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLATCAIWAYNRKHQGNLNMSPAQR 471          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Match: CG12194 (gene:FBgn0031636 transcript:FBtr0077385)

HSP 1 Score: 406.371 bits (1043), Expect = 4.353e-136
Identity = 215/440 (48.86%), Postives = 296/440 (67.27%), Query Frame = 2
Query:  113 YQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYG--FLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSR 1426
            +Q D    GC     CDP    HR+L L  +C L FGSYFCYDNP AL+D+   +L L+++ +   YS YSWPN+VL F+GGFLIDRVFGIRLG II+ L VL GQ  FA G  +  ++L + GRF+FG+G ESLAVAQN+YA  WFK  E+N +FGLQLS++R GSTVN   M P+Y  +     +G+K LG ALF+AS+TCV SL+C L+L + DKRAE+ILKR + +   E   L DI  F + FW++S +CV YYVA+FPF++L + F +  + ++  +A  + S++Y+ISA  SP+ GF+ID  G+N+ WV   T++TL AH L  FT  +P   M  +G+SYS+LA+SLWP+V+L+VP +Q GTA+G  QSVQNLGLAVV I AG+I D  G     L+VFF  +L +++     ++ ++ ++   LN S   R
Sbjct:   42 HQKD---AGC-----CDPTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIYSIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGHFWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGSTVNFWIMQPLYGYVS-KSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDKRAERILKR-NNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALGQAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCATISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLGTAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLATCAIWAYNRKHQGNLNMSPAQR 471          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Match: CG12194 (gene:FBgn0031636 transcript:FBtr0300756)

HSP 1 Score: 406.757 bits (1044), Expect = 4.587e-136
Identity = 215/440 (48.86%), Postives = 296/440 (67.27%), Query Frame = 2
Query:  113 YQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYG--FLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSR 1426
            +Q D    GC     CDP    HR+L L  +C L FGSYFCYDNP AL+D+   +L L+++ +   YS YSWPN+VL F+GGFLIDRVFGIRLG II+ L VL GQ  FA G  +  ++L + GRF+FG+G ESLAVAQN+YA  WFK  E+N +FGLQLS++R GSTVN   M P+Y  +     +G+K LG ALF+AS+TCV SL+C L+L + DKRAE+ILKR + +   E   L DI  F + FW++S +CV YYVA+FPF++L + F +  + ++  +A  + S++Y+ISA  SP+ GF+ID  G+N+ WV   T++TL AH L  FT  +P   M  +G+SYS+LA+SLWP+V+L+VP +Q GTA+G  QSVQNLGLAVV I AG+I D  G     L+VFF  +L +++     ++ ++ ++   LN S   R
Sbjct:   42 HQKD---AGC-----CDPTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIYSIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGHFWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGSTVNFWIMQPLYGYVS-KSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDKRAERILKR-NNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALGQAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCATISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLGTAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLATCAIWAYNRKHQGNLNMSPAQR 471          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Zebrafish
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 321.627 bits (823), Expect = 2.347e-103
Identity = 201/442 (45.48%), Postives = 266/442 (60.18%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEAT-GHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAAC-------SPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSV----LASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQE 1447
            CDP   LHR LVL  +CFL FGSYFCYD     +  +  D+NL  +S+M  Y+WYSWPNVVL F+GGFL+DRVFGIRLG +IFSLFVL GQ  FA GA  + ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N +  +Y  +Q+   + G   LG  L +A++TC+FSLICALVL F DKRAE+IL  K +    E I L D++ FSV+ WLI  ICV YYV +F  I + KV L       G +   I  +       C       + + GF +  + + +  V          H+L++F   +P        ++YS+    ++   W       P HQ  T    MQS+QNLGLAV++I AG I D  G+L LEVFF   LC+A+  +V+LYL+D      LN S  +R ++   E
Sbjct:   32 CDPNHLLHRILVLIFMCFLGFGSYFCYDICNPYQTHLNQDMNLNTASFMQLYAWYSWPNVVLCFLGGFLLDRVFGIRLGTVIFSLFVLVGQIIFAAGALANHFWLMNVGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNVIGWVYGRIQMSMGSAGPTTLGITLMIAASTCLFSLICALVLGFLDKRAERILN-KEQGKTGEVIKLTDVKDFSVSLWLIFIICVAYYVRIFISIGIMKVML-------GNQNVHIKVVQEAFQCVCVENTGELTSLAGFTVKSNNEQILIVRLCGHTYSSIHSLFSFQL-SPFINQGSHNLAYSIHLYRMSLDFWWK-----PEHQEETLSNTMQSIQNLGLAVMSIAAGSILDVRGYLFLEVFFIACLCMALLAVVLLYLFDYYKEGGLNLSAATRSKRAKPE 459          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Zebrafish
Match: im:7160594 (im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43])

HSP 1 Score: 150.984 bits (380), Expect = 3.252e-39
Identity = 117/357 (32.77%), Postives = 181/357 (50.70%), Query Frame = 2
Query:  167 KRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLN----------------LTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYID--SYYLCVF--GRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSK-DSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYS-LSGPKAALITSLLYIISAACSPVMGFLIDFSG-KNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLA 1168
            ++  +R++VLF  C L+FGSYFC+D P+ L++    +L                 +T   Y   Y+ Y+W N V+  + GFLID++ G R G  +FS   + G   FA G++    +Y L +   GR LFG G  SL + QN   + WF+  EL   FGL L+ SR+GS +N       + + +     G +     L+  +  CV   + A+ +S  DK   K L        E+ K+ ++D++  S+ +WL+    + +Y  +FPFI+ +  F+  KYS  S  +AA I   +Y  S   +  +G LID+ G + +F VL   L TL    L AFTF  PL   ++LGI+YS  A
Sbjct:    6 EQAYYRFVVLFFNCMLTFGSYFCFDIPSVLQEQFQGNLTCPNGTVSNRTCVEGLGMTPQEYNLLYAIYAWTNAVVVIMAGFLIDKL-GNRFGVFLFSFLTVLGSAIFALGSHFKGTTYLLPLMLTGRLLFGSGNGSLTIVQNRITAFWFRGKELALAFGLTLAFSRLGSVLNF------FLTQRFESQYGMQW---TLWGGTLLCVLGFLSAVTVSVLDKMGMKQLGLDGAIQEESRKVRVQDVKRLSLRYWLLVLTIMFFYNGIFPFIADASTFIQDKYSGYSQKEAAYIAGAVYDSSLVLAAAVGILIDYVGLRGVFAVLCAVL-TLPVFGLLAFTFVPPLVSTVWLGITYSFAA 351          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Match: arf1 (ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-GENE-950251])

HSP 1 Score: 483.797 bits (1244), Expect = 2.177e-166
Identity = 253/458 (55.24%), Postives = 320/458 (69.87%), Query Frame = 2
Query:   83 MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEV 1453
            M D E +E L            +  CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  + +D+ +  + +M  Y++YSWPNVVL F GGFLIDRVFGIRLG IIFSLFV  GQ  FA GA +++++L   GR +FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+RVGSTVN+N M  +Y+ ++    A G+  LG  L + + TC+FSLICALVL + DKRAEKIL  K +    E I L D++ FS++ WLI  ICV YYVAVFPFI L KVF I+K+  S  +A  I S++YIISA  SPV+GF++D  GKN+ WV+   + TL +H + AFTF NP   M  LGISYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++AI+AGVI D  G+L LEVFFS  LC+A+  +V+LY  +L  G  LN S + R++   Q  +
Sbjct:    1 MADDEDRETLLPGAAGSRKRDMAAICDPSRFAHRVVVLALMCFLGFGSYFCYDNPAALQTQVQADMKVNTADFMQLYAFYSWPNVVLCFFGGFLIDRVFGIRLGTIIFSLFVCVGQVIFATGALVNAFWLMEAGRLVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARVGSTVNMNVMGLVYSRIKDHMGAAGYSTLGVTLMIGAVTCIFSLICALVLGYLDKRAEKILD-KEQGKTGEVIQLTDVKDFSLSLWLIFIICVCYYVAVFPFIGLGKVFFIEKFQFSPLQAGAINSVVYIISAPLSPVLGFMVDRVGKNIIWVMCAVVTTLASHLMLAFTFWNPWIAMSLLGISYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIIAIVAGVILDASGYLFLEVFFSACLCMAIIAVVMLYFVNLLRGGDLNLSAWEREKLQKQAAI 457          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Match: arf1 (ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-GENE-950251])

HSP 1 Score: 484.182 bits (1245), Expect = 8.613e-166
Identity = 253/462 (54.76%), Postives = 321/462 (69.48%), Query Frame = 2
Query:   83 MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQ 1465
            M D E +E L            +  CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  + +D+ +  + +M  Y++YSWPNVVL F GGFLIDRVFGIRLG IIFSLFV  GQ  FA GA +++++L   GR +FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+RVGSTVN+N M  +Y+ ++    A G+  LG  L + + TC+FSLICALVL + DKRAEKIL  K +    E I L D++ FS++ WLI  ICV YYVAVFPFI L KVF I+K+  S  +A  I S++YIISA  SPV+GF++D  GKN+ WV+   + TL +H + AFTF NP   M  LGISYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++AI+AGVI D  G+L LEVFFS  LC+A+  +V+LY  +L  G  LN S + R++   Q  +   +
Sbjct:    1 MADDEDRETLLPGAAGSRKRDMAAICDPSRFAHRVVVLALMCFLGFGSYFCYDNPAALQTQVQADMKVNTADFMQLYAFYSWPNVVLCFFGGFLIDRVFGIRLGTIIFSLFVCVGQVIFATGALVNAFWLMEAGRLVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARVGSTVNMNVMGLVYSRIKDHMGAAGYSTLGVTLMIGAVTCIFSLICALVLGYLDKRAEKILD-KEQGKTGEVIQLTDVKDFSLSLWLIFIICVCYYVAVFPFIGLGKVFFIEKFQFSPLQAGAINSVVYIISAPLSPVLGFMVDRVGKNIIWVMCAVVTTLASHLMLAFTFWNPWIAMSLLGISYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIIAIVAGVILDASGYLFLEVFFSACLCMAIIAVVMLYFVNLLRGGDLNLSAWEREKLQKQAAIEAEK 461          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Match: arf1 (ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-GENE-950251])

HSP 1 Score: 429.483 bits (1103), Expect = 1.241e-145
Identity = 234/441 (53.06%), Postives = 298/441 (67.57%), Query Frame = 2
Query:   83 MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSK 1402
            M D E +E L            +  CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  + +D+ +  + +M  Y++YSWPNVVL F GGFLIDR             F+  G+  FA GA +++++L   GR +FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+RVGSTVN+N M  +Y+ ++    A G+  LG  L + + TC+FSLICALVL + DKRAEKIL  K +    E I L D++ FS++ WLI  ICV YYVAVFPFI L KVF I+K+  S  +A  I S++YIISA  SPV+GF++D  GKN+ WV+   + TL +H + AFTF NP   M  LGISYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++AI+AGVI D  G+L LEVFFS   CL+V   V+LY  +L  G +
Sbjct:    1 MADDEDRETLLPGAAGSRKRDMAAICDPSRFAHRVVVLALMCFLGFGSYFCYDNPAALQTQVQADMKVNTADFMQLYAFYSWPNVVLCFFGGFLIDR-------------FLYPGKVIFATGALVNAFWLMEAGRLVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARVGSTVNMNVMGLVYSRIKDHMGAAGYSTLGVTLMIGAVTCIFSLICALVLGYLDKRAEKILD-KEQGKTGEVIQLTDVKDFSLSLWLIFIICVCYYVAVFPFIGLGKVFFIEKFQFSPLQAGAINSVVYIISAPLSPVLGFMVDRVGKNIIWVMCAVVTTLASHLMLAFTFWNPWIAMSLLGISYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIIAIVAGVILDASGYLFLEVFFSA--CLSV---VMLYFVNLLRGKQ 422          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Match: arf1 (ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-GENE-950251])

HSP 1 Score: 425.246 bits (1092), Expect = 6.016e-144
Identity = 229/416 (55.05%), Postives = 291/416 (69.95%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPE-ATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSK 1402
            CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  + +D+ +  + +M  Y++YSWPNVVL F GGFLIDR             F+  G+  FA GA +++++L   GR +FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+RVGSTVN+N M  +Y+ ++    A G+  LG  L + + TC+FSLICALVL + DKRAEKIL  K +    E I L D++ FS++ WLI  ICV YYVAVFPFI L KVF I+K+  S  +A  I S++YIISA  SPV+GF++D  GKN+ WV+   + TL +H + AFTF NP   M  LGISYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++AI+AGVI D  G+L LEVFFS   CL+V   V+LY  +L  G +
Sbjct:   25 CDPSRFAHRVVVLALMCFLGFGSYFCYDNPAALQTQVQADMKVNTADFMQLYAFYSWPNVVLCFFGGFLIDR-------------FLYPGKVIFATGALVNAFWLMEAGRLVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARVGSTVNMNVMGLVYSRIKDHMGAAGYSTLGVTLMIGAVTCIFSLICALVLGYLDKRAEKILD-KEQGKTGEVIQLTDVKDFSLSLWLIFIICVCYYVAVFPFIGLGKVFFIEKFQFSPLQAGAINSVVYIISAPLSPVLGFMVDRVGKNIIWVMCAVVTTLASHLMLAFTFWNPWIAMSLLGISYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIIAIVAGVILDASGYLFLEVFFSA--CLSV---VMLYFVNLLRGKQ 421          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Match: arf1 (ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-GENE-950251])

HSP 1 Score: 408.683 bits (1049), Expect = 7.026e-138
Identity = 224/422 (53.08%), Postives = 282/422 (66.82%), Query Frame = 2
Query:   83 MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPE-ATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLC 1345
            M D E +E L            +  CDP R  HR +VL L+CFL FGSYFCYDNPAAL+   + D+ +  + +M  Y++YSWPNVVL F GGFLIDR          +SL              +++++L   GR +FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+RVGSTVN+N M  +Y+ ++    A G+  LG  L + + TC+FSLICALVL + DKRAEKIL  K +    E I L D++ FS++ WLI  ICV YYVAVFPFI L KVF I+K+  S  +A  I S++YIISA  SPV+GF++D  GKN+ WV+   + TL +H + AFTF NP   M  LGISYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++AI+AGVI D  G+L LEVFFS  LC
Sbjct:    1 MADDEDRETLLPGAAGSRKRDMAAICDPSRFAHRVVVLALMCFLGFGSYFCYDNPAALQT-QVQDMKVNTADFMQLYAFYSWPNVVLCFFGGFLIDRAI------CDYSL--------------VNAFWLMEAGRLVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARVGSTVNMNVMGLVYSRIKDHMGAAGYSTLGVTLMIGAVTCIFSLICALVLGYLDKRAEKILD-KEQGKTGEVIQLTDVKDFSLSLWLIFIICVCYYVAVFPFIGLGKVFFIEKFQFSPLQAGAINSVVYIISAPLSPVLGFMVDRVGKNIIWVMCAVVTTLASHLMLAFTFWNPWIAMSLLGISYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIIAIVAGVILDASGYLFLEVFFSACLC 400          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Mouse
Match: Mfsd1 (major facilitator superfamily domain containing 1 [Source:MGI Symbol;Acc:MGI:1914118])

HSP 1 Score: 456.833 bits (1174), Expect = 6.319e-156
Identity = 246/462 (53.25%), Postives = 316/462 (68.40%), Query Frame = 2
Query:   86 NDSESQEIL---YQDDETLTGCGASLP--CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR-KLAQEE 1450
             D E + +L    + D  + G   +L   CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F+GGFLIDR+FGIR G +IFS FV  GQ  FA G   ++++L   GRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y  ++ L  + GH  LG  L +   TC+FSLICAL L++ D+RAEKIL  K +    E I L+DI+ FS+   L+  ICV YYVAVFPFI L KVF ++K+  S   A+ I S++YIISA  SP+ G L+D +GKN+ WVL    ATL +H + AFTF NP   M  LG SYS+LA +LWPMVA +VP HQ GTA+G MQS+QNLGLAV+AI+AG+I D  G+L+LEVFF   + L++  +V LYL +   G  LN S   R+R KL+  E
Sbjct:    4 EDGEDRALLGGRREADSAVHGAPRALSALCDPSRLAHRLVVLSLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFLGGFLIDRIFGIRWGTVIFSCFVCIGQVIFALGGIFNAFWLMELGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYGKIEALLGSAGHMTLGVTLMIGCITCIFSLICALALAYLDRRAEKIL-HKEQGKTGEVIKLRDIKDFSLPLILVFVICVCYYVAVFPFIGLGKVFFMEKFRFSSQSASAINSIVYIISAPMSPLFGLLVDKTGKNIIWVLYAVAATLVSHMMLAFTFWNPWIAMCLLGFSYSLLACALWPMVAFIVPEHQLGTAYGFMQSIQNLGLAVIAILAGMILDSKGYLLLEVFFIACVSLSLLAVVCLYLVNRAQGGNLNYSAKQRERMKLSHPE 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q32LQ6|MFSD1_DANRE (Major facilitator superfamily domain-containing protein 1 OS=Danio rerio OX=7955 GN=mfsd1 PE=2 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 1.521e-156
Identity = 244/431 (56.61%), Postives = 313/431 (72.62%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEAT-GHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQE 1447
            CDP   LHR LVL  +CFL FGSYFCYDNPAAL+  ++ D+NL  +S+M  Y+WYSWPNVVL F+GGFL+DRVFGIRLG +IFSLFVL GQ  FA GA  + ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N +  +Y  +Q+   + G   LG  L +A++TC+FSLICALVL F DKRAE+IL  K +    E I L D++ FSV+ WLI  ICV YYVA+FPFI L +VF I+K+  +  +A  I S++YIISA  SP++GFL+D +G+N+ WV+   + TL +H + AFTF NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLAV++I AG I D  G+L LEVFF   LC+A+  +V+LYL+D      LN S  +R ++   E
Sbjct:   32 CDPNHLLHRILVLIFMCFLGFGSYFCYDNPAALQSQVIQDMNLNTASFMQLYAWYSWPNVVLCFLGGFLLDRVFGIRLGTVIFSLFVLVGQIIFAAGALANHFWLMNVGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNVIGWVYGRIQMSMGSAGPTTLGITLMIAASTCLFSLICALVLGFLDKRAERILN-KEQGKTGEVIKLTDVKDFSVSLWLIFIICVAYYVAIFPFIGLGQVFFIEKFGFTPVQARAINSVVYIISAPASPLLGFLVDKTGRNVMWVMLAVITTLLSHMMLAFTFWNPWIAMSLLGVSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAVMSIAAGSILDVRGYLFLEVFFIACLCMALLAVVLLYLFDYYKEGGLNLSAATRSKRAKPE 461          
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9DC37|MFSD1_MOUSE (Major facilitator superfamily domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mfsd1 PE=1 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 4.420e-155
Identity = 246/462 (53.25%), Postives = 316/462 (68.40%), Query Frame = 2
Query:   86 NDSESQEIL---YQDDETLTGCGASLP--CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR-KLAQEE 1450
             D E + +L    + D  + G   +L   CDP R  HR +VL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F+GGFLIDR+FGIR G +IFS FV  GQ  FA G   ++++L   GRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y  ++ L  + GH  LG  L +   TC+FSLICAL L++ D+RAEKIL  K +    E I L+DI+ FS+   L+  ICV YYVAVFPFI L KVF ++K+  S   A+ I S++YIISA  SP+ G L+D +GKN+ WVL    ATL +H + AFTF NP   M  LG SYS+LA +LWPMVA +VP HQ GTA+G MQS+QNLGLAV+AI+AG+I D  G+L+LEVFF   + L++  +V LYL +   G  LN S   R+R KL+  E
Sbjct:    4 EDGEDRALLGGRREADSAVHGAPRALSALCDPSRLAHRLVVLSLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFLGGFLIDRIFGIRWGTVIFSCFVCIGQVIFALGGIFNAFWLMELGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYGKIEALLGSAGHMTLGVTLMIGCITCIFSLICALALAYLDRRAEKIL-HKEQGKTGEVIKLRDIKDFSLPLILVFVICVCYYVAVFPFIGLGKVFFMEKFRFSSQSASAINSIVYIISAPMSPLFGLLVDKTGKNIIWVLYAVAATLVSHMMLAFTFWNPWIAMCLLGFSYSLLACALWPMVAFIVPEHQLGTAYGFMQSIQNLGLAVIAILAGMILDSKGYLLLEVFFIACVSLSLLAVVCLYLVNRAQGGNLNYSAKQRERMKLSHPE 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q1JQC1|MFSD1_BOVIN (Major facilitator superfamily domain-containing protein 1 OS=Bos taurus OX=9913 GN=MFSD1 PE=2 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 4.822e-149
Identity = 234/433 (54.04%), Postives = 301/433 (69.52%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP-EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR-KLAQEE 1450
            CDP    HR +VL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L   GRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++    + GH  LG  L +   TC+ SL+CAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVA+FPFI L KVF  +K+  S   A+ I S++Y+ISA  SP+ G L+D +GKN+ WVL   + TL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLAV++IIAG+I D  G+L LEVFF   + L++  +V+LY+ +   G  LN S   R+  KL+ EE
Sbjct:   37 CDPSHLAHRLVVLLLMCFLGFGSYFCYDNPAALQIQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMELGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKVEASLGSAGHTTLGVTLMIGGITCILSLVCALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAIFPFIGLVKVFFTEKFGFSSQAASAINSVVYVISAPMSPIFGLLVDKTGKNIIWVLCAVVTTLASHIMLAFTLWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAVISIIAGMILDTRGYLFLEVFFIACVSLSLLSVVLLYMVNHAQGGNLNYSAKKREEMKLSHEE 468          
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9H3U5|MFSD1_HUMAN (Major facilitator superfamily domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MFSD1 PE=2 SV=2)

HSP 1 Score: 436.802 bits (1122), Expect = 3.841e-147
Identity = 243/438 (55.48%), Postives = 306/438 (69.86%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R  HR LVL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSWPNVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   34 CDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5R8G5|MFSD1_PONAB (Major facilitator superfamily domain-containing protein 1 OS=Pongo abelii OX=9601 GN=MFSD1 PE=2 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 5.408e-142
Identity = 242/438 (55.25%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  158 CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ-LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            CDP R +HR LVL L+CFL FGSYFCYDNPAAL+  +  D+ +  + +M  Y+WYSW NVVL F GGFLIDRVFGIR G IIFS FV  GQ  FA G   ++++L  FGRF+FG+GGESLAVAQNTYA SWFK  ELN +FGLQLSM+R+GSTVN+N M  +Y+ ++ L  + GH  LG  L +   TC+ SLICAL L++ D+RAE+IL  K +    E I L D++ FS+  WLI  ICV YYVAVFPFI L KVF  +K+  S   A+ I S++Y+ISA  SPV G L+D +GKN+ WVL    ATL +H + AFT  NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA G MQS+QNLGLA+++IIAG+I D  G+L LEVFF   + L++  +V+LYL +   G  LN S  +R+R    EE+  S T
Sbjct:   34 CDPSRLVHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWSNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGVTCILSLICALALAYLDQRAERIL-HKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAHGFMQSIQNLGLAIISIIAGMILDSRGYLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYS--ARQR----EEIKFSHT 464          
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Match: V4C3M6 (MFS domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_214694 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 3.880e-177
Identity = 271/464 (58.41%), Postives = 345/464 (74.35%), Query Frame = 2
Query:   86 NDSESQEILYQDDET-----LTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVS 1462
            +D E + +L  ++E      +TGCG SLPCDP+R LHRYL+L ++CFLSFGSYFCYDNPAAL+D M+ DL++  S++M FYSWYSWPNVVL F GGFLID++FG+RLGAIIFSLFV  GQ  FA GA   +  +   GRF+FG+GGESLAVAQNTYA  WFK  ELN +FGLQLS SRVGSTVN+N M PIYN L+     G+K LG AL+V +  C+FSLICAL L+++DKRA++ILKRK+  S+ EKI + D++ F + FWLIS ICV YYVA+FPF+ L  VF   KY  S   A  + SL+YIISA  SP+ GF+ID SGKN+FWV+ G + T+G H + AFTF NP   M  +G++YS+LAS+LWPMV+LV+ +HQ GTA+GIMQ++QNLGLAV++++AG I D  G+LILEVFF  WLCL++   V+LYL D   G KLN S   R    A++EV V+
Sbjct:    3 SDEEKKPLLGSNEEEGDYEEITGCGGSLPCDPRRSLHRYLILIIMCFLSFGSYFCYDNPAALQDTMIKDLDINESTFMGFYSWYSWPNVVLCFFGGFLIDKLFGVRLGAIIFSLFVTVGQVIFATGALFKNSIIMDVGRFVFGIGGESLAVAQNTYAVKWFKGRELNMVFGLQLSFSRVGSTVNMNVMHPIYNLLE-NYLKGYKCLGAALYVGAFFCIFSLICALSLAYYDKRADRILKRKALSSD-EKIRITDVKDFGLKFWLISIICVAYYVAIFPFVGLGLVFFEMKYGFSPASANSVNSLVYIISAVASPLFGFMIDKSGKNIFWVIAGIVFTIGCHGVLAFTFINPYVAMSIMGLAYSILASALWPMVSLVIASHQLGTAYGIMQAIQNLGLAVISLVAGFIVDAKGYLILEVFFLAWLCLSLIAAVLLYLVDAAQGGKLNLSSKERHGG-AEKEVVVN 463          
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Match: A0A2T7NBF7 (MFS domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_21031 PE=4 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 1.541e-174
Identity = 269/464 (57.97%), Postives = 344/464 (74.14%), Query Frame = 2
Query:   83 MNDSESQEILYQDDE-TLTGCGASLPCDPKRRLHRYL-VLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQT 1468
            M++SE + +L +D E T T      PCDP+  LHRY  VL ++CFLSFGSYFCYDNPAAL+D M+ DL+L+ S +M  YS YSWPNV+L F GGFLIDRVFG+R+G+IIFSLFV AGQ  FA G+  + ++L   GRF+FG+GGESLAVAQNTYA  WFK  ELN +FGLQLS SRVGSTVN+N M P+Y+ +    A+G+K LG ALFV +  CVFSL+CA  L+F DKRA++ILKR +  S  ++I L D+++F + FWLIS ICV YYVAVFPF+ L  VF   K+ L+  +A  + SL+YIISA  SPV GFLID  GKNLFWV+TG   TLG H L AFTF  P   M+ +G++YSVLAS+LWPMVAL++P +Q GTA+GIMQ++QNLGLAV+A++AG+I D  G+LILEVFF  WLCLA+   V+LYL D+  G KLN S  +++R   +E   V+++
Sbjct:    1 MSESEKKPLLAKDSEDTETKVYVGNPCDPRGCLHRYFPVLVIMCFLSFGSYFCYDNPAALQDTMIKDLSLSESQFMLLYSLYSWPNVILCFFGGFLIDRVFGVRMGSIIFSLFVTAGQVVFAFGSLTNLFWLMCLGRFIFGIGGESLAVAQNTYAVKWFKGRELNMVFGLQLSFSRVGSTVNMNVMQPLYSYIH-NYASGYKCLGIALFVGAVMCVFSLLCAFALAFLDKRADRILKRAAVGS-GDQIRLWDVKHFPLTFWLISIICVAYYVAVFPFVGLGLVFFEMKFGLTPEQANSVNSLVYIISAVASPVFGFLIDKLGKNLFWVITGVTVTLGCHGLMAFTFLTPYVAMVVMGLAYSVLASALWPMVALIIPENQLGTAYGIMQAIQNLGLAVIALVAGIIVDSKGYLILEVFFMAWLCLALIAAVLLYLTDVAKGGKLNMS--AKERHSHKELKNVAES 460          
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Match: A0A1S3KF32 (major facilitator superfamily domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106181413 PE=4 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 5.150e-173
Identity = 266/470 (56.60%), Postives = 336/470 (71.49%), Query Frame = 2
Query:   83 MNDSESQEIL-----------YQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQ--LPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR-KLAQEE 1450
            M D E + +L            +DD  L GCG +L CDP+R LH+YL+L ++CFLSFGSYFCYDNPAAL+D M+ DLN+  S YM FYS YSWPNV+L F GGFLIDRVFGIRLGAIIFSLFV AGQ  FA GA+ +   +   GRF+FG+GGESL VAQNTYA SWFKD ELN +FGLQLS SRVGSTVN+N M P+Y++++   P+  G+  LG  L +    C+ SL C+  L++FDKR E+IL RK +    E ISL+DI+ F  + WL+  ICV YYVAVFPFI L  VF   K+ LS   A+   S++YIISA  SP+ GF ID  GKN+FWV+TG + TL  HA  AFT+ NP   M+ +G SYS+LAS+LWP+VA+VVP HQ GTA+GIMQ+VQNLGLAV+++++G+I D  G+L+LEVFF IWLC+A+   V+LYL D   G  +N SGF R++ + A EE
Sbjct:    1 MEDQEKKPLLGDRDNGPVVAVPEDDVVLEGCGGTLACDPRRALHKYLILIIMCFLSFGSYFCYDNPAALQDTMLKDLNINESIYMLFYSLYSWPNVILCFFGGFLIDRVFGIRLGAIIFSLFVTAGQVVFALGAFFNLPIVMHIGRFIFGIGGESLCVAQNTYAVSWFKDKELNMVFGLQLSFSRVGSTVNMNIMQPLYDAMKKSFPDQQGYVILGGTLMIGVGFCIASLFCSFALAYFDKRLERIL-RKEEAKTGEVISLRDIKDFPASVWLMCIICVAYYVAVFPFIGLGLVFFEMKFGLSPSAASACNSVVYIISAGASPLFGFCIDKLGKNIFWVITGVIITLACHACLAFTWINPFVPMVIMGFSYSILASALWPIVAMVVPEHQLGTAYGIMQAVQNLGLAVISMVSGMILDSKGYLVLEVFFLIWLCVALIASVLLYLVDAAKGGHINLSGFQRRKIQKANEE 469          
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Match: A0A4S2ME59 (MFS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001979 PE=4 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 3.379e-168
Identity = 265/466 (56.87%), Postives = 339/466 (72.75%), Query Frame = 2
Query:  116 QDD---ETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP--EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKIL----KRKSKDSEAEK-----------ISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFG--NPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQE 1447
            +DD   +   GCGASL CDP+RRLHRY++LF ICFLSFGSYFCYDNPAAL+D+M+ DL+LT + +M+ Y+WYSWPNV+LS +GGFLIDRVFG  LGAIIFSL +  GQ  F  GA I    L  F RF+FG+GGESL VAQNTY   WF  +ELNF+FGLQLSM+R+GSTVN+NTM  +Y S+  P    TGH+RLGTAL +AS TC+FS  CA++L+FF +R ++IL    KR + +S A+            IS KDI +F  A WLI  ICV YYVA+FPF+SL +VF  +K+ LS  +A +I SL+YI+SA  SPV G  IDF+G+NL WVL+  L TL  H  +AFT G   P+ +MI +G++YS+LASSLWP+VA ++P HQRGTA+G++QS+QNLGL V+AI AG + D  G+L LEVFF+  L LA+A+   LYLWD ++G  LNESG SR+R   +E
Sbjct:   11 EDDNERDVPQGCGASLACDPRRRLHRYMMLFFICFLSFGSYFCYDNPAALQDVMIRDLSLTETDFMNLYAWYSWPNVILSLVGGFLIDRVFGCALGAIIFSLCIFLGQIIFGVGALISKLPLMYFARFIFGIGGESLCVAQNTYIGEWFPASELNFVFGLQLSMARLGSTVNMNTMQLLYKSIG-PYFGITGHQRLGTALLIASVTCIFSACCAIILAFFTRRKDRILRAHNKRLADESAAQTGKAPVQEVTQLISPKDILHFPAAMWLICVICVAYYVAIFPFVSLGQVFFERKFHLSITEANVINSLVYILSAVASPVFGATIDFTGRNLNWVLSSILLTLFCHLCFAFTSGALPPMFIMILMGMAYSILASSLWPLVAFLLPPHQRGTAYGLIQSLQNLGLGVIAIFAGYLVDNKGYLFLEVFFTFCLSLALAVTFGLYLWDQKHGCLLNESGASRRRNEVRE 475          
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Match: A0A3Q3BBZ8 (Major facilitator superfamily domain containing 1 OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 3.925e-168
Identity = 257/465 (55.27%), Postives = 331/465 (71.18%), Query Frame = 2
Query:   80 IMNDSESQEILYQDDETLTGCGASLP--CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP-EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQ 1465
            ++ D +  E  + D +   G G  +   CDP R LHR +VLF +CFL FGSYFCYDNPAAL+  ++ DLNL   ++M  Y+WYSWPNVVL F GGFL+DRVFGIR+G IIFSLFV  GQ  FA GA ++ ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N M  +YN + L   ++GH  LG +L +A+ATCVFSLICALVL+F DKRAEKIL  K +    E I L D++ F    WLI  ICV YYVA+FPFI L ++F I+K++ S  +A  + S++YIISA  SPV+GFL+D +G+N+ WV+   +ATL AH + AFTF NP   M  LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLAV++I AG I D  G+L+LEVFF   +C+A+  +V+LY  D   G  LN S  +R  KL +E  T ++
Sbjct:   10 LLGDEDEDEDSFADRQAARGPGRLMAAICDPSRLLHRVVVLFFMCFLGFGSYFCYDNPAALQSQVIQDLNLNTETFMQLYAWYSWPNVVLCFFGGFLLDRVFGIRMGTIIFSLFVCVGQVIFAAGALVNRFWLMEAGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNIMGWVYNQVALAVGSSGHTALGGSLMIAAATCVFSLICALVLAFLDKRAEKILN-KEQGKTGEVIKLTDVKDFPSTLWLIFIICVGYYVAIFPFIGLGQIFFIEKFNFSPTQARAVNSIVYIISAPASPVLGFLVDKTGRNVVWVMIAVIATLAAHIMLAFTFWNPWIAMSLLGVSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAVISITAGAILDSRGYLVLEVFFCACICIALMSVVMLYFVDYIKGGDLNRSAAARA-KLLKESTTDAE 472          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Cavefish
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:NCBI gene;Acc:103025236])

HSP 1 Score: 466.077 bits (1198), Expect = 9.837e-160
Identity = 241/449 (53.67%), Postives = 319/449 (71.05%), Query Frame = 2
Query:   92 SESQEILYQDDETLTGCGASLPC-DPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP-EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR 1432
             E + +L +++          P  DP   LHR  VL  +CFL FGSYFCYDNPAAL+  ++ D+ L  SS+M  Y+WYSWPNVVL F+GGFL+DRVFGIRLG IIFSLFV  GQ  FA GA ++ ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+RVGSTVN+N+M  +Y+S++     TGH  LG AL +A +TCVFSL+CAL+L + D+RAE+ILK K +    E I L D++ F +  WLI  ICV YYVA+FPFI L +VF I+K++ +  +A  + S++YI+SA  SP++G ++D +GKN+ WVL   + TL +H + AFTF NP   M+ LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++++ AG I D  G+L+LEVFF   +CLA+  +V+LY  D     +LN S  +R R
Sbjct:    5 EEDERLLDENNHEGRNTRRMHPLLDPSHLLHRIWVLMFMCFLGFGSYFCYDNPAALQKQVIQDMGLNTSSFMQLYAWYSWPNVVLCFLGGFLLDRVFGIRLGTIIFSLFVCVGQVIFALGALVNHFWLMNMGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARVGSTVNMNSMGAVYDSMKTALGQTGHFTLGAALMIAGSTCVFSLLCALILGYLDRRAERILK-KEQGKTGEVIRLTDVKDFPLQLWLIFIICVGYYVAIFPFIGLGQVFFIEKFNFTPTQARAVNSIVYIMSAPASPLLGLMVDKTGKNIIWVLVAVVTTLISHMMLAFTFWNPWIAMVILGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLALISMAAGAILDSKGYLLLEVFFCACICLALIAVVVLYFVDYLRCGELNLSAAARAR 452          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Cavefish
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:NCBI gene;Acc:103025236])

HSP 1 Score: 468.003 bits (1203), Expect = 1.126e-159
Identity = 247/473 (52.22%), Postives = 328/473 (69.34%), Query Frame = 2
Query:   92 SESQEILYQDDETLTGCGASLPC-DPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP-EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLN---------------ESGFSRK-RKLAQEEVT 1456
             E + +L +++          P  DP   LHR  VL  +CFL FGSYFCYDNPAAL+  ++ D+ L  SS+M  Y+WYSWPNVVL F+GGFL+DRVFGIRLG IIFSLFV  GQ  FA GA ++ ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+RVGSTVN+N+M  +Y+S++     TGH  LG AL +A +TCVFSL+CAL+L + D+RAE+ILK K +    E I L D++ F +  WLI  ICV YYVA+FPFI L +VF I+K++ +  +A  + S++YI+SA  SP++G ++D +GKN+ WVL   + TL +H + AFTF NP   M+ LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++++ AG I D  G+L+LEVFF   +CLA+  +V+LY  D     +LN               ES  +R+ RK +QEE+T
Sbjct:    5 EEDERLLDENNHEGRNTRRMHPLLDPSHLLHRIWVLMFMCFLGFGSYFCYDNPAALQKQVIQDMGLNTSSFMQLYAWYSWPNVVLCFLGGFLLDRVFGIRLGTIIFSLFVCVGQVIFALGALVNHFWLMNMGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARVGSTVNMNSMGAVYDSMKTALGQTGHFTLGAALMIAGSTCVFSLLCALILGYLDRRAERILK-KEQGKTGEVIRLTDVKDFPLQLWLIFIICVGYYVAIFPFIGLGQVFFIEKFNFTPTQARAVNSIVYIMSAPASPLLGLMVDKTGKNIIWVLVAVVTTLISHMMLAFTFWNPWIAMVILGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLALISMAAGAILDSKGYLLLEVFFCACICLALIAVVVLYFVDYLRCGELNLSAAARARLQKTNSSESELARQMRKRSQEELT 476          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Cavefish
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:NCBI gene;Acc:103025236])

HSP 1 Score: 434.876 bits (1117), Expect = 1.418e-147
Identity = 231/443 (52.14%), Postives = 310/443 (69.98%), Query Frame = 2
Query:   92 SESQEILYQDDETLTGCGASLPC-DPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLP-EATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNES 1414
             E + +L +++          P  DP   LHR  VL  +CFL FGSYFCYDNPAAL+  ++ D+ L  SS+M  Y+WYSWPNVVL F+GGFL+DRVFGI    +I+S F    Q  FA GA ++ ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+RVGSTVN+N+M  +Y+S++     TGH  LG AL +A +TCVFSL+CAL+L + D+RAE+ILK K +    E I L D++ F +  WLI  ICV YYVA+FPFI L +VF I+K++ +  +A  + S++YI+SA  SP++G ++D +GKN+ WVL   + TL +H + AFTF NP   M+ LG+SYS+LA +LWPMVA VVP HQ GTA+G MQS+QNLGLA++++ AG I D  G+L+LEVFF   +CLA+  +V+LY  D     KLN +
Sbjct:    5 EEDERLLDENNHEGRNTRRMHPLLDPSHLLHRIWVLMFMCFLGFGSYFCYDNPAALQKQVIQDMGLNTSSFMQLYAWYSWPNVVLCFLGGFLLDRVFGI--SPVIYSFFFFC-QVIFALGALVNHFWLMNMGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARVGSTVNMNSMGAVYDSMKTALGQTGHFTLGAALMIAGSTCVFSLLCALILGYLDRRAERILK-KEQGKTGEVIRLTDVKDFPLQLWLIFIICVGYYVAIFPFIGLGQVFFIEKFNFTPTQARAVNSIVYIMSAPASPLLGLMVDKTGKNIIWVLVAVVTTLISHMMLAFTFWNPWIAMVILGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLALISMAAGAILDSKGYLLLEVFFCACICLALIAVVVLYFVDYLR-CKLNSN 442          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Cavefish
Match: im:7160594 (im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43])

HSP 1 Score: 177.178 bits (448), Expect = 7.200e-49
Identity = 133/382 (34.82%), Postives = 191/382 (50.00%), Query Frame = 2
Query:  167 KRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYID-SYYL---CVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSK-DSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYS-LSGPKAALITSLLYIISAACSPVMGFLIDFSG-KNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVI 1291
            +R  +R+LVLF  C L+FGSYFC+D P+ L++    +L                PN  +SF          G   G  +FS   + G   FA G++   S YL    + GR LFG G  SL   Q T  + WFK  EL   FGL L+ SR+GS +N       + + +     G +     L+  +  CV   + A+ +S  DK   K L        E+ K+ ++DIR  S+ +WL+    + +Y  +FPFI+ +  F+  KYS  S  +AA I   +Y  S   S  +G LID+ G + +F VL   L TL    L AFTF  PL   I+LG++YS  A+S+WP + LVVP    GTA G+  SVQ +G+ +  +I G I
Sbjct:    6 ERAYYRFLVLFFNCMLTFGSYFCFDIPSVLQEQFQGNLTC--------------PNSTVSF------GSSNGSEFGVFLFSFLTVLGSAMFALGSHFKGSEYLLPLMLTGRLLFGSGNGSLTRKQIT--AFWFKGKELALAFGLTLAFSRLGSVLNF------FLTQRFEAEYGMQW---TLWGGTLLCVLGFLSAITVSVLDKVGMKQLGLDGAIQEESRKVRVQDIRLLSLRYWLLVLTIMFFYNGIFPFIADASKFIQDKYSGYSQKEAAYIAGAVYDSSLVLSAAVGILIDYVGLRGVFAVLCAVL-TLPVFGLLAFTFVPPLVSTIWLGVTYSFAAASMWPSIPLVVPQATLGTAMGLATSVQMIGIGISNLIVGQI 355          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25874])

HSP 1 Score: 486.493 bits (1251), Expect = 2.491e-167
Identity = 246/435 (56.55%), Postives = 314/435 (72.18%), Query Frame = 2
Query:  131 LTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRK 1435
            L+GCGAS  C+P+R  HR++VL  +CFL FGSYFCYDNPAAL+  +M D+ +  +S+M  Y+WYSWPNV+L F GGFLIDRVFG+RLG IIF LFV  GQ   A GA+ ++Y+L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N M  +YN +     +GH  LG +L +AS TC+FSL+CAL+L F DKRAEKIL  K +    E + L D++ F  + W+I  +CV YYVAVFPFI L KVF  +K+  S P A  + S++Y+ISA  SPV+GF++D  GKN+ WVL   LATLGAH + AFTF NP   M  +G++YS+LA +LWPMV+ +VP HQ GTA+G MQS+QNLGLAV++I AG I D  G+L LE+FF I LC A+   V+LYL DL     LN S   R +K
Sbjct:   33 LSGCGASPLCNPRRTPHRFVVLVFMCFLGFGSYFCYDNPAALQTQVMQDMKVNTASFMQLYAWYSWPNVILCFFGGFLIDRVFGVRLGTIIFGLFVFIGQIIVAVGAFTNAYWLMELGRFIFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNVMGILYNKVAQTFGSGHSCLGISLMIASITCLFSLVCALILGFLDKRAEKIL-HKEQGKTGEVVRLTDVKDFPASLWMIFMVCVGYYVAVFPFIGLGKVFFEEKFGFSAPSAGAVNSIVYVISAPASPVLGFMVDRVGKNILWVLMAVLATLGAHLMLAFTFWNPWIPMSLMGVAYSLLACALWPMVSFLVPEHQLGTAYGFMQSIQNLGLAVISIAAGSILDSSGYLFLELFFCICLCFALIATVLLYLIDLIRDGGLNLSSRERDKK 466          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: im:7160594 (im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43])

HSP 1 Score: 97.8265 bits (242), Expect = 5.824e-23
Identity = 82/284 (28.87%), Postives = 130/284 (45.77%), Query Frame = 2
Query:  167 KRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMM--------------------------SDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFA-----GGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSL---ICALVLSFFDKRA-EKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFIS 913
             RR +R+LVL   C ++FGSY+C+D P  L+                              S L LT S Y   Y+ Y+W NVVL    G+L+D++ G R+  ++FS F + G   FA      G+      L + GR LFG G  SL + Q    + WF++ EL   FG+ ++ SR+GS +N            L   +   R G    + +  C+  +     A  +   D+R  +++        EA+ +++ DIR F + +W++    V +Y  VFPFI+
Sbjct:    6 SRRRYRFLVLLCNCLVTFGSYYCFDMPGVLQAQFQGNLSCSEEQNAKNATVLNGGGGCETPSGLGLTPSQYNLLYAVYAWGNVVLVIPFGYLMDKI-GNRVSVMLFSSFCMLGSLLFALSIRLRGSTRSMLALMLAGRVLFGCGNVSLIIVQFRIVTFWFREKELAMAFGVTIAFSRLGSVLNF-----------LCTESFEHRFGLEATLWAGVCLNCMHFISTACTVGQMDQRGLQQLGVYAGLRHEAKSVNITDIRRFKLTYWMLVLATVFFYSTVFPFIA 277          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008865.1 (pep scaffold:Pmarinus_7.0:GL476579:122451:131953:-1 gene:ENSPMAG00000008024.1 transcript:ENSPMAT00000008865.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.395e-10
Identity = 35/114 (30.70%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  950 SGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVI 1291
            S  +A+L+    Y++S       G L+D  G     +    ++TL    + AF    PL   ++LG++YSV  + +WP +++VVP    GTA G+  S+Q LG+ V  +  G +
Sbjct:   12 SQEQASLVVGATYMVSMVLCAASGVLVDRVGLRGVMISAAAISTLPVFPVLAFGRLPPLASTLWLGVAYSVSTACMWPAISMVVPYSTLGTANGVATSLQMLGVGVSNLAVGAL 125          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008867.1 (pep scaffold:Pmarinus_7.0:GL476579:122454:131953:-1 gene:ENSPMAG00000008024.1 transcript:ENSPMAT00000008867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.955e-10
Identity = 35/114 (30.70%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  950 SGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVI 1291
            S  +A+L+    Y++S       G L+D  G     +    ++TL    + AF    PL   ++LG++YSV  + +WP +++VVP    GTA G+  S+Q LG+ V  +  G +
Sbjct:   12 SQEQASLVVGATYMVSMVLCAASGVLVDRVGLRGVMISAAAISTLPVFPVLAFGRLPPLASTLWLGVAYSVSTACMWPAISMVVPYSTLGTANGVATSLQMLGVGVSNLAVGAL 125          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO35229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM64])

HSP 1 Score: 427.172 bits (1097), Expect = 1.672e-145
Identity = 223/421 (52.97%), Postives = 296/421 (70.31%), Query Frame = 2
Query:   86 NDSESQEILYQDD---ETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEAT---GHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFF 1330
            N +E   ++  +    E   GCGASL CDP+R LHRY+VL  ICFLSFG Y+CYDNPAALE  +  D+    S+Y+  YS YS+PNV+L F GGFL+DRVFG+RLG +IFS FVLAGQ  FA GAY  ++ + + GRF+FG+GGE+LAVAQNTY+ +WF+  ELN +FGLQLS SR+GST+N+N    IY +     A    G++ LG  LFV    C+FS IC + +   DKR+ +IL+ K +    E I L+D++ F ++ WLI  ICV YYVAVFPF+ L   F  +K+ L+   A  + S+++IISAA SPV+GF++D +GKN+FWVL   + TL AH + AFTF NP   M  LG++YS+LA +LWP+V+LVVP HQ GTA+G MQS+QNLGLAV+  +AG+I D  G+LILE+FF
Sbjct:    4 NSTEKTPLINTNSASRERPEGCGASLLCDPRRGLHRYVVLIFICFLSFGGYYCYDNPAALEKHIEQDMAKDTSNYVLLYSLYSYPNVILCFFGGFLLDRVFGVRLGTLIFSAFVLAGQVVFALGAYTHNWTIMLVGRFIFGLGGENLAVAQNTYSVNWFRGKELNMVFGLQLSFSRIGSTINMNVNHLIYTAFSKMGAKPLPGYEALGLTLFVGVGVCLFSFICGICVGVLDKRSARILQ-KDEGKTGEMIQLRDVKDFPLSLWLIFLICVAYYVAVFPFVGLGLAFFQEKFDLTPDTAGAVNSIVFIISAAASPVLGFMVDRTGKNVFWVLLAVVLTLVAHGMVAFTFWNPFVAMSVLGVAYSLLACALWPLVSLVVPGHQLGTAYGFMQSIQNLGLAVITQVAGIIVDNNGYLILEIFF 423          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO28002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7P8])

HSP 1 Score: 245.743 bits (626), Expect = 3.823e-76
Identity = 142/336 (42.26%), Postives = 203/336 (60.42%), Query Frame = 2
Query:  329 PNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVA--SATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFF 1330
            PNV+L F GGFL+DRVFG+RLG +IFS FVLAGQ      +     +L    +        ++ +   T   S  K    +F   ++ S      T+       +   + +  +T  K +   +  +  S  C+FS IC + +   DKR+ +IL+ K +    E I L+D++ F ++ WLI  ICV YYVAVFPF+ L   F  +K+ L+   A  + S+++IISAA SPV+GF++D +GKN+FWVL   + TL AH + AFTF NP   M  LG++YS+LA +LWP+V+LVVP HQ GTA+G MQS+QNLGLAV+  +AG+I D  G+LILE+FF
Sbjct:   19 PNVILCFFGGFLLDRVFGVRLGTLIFSAFVLAGQV-----SVEQRLWLRKSSQIKHRANRNAINILLKTLCISLTKATTFHFHILVENSEELSDHTLKQAKAYFLRGRIGILLSTDSKVITHYINRSKQSLVCLFSFICGICVGVLDKRSARILQ-KDEGKTGEMIQLRDVKDFPLSLWLIFLICVAYYVAVFPFVGLGLAFFQEKFDLTPDTAGAVNSIVFIISAAASPVLGFMVDRTGKNVFWVLLAVVLTLVAHGMVAFTFWNPFVAMSVLGVAYSLLACALWPLVSLVVPGHQLGTAYGFMQSIQNLGLAVITQVAGIIVDNNGYLILEIFF 348          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO41128 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S520])

HSP 1 Score: 184.882 bits (468), Expect = 2.739e-52
Identity = 127/394 (32.23%), Postives = 212/394 (53.81%), Query Frame = 2
Query:  182 RYLVLFLICFLSFGSYFCYDNPAALEDLMMSD------------LNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDS----YYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSK-DSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLS---GPK-AALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFG-NPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQD 1297
            R+++L   C ++FGSY+CYD P+ ++     D            L LT   +   YS Y+W N V+  + G LID++ G  +GA++FS   L G   FA G Y+      + + + GR LFG G  SL + QN   + WF   EL F FG+ L+ SR+GS +N       + + +  E  G   L   L+  S  C F ++CA+  +  D    K+L RK++ +++++++ + DI++F  ++WL++   + +Y  VFPF+S +  F+   Y+ +   GPK +A I   +Y +S    P MG ++D  GK  +  L   L+ +    L +F    +P+   ++LG++YS+ A+SLWP V L+V     GTA G+M ++Q +G+ +  +I G I D
Sbjct:   10 RFVLLIFTCLMTFGSYYCYDMPSKIDGNPPPDGTVINGTDCIKGLGLTQIEFNLLYSIYAWTNAVIVLLAGILIDKL-GNGVGALLFSSMCLIGVSTFASGLYLQGTKAMFPIMLLGRILFGSGNGSLTIVQNRICAIWFTGKELAFAFGVSLAFSRLGSVMNF------FLTEEFEEKYG---LQITLWGGSILCGFGVLCAITATTLDYTGIKLLNRKAEMEAQSKRMRVTDIKFFGSSYWLLAMTLMFFYNGVFPFVSDASDFIETNYAETFKFGPKTSAYIAGAVYDVSMVLGPFMGAIVDQFGKRGYLSLICALSCIPVFGLLSFAPSVHPIISTLWLGLNYSIAAASLWPSVPLIVNQGCVGTAMGLMTTIQMIGIGICNLIVGKILD 393          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Medaka
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:NCBI gene;Acc:101173160])

HSP 1 Score: 444.506 bits (1142), Expect = 1.712e-151
Identity = 237/431 (54.99%), Postives = 306/431 (71.00%), Query Frame = 2
Query:   83 MNDSESQEILYQDDET-----LTGCGASLP----CDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEAT-GHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLC 1345
            M D   ++ L +DDE+      +  G   P    CDP R  HR +VL  +CFL FGSYFCYDNPAAL+  ++ DLNL  + +M  Y+WYSWPNVVL F GGFL+DRVFGIRLG IIFSLFV  GQ  FA GA+ D ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N M  +YN + +   + G   LG +L +A+ TC+FSL+CALVL F DKRAE+IL  K +    E I L D++ F +  WL+  ICV YYVA+FPFI L +VF I+K++ S  +A  + S++YIISA  SPV+GF++D +G+N+ WV+   +ATL AH + AFTF NP   M  LG+SYS+LA +LWPMVA +VP HQ GTA+G MQS+QNLGLA++A+ AG I D  G+L+LEVFF   +C
Sbjct:    1 MADFVERQNLLEDDESSPAERRSASGDDRPMSAICDPSRLPHRAVVLVFMCFLGFGSYFCYDNPAALQTQVIQDLNLNTAKFMQLYAWYSWPNVVLCFFGGFLLDRVFGIRLGTIIFSLFVCVGQVIFAAGAWYDLFWLMELGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNIMGWVYNKVAVVVGSPGPTTLGASLMIAAVTCLFSLVCALVLGFLDKRAERIL-HKEEGKTGEVIKLTDVKDFPLTLWLVFIICVGYYVAIFPFIGLGQVFFIEKFNFSPAEARAVNSIVYIISAPASPVLGFVVDKTGRNVVWVMMAVVATLAAHMMLAFTFWNPWIAMSLLGVSYSLLACALWPMVAFMVPEHQLGTAYGFMQSIQNLGLALIAMAAGAILDSRGYLVLEVFFCACIC 430          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Medaka
Match: mfsd1 (major facilitator superfamily domain containing 1 [Source:NCBI gene;Acc:101173160])

HSP 1 Score: 403.675 bits (1036), Expect = 1.418e-135
Identity = 209/383 (54.57%), Postives = 273/383 (71.28%), Query Frame = 2
Query:  329 PNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEAT-GHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQTLK 1474
            PNVVL F GGFL+DRVFGIRLG IIFSLFV  GQ  FA GA+ D ++L   GRF+FG+GGESLAVAQNTYA +WFK  ELN +FGLQLSM+R+GSTVN+N M  +YN + +   + G   LG +L +A+ TC+FSL+CALVL F DKRAE+IL  K +    E I L D++ F +  WL+  ICV YYVA+FPFI L +VF I+K++ S  +A  + S++YIISA  SPV+GF++D +G+N+ WV+   +ATL AH + AFTF NP   M  LG+SYS+LA +LWPMVA +VP HQ GTA+G MQS+QNLGLA++A+ AG I D  G+L+LEVFF   +C+A+  +V+LY  D   G  LN+S  +R +   Q+E T     K
Sbjct:   10 PNVVLCFFGGFLLDRVFGIRLGTIIFSLFVCVGQVIFAAGAWYDLFWLMELGRFVFGIGGESLAVAQNTYAVNWFKGKELNLVFGLQLSMARLGSTVNMNIMGWVYNKVAVVVGSPGPTTLGASLMIAAVTCLFSLVCALVLGFLDKRAERIL-HKEEGKTGEVIKLTDVKDFPLTLWLVFIICVGYYVAIFPFIGLGQVFFIEKFNFSPAEARAVNSIVYIISAPASPVLGFVVDKTGRNVVWVMMAVVATLAAHMMLAFTFWNPWIAMSLLGVSYSLLACALWPMVAFMVPEHQLGTAYGFMQSIQNLGLALIAMAAGAILDSRGYLVLEVFFCACICIALIAVVMLYFVDYVKGGDLNQSAAARAK--LQKEATSDAEAK 389          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Medaka
Match: im:7160594 (major facilitator superfamily domain-containing protein 1 [Source:NCBI gene;Acc:101162558])

HSP 1 Score: 189.504 bits (480), Expect = 4.102e-53
Identity = 148/471 (31.42%), Postives = 232/471 (49.26%), Query Frame = 2
Query:  167 KRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLN------------------LTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDS--YYLCVF--GRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEA-EKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKY-SLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIW---------LCLAVALI---VILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQTL 1471
            ++  +R++VLF  C L+FGSYFC+D P+ L+D    +L                   +T   Y   Y+ Y+W N ++  + GFLID++ G R G  +FS   + G   FA G++     Y L +   GR LFG G  SL + QN   + WFK  EL   FGL L+ SR+GS +N       + + +  +  G +     L+  +  CV     A+++S  DK   K L  +    EA  K+ ++D++  S+ +WL+    + +Y  +FPFI+ +  F+  KY + S  +AA +   +Y  S   S  +G LID+ G    + LT  + TL    L AFTF  PL   I+LG++YS  A+S+WP + LVVP    GTA G+  S+Q +G+ +  ++ G I    G    E    +W         L   V+ I   V+L + D + G  LN+   + KR   +E  +  + L
Sbjct:    6 EKAYYRFVVLFFNCLLTFGSYFCFDMPSVLQDQFQGNLTCPNVTVINGTVDCVPGLGMTPQQYNLLYAIYAWTNAIVVILAGFLIDKL-GNRFGVFLFSFLCVLGSSLFALGSHFKGTPYLLPIMLTGRLLFGSGNGSLTIVQNRITAFWFKGKELALAFGLTLAFSRLGSVLNF------FLTEKFEDKFGMEW---TLWGGALLCVLGFSSAIIVSAMDKVGMKQLGLEGTMQEASRKVRIQDVKLLSLRYWLLVLTIMFFYNGIFPFIADASKFIQDKYGNYSQKEAAYVAGAVYDSSLVLSASVGILIDYVGLRGIFALTCAVLTLPVFGLLAFTFVPPLVSTIWLGVTYSFAAASMWPSIPLVVPQATLGTAMGLATSIQMVGIGLSNLVVGQI---LGTQTSEARIPLWRWRRMMIFMLANTVSCIVTSVLLNIVDYKQGGTLNK---TTKRSQQEERNSEREPL 460          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000017192.1 (SMESG000017192.1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 464/465 (99.78%), Postives = 464/465 (99.78%), Query Frame = 2
Query:   83 MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQTLKS 1477
            MN SESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTASSYMSFYSWYSWPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQTLKS
Sbjct:    1 MNASESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTASSYMSFYSWYSWPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKRKLAQEEVTVSQTLKS 465          
BLAST of major facilitator superfamily domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000028849.1 (SMESG000028849.1)

HSP 1 Score: 331.643 bits (849), Expect = 5.072e-106
Identity = 185/408 (45.34%), Postives = 269/408 (65.93%), Query Frame = 2
Query:  110 LYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYFCYDNPAALEDLMMSDLNLTAXXXXXXXXXXXXPNVVLSFIGGFLIDRVFGIRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQNTYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHKRLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKDIRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSLLYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFG-NPLGVMIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIAGVIQDKYGFLILEVFF 1330
            L +  E  +GC  S  C PK  ++R ++LF  CF++FGS+FCYDNPA+L+ + M+DL+L+  SYM  YSWY+WPN+V+ FI GFLID + GIRLGAIIF    + GQ   A G Y++  +L    R +FG+G ESLAVAQNTYA+ WF+D ELN +FGLQ+S+SR+GST+N N M  IYNSL     +    L  +L +AS TC+ S I  ++L + D RA K+      +    K+ + +I  F+   W++S ICV +Y ++FPF+S+++   +QKY+++   A   +SL+YIISA  SP +GF +D  G+NL W+ +G    L +HA+ AF    N   + I +G++YS++A SLW +V  +V  ++ GTAFG+MQS+ NLGL  +++I G I D YG+  LE+FF
Sbjct:    6 LLKPKELQSGCCHSSYCHPKHFIYRAIILFFTCFMTFGSFFCYDNPASLQTMFMNDLDLSFQSYMGLYSWYAWPNIVMGFIAGFLIDNILGIRLGAIIFGFITIIGQLLLALGVYVNKLWLMDLARLIFGIGSESLAVAQNTYAAIWFRDKELNIVFGLQISISRIGSTINSNVMPLIYNSLN-SYVSNQTSLTLSLLLASITCLISFIFCIILGYLDLRAFKLGCNLFPEETRSKLRILNIFKFNYGVWILSIICVLFYCSIFPFVSIAQTLFMQKYNVNIITANFASSLIYIISACASPFIGFGVDIFGRNLIWLTSGLGILLLSHAIVAFRSDLNVFIITILMGLAYSIVACSLWGLVTYMVSRNKNGTAFGLMQSLMNLGLGSISLICGYILDNYGYFPLEIFF 412          
The following BLAST results are available for this feature:
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD17.997e-14855.48major facilitator superfamily domain containing 1 ... [more]
MFSD17.997e-14855.48major facilitator superfamily domain containing 1 ... [more]
MFSD15.228e-14755.48major facilitator superfamily domain containing 1 ... [more]
MFSD12.651e-11647.95major facilitator superfamily domain containing 1 ... [more]
MFSD11.817e-11547.95major facilitator superfamily domain containing 1 ... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrva7.327e-14147.31gene:FBgn0035763 transcript:FBtr0076884[more]
mrva7.327e-14147.31gene:FBgn0035763 transcript:FBtr0332734[more]
CG121944.353e-13648.86gene:FBgn0031636 transcript:FBtr0332476[more]
CG121944.353e-13648.86gene:FBgn0031636 transcript:FBtr0077385[more]
CG121944.587e-13648.86gene:FBgn0031636 transcript:FBtr0300756[more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mfsd12.347e-10345.48major facilitator superfamily domain containing 1 ... [more]
im:71605943.252e-3932.77im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43][more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf12.177e-16655.24ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-G... [more]
arf18.613e-16654.76ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-G... [more]
arf11.241e-14553.06ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-G... [more]
arf16.016e-14455.05ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-G... [more]
arf17.026e-13853.08ADP ribosylation factor 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mfsd16.319e-15653.25major facilitator superfamily domain containing 1 ... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32LQ6|MFSD1_DANRE1.521e-15656.61Major facilitator superfamily domain-containing pr... [more]
sp|Q9DC37|MFSD1_MOUSE4.420e-15553.25Major facilitator superfamily domain-containing pr... [more]
sp|Q1JQC1|MFSD1_BOVIN4.822e-14954.04Major facilitator superfamily domain-containing pr... [more]
sp|Q9H3U5|MFSD1_HUMAN3.841e-14755.48Major facilitator superfamily domain-containing pr... [more]
sp|Q5R8G5|MFSD1_PONAB5.408e-14255.25Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4C3M63.880e-17758.41MFS domain-containing protein OS=Lottia gigantea O... [more]
A0A2T7NBF71.541e-17457.97MFS domain-containing protein OS=Pomacea canalicul... [more]
A0A1S3KF325.150e-17356.60major facilitator superfamily domain-containing pr... [more]
A0A4S2ME593.379e-16856.87MFS domain-containing protein OS=Opisthorchis feli... [more]
A0A3Q3BBZ83.925e-16855.27Major facilitator superfamily domain containing 1 ... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfsd19.837e-16053.67major facilitator superfamily domain containing 1 ... [more]
mfsd11.126e-15952.22major facilitator superfamily domain containing 1 ... [more]
mfsd11.418e-14752.14major facilitator superfamily domain containing 1 ... [more]
im:71605947.200e-4934.82im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43][more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfsd12.491e-16756.55major facilitator superfamily domain containing 1 ... [more]
im:71605945.824e-2328.87im:7160594 [Source:ZFIN;Acc:ZDB-GENE-080917-43][more]
ENSPMAT00000008865.12.395e-1030.70pep scaffold:Pmarinus_7.0:GL476579:122451:131953:-... [more]
ENSPMAT00000008867.12.955e-1030.70pep scaffold:Pmarinus_7.0:GL476579:122454:131953:-... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO352291.672e-14552.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280023.823e-7642.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411282.739e-5232.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mfsd11.712e-15154.99major facilitator superfamily domain containing 1 ... [more]
mfsd11.418e-13554.57major facilitator superfamily domain containing 1 ... [more]
im:71605944.102e-5331.42major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017192.10.000e+099.78SMESG000017192.1[more]
SMESG000028849.15.072e-10645.34SMESG000028849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010337 ID=SMED30010337|Name=major facilitator superfamily domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1825bp
ATTAATTTAAATAGGATTTTAAATTCCTTTATATATTAGTCCGTGTTTAT
AGTGAATTTGGCATTGTGTAAGTATAATTATCATGAATGATTCGGAATCG
CAAGAAATTCTATACCAAGATGACGAAACGTTAACTGGATGTGGAGCATC
ACTTCCATGTGATCCAAAGCGTCGACTTCATCGTTATTTGGTTTTGTTTC
TGATTTGTTTTTTGAGTTTCGGAAGTTATTTTTGTTACGACAACCCAGCG
GCATTGGAGGATCTAATGATGAGTGATTTAAATTTAACCGCTTCGAGCTA
CATGAGTTTCTACTCCTGGTATAGTTGGCCAAATGTAGTTCTGAGCTTCA
TTGGAGGATTTCTCATTGATAGGGTTTTCGGAATCCGTTTAGGTGCGATT
ATTTTCTCTTTATTCGTCCTGGCGGGGCAATTCTTTTTTGCGGGAGGTGC
CTATATAGATAGCTATTATCTTTGCGTTTTCGGTCGGTTCTTGTTTGGTG
TCGGTGGAGAGAGCTTAGCAGTTGCCCAGAATACATACGCCAGCTCTTGG
TTTAAGGACAATGAGTTGAATTTCATTTTCGGTCTTCAATTGAGCATGTC
CAGAGTCGGGAGCACCGTCAATTTGAATACGATGATTCCGATTTATAATT
CATTACAGTTGCCGGAAGCTACAGGACATAAACGTTTGGGTACAGCTTTG
TTCGTTGCTTCGGCAACTTGCGTTTTTTCTTTGATTTGCGCATTGGTTCT
TTCTTTCTTTGACAAAAGAGCCGAGAAAATTTTAAAAAGAAAATCCAAAG
ATTCAGAAGCGGAAAAAATATCTCTCAAAGATATTCGTTATTTTTCAGTG
GCCTTCTGGCTAATCAGCGGCATTTGTGTAACGTATTACGTTGCAGTCTT
TCCTTTCATTTCTTTGTCGAAAGTATTTCTCATTCAGAAATACAGTTTAT
CCGGCCCCAAAGCGGCTTTAATCACAAGTTTATTGTACATTATCTCCGCT
GCCTGCAGCCCAGTAATGGGCTTTCTTATCGATTTTTCTGGGAAAAACTT
GTTCTGGGTCCTTACCGGTACTTTGGCCACATTAGGTGCTCATGCTCTCT
ATGCATTTACCTTTGGTAATCCTTTAGGCGTCATGATCTTCCTTGGAATA
TCCTATTCCGTTCTTGCCAGTTCGTTATGGCCAATGGTGGCGCTTGTCGT
TCCTACACATCAGCGCGGCACGGCATTCGGTATTATGCAATCGGTCCAGA
ATCTCGGGTTGGCGGTCGTTGCCATTATCGCAGGCGTAATTCAAGACAAA
TACGGATTTCTAATTCTTGAAGTTTTCTTCTCCATTTGGTTGTGTCTCGC
TGTAGCGCTTATTGTCATTCTTTATCTGTGGGACCTTCAAAACGGATCGA
AATTGAACGAAAGCGGTTTCAGCAGGAAACGGAAACTCGCTCAAGAGGAA
GTCACTGTCAGCCAGACTTTAAAAAGTTAATGCAAAATTAACTTGATAAA
TCCTGATAGTCAACAAATGTCCACCAGAGTTTCCTTTTAATTATGTATTT
TTATATGGAATAATTATTATTGATTGATTTCAATTTTTATAATTTATTGA
TTTTTAGTCAACCAATTATCGATTTCCTATCAAATATCGATTGTGATTTT
TATTGTTTTTAAGTAAAGATTTCTATTTGTTTACACCGAATTTTATTGAT
TTATTGATTGATTAATATCGATTTGTGCTGATAATGTTTATGTTATATTA
TTGAATTCACGCGGAAATAATTCTCGATAAAATTGTGAAATATTTTATCG
ATTTAAAAAAAACTAATAAAATCGC
back to top

protein sequence of SMED30010337-orf-1

>SMED30010337-orf-1 ID=SMED30010337-orf-1|Name=SMED30010337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MNDSESQEILYQDDETLTGCGASLPCDPKRRLHRYLVLFLICFLSFGSYF
CYDNPAALEDLMMSDLNLTASSYMSFYSWYSWPNVVLSFIGGFLIDRVFG
IRLGAIIFSLFVLAGQFFFAGGAYIDSYYLCVFGRFLFGVGGESLAVAQN
TYASSWFKDNELNFIFGLQLSMSRVGSTVNLNTMIPIYNSLQLPEATGHK
RLGTALFVASATCVFSLICALVLSFFDKRAEKILKRKSKDSEAEKISLKD
IRYFSVAFWLISGICVTYYVAVFPFISLSKVFLIQKYSLSGPKAALITSL
LYIISAACSPVMGFLIDFSGKNLFWVLTGTLATLGAHALYAFTFGNPLGV
MIFLGISYSVLASSLWPMVALVVPTHQRGTAFGIMQSVQNLGLAVVAIIA
GVIQDKYGFLILEVFFSIWLCLAVALIVILYLWDLQNGSKLNESGFSRKR
KLAQEEVTVSQTLKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 27..434
e-value: 3.4E-45
score: 156.4
NoneNo IPR availablePANTHERPTHR23512FAMILY NOT NAMEDcoord: 23..449
NoneNo IPR availableCDDcd17340MFS_MFSD1coord: 38..432
e-value: 0.0
score: 512.974
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 411..433
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 39..343
e-value: 2.7E-20
score: 72.6
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 34..437
score: 14.844
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 23..433