SSB

Overview
NameSSB
Smed IDSMED30010336
Length (bp)1842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SSB (SMED30010336) t-SNE clustered cells

Violin plots show distribution of expression levels for SSB (SMED30010336) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SSB (SMED30010336) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SSB (SMED30010336) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010336

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30010336h1SMcG0007996 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SSB vs. Ensembl Zebrafish
Match: larp1 (La ribonucleoprotein 1, translational regulator [Source:ZFIN;Acc:ZDB-GENE-030131-5386])

HSP 1 Score: 50.0618 bits (118), Expect = 7.998e-6
Identity = 31/102 (30.39%), Postives = 48/102 (47.06%), Query Frame = 2
Query:  551 ISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDGW-FPAKLIDDSHQNNVPQWV 853
            + DYI   + YYFS  N   D  L   MDE G + +  +  F R+  + T +  I++ALK S  V I+ MK  ++       W  P   + D  Q +  Q++
Sbjct:  291 LKDYIKRQIEYYFSVDNLERDFFLRRKMDEGGFLPVSLIASFHRVQALTTDVSLILQALKDSKVVDIIDMK--MRCKEEPQKWPLPDLCLPDQAQTDFAQFI 390          
BLAST of SSB vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 53.5286 bits (127), Expect = 9.920e-7
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  485 LKNGKYFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDG---W-FPAKLIDDSHQN------NVPQWVPISG 865
            L N  Y+    +  ++Y V   +  DYI   + YYFS  N   D  L   MD  G + +  +  F R+  + T IE I++ALK S  V+I+  K     +RR D    W  P   + D+ Q       N P++VP  G
Sbjct:  254 LSNITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDEK-----IRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVPRQG 386          
BLAST of SSB vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 53.5286 bits (127), Expect = 9.966e-7
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  485 LKNGKYFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDG---W-FPAKLIDDSHQN------NVPQWVPISG 865
            L N  Y+    +  ++Y V   +  DYI   + YYFS  N   D  L   MD  G + +  +  F R+  + T IE I++ALK S  V+I+  K     +RR D    W  P   + D+ Q       N P++VP  G
Sbjct:  304 LSNITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDEK-----IRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVPRQG 436          
BLAST of SSB vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 53.5286 bits (127), Expect = 1.062e-6
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  485 LKNGKYFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDG---W-FPAKLIDDSHQN------NVPQWVPISG 865
            L N  Y+    +  ++Y V   +  DYI   + YYFS  N   D  L   MD  G + +  +  F R+  + T IE I++ALK S  V+I+  K     +RR D    W  P   + D+ Q       N P++VP  G
Sbjct:  294 LSNITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDEK-----IRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVPRQG 426          
BLAST of SSB vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 53.5286 bits (127), Expect = 1.070e-6
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  485 LKNGKYFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDG---W-FPAKLIDDSHQN------NVPQWVPISG 865
            L N  Y+    +  ++Y V   +  DYI   + YYFS  N   D  L   MD  G + +  +  F R+  + T IE I++ALK S  V+I+  K     +RR D    W  P   + D+ Q       N P++VP  G
Sbjct:  242 LSNITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDEK-----IRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVPRQG 374          
BLAST of SSB vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 53.5286 bits (127), Expect = 1.175e-6
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  485 LKNGKYFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDG---W-FPAKLIDDSHQN------NVPQWVPISG 865
            L N  Y+    +  ++Y V   +  DYI   + YYFS  N   D  L   MD  G + +  +  F R+  + T IE I++ALK S  V+I+  K     +RR D    W  P   + D+ Q       N P++VP  G
Sbjct:  313 LSNITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDEK-----IRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVPRQG 445          
BLAST of SSB vs. Ensembl Mouse
Match: Larp1b (La ribonucleoprotein domain family, member 1B [Source:MGI Symbol;Acc:MGI:1914604])

HSP 1 Score: 50.0618 bits (118), Expect = 4.174e-6
Identity = 34/106 (32.08%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  452 GNADERPSAGQLKNGK-YFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMK 763
            G   E+P + +L     Y+     G  +Y V  ++  +YI   + YYFS +N   D  L   MDE G + +  +  F R+  + T +  I+EALK S  V+IV  K
Sbjct:  133 GERTEQPFSTELNTSMMYYYDDGTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNLNLILEALKDSTEVEIVDEK 238          
BLAST of SSB vs. Ensembl Mouse
Match: Larp1b (La ribonucleoprotein domain family, member 1B [Source:MGI Symbol;Acc:MGI:1914604])

HSP 1 Score: 50.447 bits (119), Expect = 4.273e-6
Identity = 34/106 (32.08%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  452 GNADERPSAGQLKNGK-YFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMK 763
            G   E+P + +L     Y+     G  +Y V  ++  +YI   + YYFS +N   D  L   MDE G + +  +  F R+  + T +  I+EALK S  V+IV  K
Sbjct:  180 GERTEQPFSTELNTSMMYYYDDGTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNLNLILEALKDSTEVEIVDEK 285          
BLAST of SSB vs. Ensembl Mouse
Match: Larp1b (La ribonucleoprotein domain family, member 1B [Source:MGI Symbol;Acc:MGI:1914604])

HSP 1 Score: 50.0618 bits (118), Expect = 4.958e-6
Identity = 34/106 (32.08%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  452 GNADERPSAGQLKNGK-YFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMK 763
            G   E+P + +L     Y+     G  +Y V  ++  +YI   + YYFS +N   D  L   MDE G + +  +  F R+  + T +  I+EALK S  V+IV  K
Sbjct:  162 GERTEQPFSTELNTSMMYYYDDGTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNLNLILEALKDSTEVEIVDEK 267          
BLAST of SSB vs. Ensembl Mouse
Match: Larp1b (La ribonucleoprotein domain family, member 1B [Source:MGI Symbol;Acc:MGI:1914604])

HSP 1 Score: 49.6766 bits (117), Expect = 8.826e-6
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 2
Query:  500 YFTQRSAGKDIYMVFNSI-SDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMK 763
            Y+     G  +Y V  ++  +YI   + YYFS +N   D  L   MDE G + +  +  F R+  + T +  I+EALK S  V+IV  K
Sbjct:  403 YYYDDGTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNLNLILEALKDSTEVEIVDEK 491          
BLAST of SSB vs. TrEMBL
Match: A0A0X3PHX6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR151765 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.750e-18
Identity = 46/132 (34.85%), Postives = 78/132 (59.09%), Query Frame = 2
Query:  407 NYTVSKWHEISSFYDGNADE-RPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDGW 799
            ++ +  W E+   +     E R  +G L +G+ + Q++A +D Y +F S S YI  F++YYFS  N   D+ +  +M E  +V++  LI+ PRLA IGTT+ D+  A+  SN + +V +    +GV+R+DG+
Sbjct:   90 DFRIITWEELRHLFPKPGPEGRVESGLLSDGRAYAQKTAKRDNYFLFPSKSAYILYFIHYYFSRDNLDRDQTIRRMMIENTAVSVDKLIQAPRLASIGTTVSDLEVAIHNSNILCLVDLPDGKRGVKRYDGY 221          
BLAST of SSB vs. TrEMBL
Match: A0A5K3FBP8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.464e-17
Identity = 49/136 (36.03%), Postives = 81/136 (59.56%), Query Frame = 2
Query:  398 IFINYTVSKWHEISSFY-DGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALK-YSNFVKIVSMKSDLKGVRRFDGW 799
            I  ++ V  W E+ +   +  +D R  +G L +G+ F Q++A KD Y +F S S YI  F +YYFS +N   D+ +  LM +  +V ++ +I+ PRLA IGTT++D+ +A++  SN + +V+       VRR DG+
Sbjct:   47 IEKDFRVVSWEELRTLLPEAPSDGRVESGLLSDGRAFAQKTARKDNYFLFPSKSAYILYFTHYYFSRENLDRDQTIRKLMTDNAAVPIEKIIEAPRLASIGTTVDDMKKAIETCSNLLCLVNSSDGRCFVRRIDGY 182          
BLAST of SSB vs. TrEMBL
Match: A0A0R3ULG3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8516 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.729e-17
Identity = 49/136 (36.03%), Postives = 81/136 (59.56%), Query Frame = 2
Query:  398 IFINYTVSKWHEISSFY-DGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALK-YSNFVKIVSMKSDLKGVRRFDGW 799
            I  ++ V  W E+ +   +  +D R  +G L +G+ F Q++A KD Y +F S S YI  F +YYFS +N   D+ +  LM +  +V ++ +I+ PRLA IGTT++D+ +A++  SN + +V+       VRR DG+
Sbjct:  176 IEKDFRVVSWEELRTLLPEAPSDGRVESGLLSDGRAFAQKTARKDNYFLFPSKSAYILYFTHYYFSRENLDRDQTIRKLMTDNAAVPIEKIIEAPRLASIGTTVDDMKKAIETCSNLLCLVNSSDGRCFVRRIDGY 311          
BLAST of SSB vs. TrEMBL
Match: A0A0R3X6U0 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9228 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.148e-16
Identity = 46/133 (34.59%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  407 NYTVSKWHEISSFY-DGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKY-SNFVKIVSMKSDLKGVRRFDGW 799
            ++ +  W E+ S   + ++D R  +G L +G+ F QRS  +D Y +F S S YI  F +YYFS +N   D+ +  +M +  ++A+  +I+ PRLA IGTTI+D+  A++  SN + +++       +RR DG+
Sbjct:   77 DFRIIPWDELKSLLAEESSDVRAESGLLSDGRAFAQRSPRRDAYFLFPSKSAYILYFTHYYFSRENLDRDQTIRGMMLDNCAIAIDKIIEAPRLASIGTTIDDMKVAVESGSNILCVLNAPDGRCYLRRIDGY 209          
BLAST of SSB vs. TrEMBL
Match: A0A0R3W168 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3461 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 8.099e-16
Identity = 46/133 (34.59%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  407 NYTVSKWHEISSFY-DGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKY-SNFVKIVSMKSDLKGVRRFDGW 799
            ++ +  W E+ S   + ++D R  +G L +G+ F QRS  +D Y +F S S YI  F +YYFS +N   D+ +  +M +  ++A+  +I+ PRLA IGTTI+D+  A++  SN + +++       +RR DG+
Sbjct:   77 DFRIIPWDELKSLLTEESSDVRAESGLLSDGRAFAQRSPRRDAYFLFPSKSAYILYFTHYYFSRENLDRDQTIRGMMLDNCAIAIDKIIEAPRLASIGTTIDDMKVAVESGSNVLCVLNAPDGRCYLRRIDGY 209          
BLAST of SSB vs. Planmine SMEST
Match: SMESG000038360.1 (SMESG000038360.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 299/300 (99.67%), Postives = 299/300 (99.67%), Query Frame = 2
Query:   26 MRTSDMRFTSANDNPGIRFSHPIQYIPQQHNQTQNLFYQTPVGIPISPQIANGSHLNNYSLYSQIYQIPNQQIMMSGNQQLLISMPSTNNHMPDNTNLGNISAVDXXXXXXXXXXXXXXXXXXXIFINYTVSKWHEISSFYDGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDGWFPAKLIDDSHQNNVPQWVPISGESGSNYSKKPDNEMLGKKNF 925
            MRTSDMRFTSANDNPGIRFSHPIQYIPQQHNQTQNLFYQTPVGIPISPQIANGSHLNNYSLYSQIYQIPNQQIMMSGNQQLLISMPSTNNHMPDNTNLGNISAVDSNMNSSVTSPVSMTSVQSQIFINYTVSKWHEISSFYDGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDGWFPAKLIDDSHQNNVPQWVPISGESGSNYSKKPDNEMLGKK F
Sbjct:    1 MRTSDMRFTSANDNPGIRFSHPIQYIPQQHNQTQNLFYQTPVGIPISPQIANGSHLNNYSLYSQIYQIPNQQIMMSGNQQLLISMPSTNNHMPDNTNLGNISAVDSNMNSSVTSPVSMTSVQSQIFINYTVSKWHEISSFYDGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLKGVRRFDGWFPAKLIDDSHQNNVPQWVPISGESGSNYSKKPDNEMLGKKIF 300          
BLAST of SSB vs. Planmine SMEST
Match: SMESG000023300.1 (SMESG000023300.1)

HSP 1 Score: 137.887 bits (346), Expect = 3.523e-35
Identity = 63/129 (48.84%), Postives = 92/129 (71.32%), Query Frame = 2
Query:  410 YTVSKWHEISSFYDGNADERPSAGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSM-KSDLKGVRRFD 793
            Y +  W +I+  Y+GN +E+P  G+L++  YFTQRSA  D+YM+F+  SDYINNFVNYYFS+KN + D+KL  LMD+ G V L  L KFP+L  + TT+ED+I+A + ++FV  V + +++ KG +R D
Sbjct:   87 YKIVSWQDIADSYEGN-EEKPKCGKLRDNIYFTQRSASSDMYMIFDKKSDYINNFVNYYFSDKNLARDQKLVALMDDKGIVPLSALAKFPKLHQVDTTVEDLIKAFQCNSFVAAVDIGQNNEKGAQRRD 214          
BLAST of SSB vs. Planmine SMEST
Match: SMESG000004135.1 (SMESG000004135.1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.803e-6
Identity = 32/89 (35.96%), Postives = 47/89 (52.81%), Query Frame = 2
Query:  569 NFVNYYFSNKNFSTDEKLFNLMDECGSVALKDLIKFPRLAHIGTTIED---IIEALKYSNF---------VKIVSMKSDLKG--VRRFD 793
            N ++YYFS  N   D+ L ++MD+ G V L  L+KFPRL    TT++D   I+  +KY  F           ++ +K D  G  +RR D
Sbjct:  195 NVLSYYFSEMNLFNDKYLMSIMDDDGWVNLDILLKFPRLLKTKTTMQDVSNIVSNIKYPEFSYNGTKSLPETVLQLKEDENGWKIRRSD 283          
The following BLAST results are available for this feature:
BLAST of SSB vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
larp17.998e-630.39La ribonucleoprotein 1, translational regulator [S... [more]
back to top
BLAST of SSB vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp19.920e-731.16La ribonucleoprotein domain family member 1 [Sourc... [more]
larp19.966e-731.16La ribonucleoprotein domain family member 1 [Sourc... [more]
larp11.062e-631.16La ribonucleoprotein domain family member 1 [Sourc... [more]
larp11.070e-631.16La ribonucleoprotein domain family member 1 [Sourc... [more]
larp11.175e-631.16La ribonucleoprotein domain family member 1 [Sourc... [more]
back to top
BLAST of SSB vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Larp1b4.174e-632.08La ribonucleoprotein domain family, member 1B [Sou... [more]
Larp1b4.273e-632.08La ribonucleoprotein domain family, member 1B [Sou... [more]
Larp1b4.958e-632.08La ribonucleoprotein domain family, member 1B [Sou... [more]
Larp1b8.826e-633.71La ribonucleoprotein domain family, member 1B [Sou... [more]
back to top
BLAST of SSB vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PHX62.750e-1834.85Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A5K3FBP81.464e-1736.03Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3ULG33.729e-1736.03Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3X6U05.148e-1634.59Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3W1688.099e-1634.59Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of SSB vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SSB vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000038360.10.000e+099.67SMESG000038360.1[more]
SMESG000023300.13.523e-3548.84SMESG000023300.1[more]
SMESG000004135.14.803e-635.96SMESG000004135.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010336 ID=SMED30010336|Name=SSB|organism=Schmidtea mediterranea sexual|type=transcript|length=1842bp
ATCTATATAAATCTTATATGAAACTATGAGAACTAGTGATATGAGATTCA
CATCAGCAAATGATAACCCGGGTATTAGATTCAGCCATCCTATCCAATAT
ATTCCACAGCAACATAACCAGACACAAAATTTATTTTATCAGACACCTGT
TGGAATACCGATATCACCTCAAATCGCTAATGGATCACATTTAAATAATT
ATTCGCTATATTCTCAAATTTATCAAATTCCGAATCAACAAATAATGATG
AGTGGAAATCAACAATTATTAATTTCCATGCCTAGTACTAACAACCATAT
GCCGGATAATACAAATTTAGGTAACATTTCGGCTGTTGATTCAAATATGA
ATTCGTCTGTTACATCACCAGTTAGTATGACTTCGGTTCAGAGTCAAATA
TTTATTAATTATACTGTATCAAAATGGCATGAAATTTCATCATTTTATGA
TGGTAATGCCGATGAAAGACCAAGTGCAGGACAGTTGAAAAATGGGAAAT
ATTTTACTCAGAGATCAGCAGGAAAAGATATTTATATGGTATTTAATTCA
ATAAGTGATTATATAAATAATTTTGTAAATTATTATTTTTCAAATAAAAA
TTTTTCTACAGATGAAAAATTATTTAATTTAATGGACGAATGTGGTTCTG
TAGCCCTGAAAGATTTAATCAAATTTCCCAGGTTAGCTCACATTGGGACA
ACTATTGAAGATATTATAGAAGCTTTAAAATATAGTAATTTCGTAAAGAT
CGTTAGCATGAAAAGTGATTTAAAAGGTGTTCGAAGATTCGATGGATGGT
TTCCTGCTAAACTTATTGATGATTCGCATCAAAATAATGTACCGCAATGG
GTACCAATAAGCGGAGAAAGTGGGTCTAATTATTCAAAAAAGCCTGACAA
TGAAATGCTGGGGAAAAAAAATTTTTACAATGTATCTTCGTCTGTGATTT
CGGTTTCTGCACAAAATGCAATGGATTCGAACGTTATAACACAATCTCAT
CCAAATGATGGCAATTCTCACGTCGATAGTGGCGTTACACAAAACCCGCT
TATTTATTTTAGCCCATCTAATAGTTCTATTCATCAAGCAATGTATCCGT
CAACTATAATGCACGGGATTCATCAAAATCATTTGCATAATTTACAATCA
CAAAATCCTTCTGGTCACTTGTTGGCACCAGCTAATCCCACTCAACTGAT
ACTTCACACCCAACCATATTCGACATTTTACCAGCCTAACCAGTCTATTC
ACTTCAGACAATTTTGGCAAAATCCAAATATAACAGATTTAAGTGGCAAC
CCTATTTTATATACATCTAGTAACAATACTAATATGAGACATGTAATTGG
TGCTGGTGGTAACAATGTCAGCTCGAATTTGCGATAACATTCTTTTTTTA
CTGCTTTGGTGATAAATTTGTAAGTTGTGGTTTTCACTCATTGTGATACT
GAATTCGTGATAATGATTTAGAAAGTTTTCTCAACGTTATTGAATATTTG
AGCTAGTATTATCATGTGTTAAATTTGGTTGTACTGTGTATGGAAATTAT
ATACACGTGTAAATAACCTTTTCAAGTACACCTTTAGGTATTATTTGTGA
GTGAGCTTATAATGGAGTTATTTATTTTATTTTTTGACTTAAAGGTTTGC
CTTGGTGTTGTAGAGAAAAGTGATTGTTGATGTCATTGTGCATTTTAAAG
TCAAGAATTTTTCACGAATTTGGACATAAAAATTAAGTAGGCTGATTTCA
TATTACACTGCTGATGTTTTTATATTTCCTTATAGTGAAAGCGAAATTCA
GTATTTTGTAAGAATAAAATGATGCCTCAGTTTTGATATTAG
back to top

protein sequence of SMED30010336-orf-1

>SMED30010336-orf-1 ID=SMED30010336-orf-1|Name=SMED30010336-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MRTSDMRFTSANDNPGIRFSHPIQYIPQQHNQTQNLFYQTPVGIPISPQI
ANGSHLNNYSLYSQIYQIPNQQIMMSGNQQLLISMPSTNNHMPDNTNLGN
ISAVDSNMNSSVTSPVSMTSVQSQIFINYTVSKWHEISSFYDGNADERPS
AGQLKNGKYFTQRSAGKDIYMVFNSISDYINNFVNYYFSNKNFSTDEKLF
NLMDECGSVALKDLIKFPRLAHIGTTIEDIIEALKYSNFVKIVSMKSDLK
GVRRFDGWFPAKLIDDSHQNNVPQWVPISGESGSNYSKKPDNEMLGKKNF
YNVSSSVISVSAQNAMDSNVITQSHPNDGNSHVDSGVTQNPLIYFSPSNS
SIHQAMYPSTIMHGIHQNHLHNLQSQNPSGHLLAPANPTQLILHTQPYST
FYQPNQSIHFRQFWQNPNITDLSGNPILYTSSNNTNMRHVIGAGGNNVSS
NLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:1990904ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006630La_HTH
IPR011991WHTH_DNA-bd_dom