slc25a-34

Overview
Nameslc25a-34 (AKN21602.1)
Smed IDSMED30010330
Length (bp)1172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-34 (SMED30010330) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-34 (SMED30010330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-34 (SMED30010330) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-34 (SMED30010330) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of slc25a-34 vs. Ensembl Human
Match: SLC25A10 (solute carrier family 25 member 10 [Source:HGNC Symbol;Acc:HGNC:10980])

HSP 1 Score: 342.428 bits (877), Expect = 1.119e-116
Identity = 166/283 (58.66%), Postives = 208/283 (73.50%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            ++ + +V  WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DGILALY+GLSASL RQ+TYS+TRF IYET + +  KG+   LPF+EK  +  V+G  GG VG PAD+VNVRMQND+K+ +  RRNY +A DG++RV +EEG+  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF AS  A G AT + QP DV+KTRLMN+K G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR N G
Sbjct:    1 MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFG 282          
BLAST of slc25a-34 vs. Ensembl Human
Match: SLC25A10 (solute carrier family 25 member 10 [Source:HGNC Symbol;Acc:HGNC:10980])

HSP 1 Score: 335.88 bits (860), Expect = 5.357e-114
Identity = 167/292 (57.19%), Postives = 209/292 (71.58%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAA---------GIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            ++ + +V  WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DGILALY+GLSASL RQ+TYS+TRF IYET + +  KG+   LPF+EK  +  V+G  GG VG PAD+VNVRMQND+K+ +  RRNY +A DG++RV +EEG+  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF AS  AA         G AT + QP DV+KTRLMN+K G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR N G
Sbjct:    1 MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAAAGDEPPPQGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFG 291          
BLAST of slc25a-34 vs. Ensembl Human
Match: AC139530.2 (novel protein)

HSP 1 Score: 291.197 bits (744), Expect = 1.761e-94
Identity = 143/248 (57.66%), Postives = 180/248 (72.58%), Query Frame = 3
Query:  240 TQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            TQQ+ +  M GM L+VV+ DGILALY+GLSASL RQ+TYS+TRF IYET + +  KG+   LPF+EK  +  V+G  GG VG PAD+VNVRMQND+K+ +  RRNY +A DG++RV +EEG+  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF AS  A G AT + QP DV+KTRLMN+K G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR N G
Sbjct:  191 TQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFG 437          
BLAST of slc25a-34 vs. Ensembl Human
Match: SLC25A10 (solute carrier family 25 member 10 [Source:HGNC Symbol;Acc:HGNC:10980])

HSP 1 Score: 223.016 bits (567), Expect = 1.968e-68
Identity = 104/179 (58.10%), Postives = 135/179 (75.42%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQL 659
            ++ + +V  WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DGILALY+GLSASL RQ+TYS+TRF IYET + +  KG+   LPF+EK  +  V+G  GG VG PAD+VNVRMQND+K+ +  RRNY +A DG++RV +EEG+  LFSG +M ++R   +T GQL
Sbjct:    1 MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179          
BLAST of slc25a-34 vs. Ensembl Human
Match: SLC25A11 (solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981])

HSP 1 Score: 187.578 bits (475), Expect = 6.643e-56
Identity = 114/283 (40.28%), Postives = 155/283 (54.77%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQTQ----QKKEFGMGGMFL-KVVKNDGILALYNGLSASLLRQLTYSMTRFGIYET-YKKKKGAN-LP--FYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGY 974
            FGG+A   A     PLDL+K  +Q      + +E+      L  ++K +G+  +Y GLSA LLRQ TY+ TR GIY   +++  GA+  P  F  KA + M AG  G  VG PA++  +RM  D ++  + RR Y N F+ + R+ +EEGVL L+ G   T  RA  +   QLA Y   KQ L+ +G+FSDNIL HF AS  +  + T  + P D+ KTR+ N      KP   +GL      +   G    +KG  P + RLGP TVLTFIFLEQ  MN  Y
Sbjct:   27 FGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQ--MNKAY 307          
BLAST of slc25a-34 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 344.354 bits (882), Expect = 9.132e-118
Identity = 168/283 (59.36%), Postives = 208/283 (73.50%), Query Frame = 3
Query:  138 SKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFP 980
             K  ++G WYFGGVA AMAA CTHPLDLLKV LQTQQ+ +  +G + LK+ KNDGILA YNG+SAS+LRQLTYS TRFGIYET KK+  +   LPFY+KA ++  AG  GG+VG P D+VNVRMQND K+  E RRNY +A DG+ R+ +EEG + +F+G +M  +RA  MT GQL+FYD  KQTL+ +G   DN+ THF +S  AA +AT+MTQP DVMKTR+MNA PG + G+  C     K GP+GFFKG +PA+ RL P TVLTFIF EQLR+  GY P
Sbjct:    4 DKTKRLGRWYFGGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLSLKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQDQPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMNAAPGEFKGILDCFMFTAKLGPMGFFKGFIPAWARLAPHTVLTFIFFEQLRLKFGYAP 286          
BLAST of slc25a-34 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 344.354 bits (882), Expect = 9.132e-118
Identity = 168/283 (59.36%), Postives = 208/283 (73.50%), Query Frame = 3
Query:  138 SKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFP 980
             K  ++G WYFGGVA AMAA CTHPLDLLKV LQTQQ+ +  +G + LK+ KNDGILA YNG+SAS+LRQLTYS TRFGIYET KK+  +   LPFY+KA ++  AG  GG+VG P D+VNVRMQND K+  E RRNY +A DG+ R+ +EEG + +F+G +M  +RA  MT GQL+FYD  KQTL+ +G   DN+ THF +S  AA +AT+MTQP DVMKTR+MNA PG + G+  C     K GP+GFFKG +PA+ RL P TVLTFIF EQLR+  GY P
Sbjct:    4 DKTKRLGRWYFGGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLSLKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQDQPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMNAAPGEFKGILDCFMFTAKLGPMGFFKGFIPAWARLAPHTVLTFIFFEQLRLKFGYAP 286          
BLAST of slc25a-34 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 190.66 bits (483), Expect = 1.336e-57
Identity = 116/283 (40.99%), Postives = 152/283 (53.71%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQ---TQQKKEFGMGGMFL-KVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRL-----MNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYF 977
            FGG A   A     PLDL+K  +Q   T  KKE+      L  ++KN+G+ A+YNGLSA LLRQ TY+ TR G Y    E + +K    L F  KA + M AG IG  VG PA++  +RM  D ++  E RRNY    + + R+ KEEGVL L+ G + T  RA  +   QLA Y   KQ L+ +G   D I  HF AS  +    T+ + P D+ KTR+     ++ KP   +     G  I   G    +KG  P ++RLGP TVLTFI LEQ  MN  YF
Sbjct:   15 FGGTAGMGATLVVQPLDLVKNRMQLSGTTGKKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKD-KPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQ--MNAAYF 294          
BLAST of slc25a-34 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 190.66 bits (483), Expect = 1.336e-57
Identity = 116/283 (40.99%), Postives = 152/283 (53.71%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQ---TQQKKEFGMGGMFL-KVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRL-----MNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYF 977
            FGG A   A     PLDL+K  +Q   T  KKE+      L  ++KN+G+ A+YNGLSA LLRQ TY+ TR G Y    E + +K    L F  KA + M AG IG  VG PA++  +RM  D ++  E RRNY    + + R+ KEEGVL L+ G + T  RA  +   QLA Y   KQ L+ +G   D I  HF AS  +    T+ + P D+ KTR+     ++ KP   +     G  I   G    +KG  P ++RLGP TVLTFI LEQ  MN  YF
Sbjct:   15 FGGTAGMGATLVVQPLDLVKNRMQLSGTTGKKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKD-KPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQ--MNAAYF 294          
BLAST of slc25a-34 vs. Ensembl Celegans
Match: ucp-4 (UnCoupling Protein (Mitochondrial substrate carrier) [Source:UniProtKB/TrEMBL;Acc:O01883])

HSP 1 Score: 119.013 bits (297), Expect = 2.337e-30
Identity = 86/308 (27.92%), Postives = 141/308 (45.78%), Query Frame = 3
Query:  126 NKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMF---LKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYE-----TYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQND--MKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLM---------------NAKPGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            N    KK    Y +    A+ +A   T+PLD+ K  LQ  + K F  GGM      +++ +G +AL+ G++ ++ R   Y+  R G YE     T+ K+   + P ++       +G I     +P D+V V+MQ +   ++ K+  R Y  A D    + + +G   L+ G      RA  +    +A YD  K  L+      DN LTH  AS  A   A +++ P DV+KTR+M               N     Y G+  C   I+K  G    +KG +P++IR+ P ++  ++  E++R   G
Sbjct:   16 NSQTFKKIATKY-FLSCTAALVAETVTYPLDITKTRLQIARNK-FTKGGMVQVTYDIIRREGAMALWTGVAPAITRHYIYTGIRMGAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLR-YTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRKWTG 320          
BLAST of slc25a-34 vs. Ensembl Fly
Match: Dic1 (gene:FBgn0027610 transcript:FBtr0082747)

HSP 1 Score: 310.842 bits (795), Expect = 1.104e-104
Identity = 153/279 (54.84%), Postives = 193/279 (69.18%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +  +++   W+FGG+AS  AA  THPLDL+KV LQTQQ     +  +  K+ +  G+L  YNGLSAS+LRQLTYS  RFG+YE  KK    +  F  K A++  +G +GGIVG PADMVNVRMQND+K+  + RRNYNNAFDG+ RV ++EG   LFSG +    R   MT GQ+AFYD  K  L+ T +F DN++THFTAS  A  IAT +TQP DV+KTR MNAKPG ++GL        K GPLGFFKG VPAF+RLGP T++TF+FLEQLR+  G
Sbjct:    1 MPHQERKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQG-HLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTD-SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFG 277          
BLAST of slc25a-34 vs. Ensembl Fly
Match: Dic1 (gene:FBgn0027610 transcript:FBtr0346113)

HSP 1 Score: 310.842 bits (795), Expect = 1.104e-104
Identity = 153/279 (54.84%), Postives = 193/279 (69.18%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +  +++   W+FGG+AS  AA  THPLDL+KV LQTQQ     +  +  K+ +  G+L  YNGLSAS+LRQLTYS  RFG+YE  KK    +  F  K A++  +G +GGIVG PADMVNVRMQND+K+  + RRNYNNAFDG+ RV ++EG   LFSG +    R   MT GQ+AFYD  K  L+ T +F DN++THFTAS  A  IAT +TQP DV+KTR MNAKPG ++GL        K GPLGFFKG VPAF+RLGP T++TF+FLEQLR+  G
Sbjct:    1 MPHQERKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQG-HLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTD-SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFG 277          
BLAST of slc25a-34 vs. Ensembl Fly
Match: Dic1 (gene:FBgn0027610 transcript:FBtr0082748)

HSP 1 Score: 310.842 bits (795), Expect = 1.104e-104
Identity = 153/279 (54.84%), Postives = 193/279 (69.18%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +  +++   W+FGG+AS  AA  THPLDL+KV LQTQQ     +  +  K+ +  G+L  YNGLSAS+LRQLTYS  RFG+YE  KK    +  F  K A++  +G +GGIVG PADMVNVRMQND+K+  + RRNYNNAFDG+ RV ++EG   LFSG +    R   MT GQ+AFYD  K  L+ T +F DN++THFTAS  A  IAT +TQP DV+KTR MNAKPG ++GL        K GPLGFFKG VPAF+RLGP T++TF+FLEQLR+  G
Sbjct:    1 MPHQERKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQG-HLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTD-SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFG 277          
BLAST of slc25a-34 vs. Ensembl Fly
Match: Dic2 (gene:FBgn0038797 transcript:FBtr0334587)

HSP 1 Score: 266.929 bits (681), Expect = 3.663e-87
Identity = 138/280 (49.29%), Postives = 183/280 (65.36%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPE 983
            + ++  WYFGG+AS+MAA  THP+DL+KV +QTQ +K   +     K+VK  G LA+YNG+SAS+LRQ TY++ RFGIY         +     K  ++ +AG IGG VG PAD++NVR+QND+K+  E RRNY +A DG+ R+ +EEG   LF+G SM A R  FMT GQ+AFY+  K  +++ G   D + T+  AS  ++ +AT +TQP DV+KTR MNA PG YSGL        K GPL FFKG VP+  RL P TVL F+ LE LR + GY PE
Sbjct:   13 QRRIARWYFGGLASSMAAMVTHPIDLIKVLIQTQAEK-LSVFQTTRKIVKEQGPLAMYNGISASMLRQYTYTLARFGIYSVGSGAMDTST-MAGKTCLAAIAGGIGGFVGAPADLINVRLQNDVKLPPEKRRNYKHAIDGLVRITREEGWKNLFNGSSMIALRGAFMTVGQIAFYEQSKSQMIKLG-MPDYMGTYILASMISSVVATTLTQPIDVVKTRRMNAAPGEYSGLGDVFVKTSKEGPLAFFKGYVPSLSRLLPHTVLLFLGLEYLRTHFGYLPE 289          
BLAST of slc25a-34 vs. Ensembl Fly
Match: Dic2 (gene:FBgn0038797 transcript:FBtr0083891)

HSP 1 Score: 266.929 bits (681), Expect = 3.663e-87
Identity = 138/280 (49.29%), Postives = 183/280 (65.36%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPE 983
            + ++  WYFGG+AS+MAA  THP+DL+KV +QTQ +K   +     K+VK  G LA+YNG+SAS+LRQ TY++ RFGIY         +     K  ++ +AG IGG VG PAD++NVR+QND+K+  E RRNY +A DG+ R+ +EEG   LF+G SM A R  FMT GQ+AFY+  K  +++ G   D + T+  AS  ++ +AT +TQP DV+KTR MNA PG YSGL        K GPL FFKG VP+  RL P TVL F+ LE LR + GY PE
Sbjct:   13 QRRIARWYFGGLASSMAAMVTHPIDLIKVLIQTQAEK-LSVFQTTRKIVKEQGPLAMYNGISASMLRQYTYTLARFGIYSVGSGAMDTST-MAGKTCLAAIAGGIGGFVGAPADLINVRLQNDVKLPPEKRRNYKHAIDGLVRITREEGWKNLFNGSSMIALRGAFMTVGQIAFYEQSKSQMIKLG-MPDYMGTYILASMISSVVATTLTQPIDVVKTRRMNAAPGEYSGLGDVFVKTSKEGPLAFFKGYVPSLSRLLPHTVLLFLGLEYLRTHFGYLPE 289          
BLAST of slc25a-34 vs. Ensembl Zebrafish
Match: si:ch1073-100f3.2 (si:ch1073-100f3.2 [Source:ZFIN;Acc:ZDB-GENE-131127-11])

HSP 1 Score: 325.094 bits (832), Expect = 4.448e-110
Identity = 165/280 (58.93%), Postives = 204/280 (72.86%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGAN----LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM ++VV++DG+ ALYNGLSASL RQ++YSMTRF IYET + +  +     +PFY+K  ++   GF GG +G PADMVNVRMQNDMK+   LRRNY +A DG+ RV+KEEG+  LFSG SM A+R   +T GQL+ YD  KQ ++ TG  +DNI THF AS  A G AT++ QP DV+KTRLMN+K G Y GL  C +D  K GP  F+KGLVPA IRL P TVLTFIFLEQLR+  G
Sbjct:    3 ETRVSRWYFGGIASCAAACCTHPLDLIKVHLQTQQEVKMRMTGMAVQVVRSDGVFALYNGLSASLCRQMSYSMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFIGTPADMVNVRMQNDMKLPPVLRRNYAHALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAKQLVLGTGLMTDNIFTHFVASFIAGGCATVLCQPMDVVKTRLMNSK-GEYRGLIHCLSDTGKLGPKAFYKGLVPAGIRLIPHTVLTFIFLEQLRLYFG 281          
BLAST of slc25a-34 vs. Ensembl Zebrafish
Match: slc25a10 (solute carrier family 25 member 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1095])

HSP 1 Score: 314.309 bits (804), Expect = 7.322e-106
Identity = 163/288 (56.60%), Postives = 203/288 (70.49%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGAN----LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            M+ K +S+      WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + VVKNDG LALY+GLSASL RQ++YS+TRF IYET +   G+     +PFY+K  +    GF GG +G PADMVNVRMQND+K+  E RRNY +A DG+FRV +EEG   LFSG +M ++R   +T GQLA YD  KQ ++ TG   DNILTHF +S  A G AT + QP DV+KTRLMN+K G Y G+  C ++  K GPL F+KGLVPA IRL P T+LTF+FLEQL+   G
Sbjct:    1 MAEKRMSR------WYFGGIASCGAACCTHPLDLIKVHLQTQQEVKMRMMGMAIHVVKNDGFLALYSGLSASLCRQMSYSLTRFAIYETVRDMLGSGSQGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRMQNDVKLPLEQRRNYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAKQLVLGTGLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYRGVMHCLSETAKLGPLAFYKGLVPAGIRLIPHTILTFVFLEQLKKYFG 281          
BLAST of slc25a-34 vs. Ensembl Zebrafish
Match: slc25a11 (solute carrier family 25 member 11 [Source:ZFIN;Acc:ZDB-GENE-040625-79])

HSP 1 Score: 190.66 bits (483), Expect = 2.331e-57
Identity = 110/280 (39.29%), Postives = 149/280 (53.21%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQ--------TQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            FGG+A   A     PLDL+K  +Q         + K  F   G    +++N+G+  +Y GLSA LLRQ TY+ TR GIY    E   K  G    F+ KA + M AG  G  VG PA++  +RM  D ++  + RR Y N F+ + R+ +EEGV  L+ G   T  RA  +   QLA Y   KQ L+ +G+F D+IL HF AS  +  + T  + P D++KTR+ N      KP   +GL      I   G    +KG  P + RLGP TVLTFIFLEQ+
Sbjct:   21 FGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSFHAVG---SILRNEGVRGIYTGLSAGLLRQATYTTTRLGIYTILFERMSKADGTPPNFFMKALIGMTAGATGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQLASYSQSKQALLDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLVKVIRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 297          
BLAST of slc25a-34 vs. Ensembl Zebrafish
Match: ucp1 (uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010503-1])

HSP 1 Score: 159.073 bits (401), Expect = 3.318e-45
Identity = 96/280 (34.29%), Postives = 145/280 (51.79%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQKKEF----------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGIVG----NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
             G A+ +A   T PLD  KV LQ Q +K            G+ G    +++ +G  +LYNGL A L RQ+ ++  R G+Y+  K    +G + P     AV ++AG   G +      P D+V VR Q  M + + + R YN       ++ + EG+  L+ G     TR   +   +L  YDL K+ +++    SDN+  HF ++ GA  I T++  P DV+KTR MN+ PG YS    C   ++ K GP  F+KG VP+F+RLG   V+ F+  EQL+
Sbjct:   20 AGTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSFYTRGKDNP---NVAVRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNL-QGVGRRYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLLSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQYSSSTNCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLK 295          
BLAST of slc25a-34 vs. Ensembl Zebrafish
Match: ucp1 (uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010503-1])

HSP 1 Score: 159.073 bits (401), Expect = 3.318e-45
Identity = 96/280 (34.29%), Postives = 145/280 (51.79%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQKKEF----------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGIVG----NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
             G A+ +A   T PLD  KV LQ Q +K            G+ G    +++ +G  +LYNGL A L RQ+ ++  R G+Y+  K    +G + P     AV ++AG   G +      P D+V VR Q  M + + + R YN       ++ + EG+  L+ G     TR   +   +L  YDL K+ +++    SDN+  HF ++ GA  I T++  P DV+KTR MN+ PG YS    C   ++ K GP  F+KG VP+F+RLG   V+ F+  EQL+
Sbjct:   20 AGTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSFYTRGKDNP---NVAVRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNL-QGVGRRYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLLSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQYSSSTNCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLK 295          
BLAST of slc25a-34 vs. Ensembl Xenopus
Match: fbxo4 (F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443])

HSP 1 Score: 332.413 bits (851), Expect = 8.497e-113
Identity = 169/280 (60.36%), Postives = 203/280 (72.50%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + V++NDG LALYNGLSASL RQ+TYS+TRF IYET + +      A LPFY+K  +  V GF GG +G PADMVNVRMQND+K+   LRRNY +A DGMFRV++EEG   LFSG +M ++R   +T GQLA YD  KQ ++ TGF SDNI THF AS+ A G AT + QP DV+KTRLMNAK G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR   G
Sbjct:    3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKYFG 281          
BLAST of slc25a-34 vs. Ensembl Xenopus
Match: fbxo4 (F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443])

HSP 1 Score: 305.834 bits (782), Expect = 1.154e-102
Identity = 160/280 (57.14%), Postives = 193/280 (68.93%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + V++NDG LALYNGLSASL RQ+TYS+TRF IYET + +      A LPFY+K  +  V GF GG +G PADMVNVRMQND+K+   LRRNY +A DGMFRV++EEG   LFSG +M ++R   +T GQLA YD  KQ ++ TGF SDNI THF AS+ A G AT + QP DV+KTRLMNAK                    G ++GLVPA IRL P TVLTF+FLEQLR   G
Sbjct:    3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK--------------------GEYRGLVPAGIRLIPHTVLTFVFLEQLRKYFG 262          
BLAST of slc25a-34 vs. Ensembl Xenopus
Match: fbxo4 (F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443])

HSP 1 Score: 300.442 bits (768), Expect = 3.888e-100
Identity = 160/284 (56.34%), Postives = 195/284 (68.66%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKEL----RRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + V++NDG LALYNGLSASL RQ+TYS+TRF IYET + +      A LPFY+K  +  V GF GG +G PADMVN R+     +   L      +Y +A DGMFRV++EEG   LFSG +M ++R   +T GQLA YD  KQ ++ TGF SDNI THF AS+ A G AT + QP DV+KTRLMNAK G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR   G
Sbjct:    3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNHRIVKMFSVKIMLFPFVVCSYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKYFG 285          
BLAST of slc25a-34 vs. Ensembl Xenopus
Match: fbxo4 (F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443])

HSP 1 Score: 298.901 bits (764), Expect = 9.324e-100
Identity = 159/280 (56.79%), Postives = 193/280 (68.93%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + V++NDG LALYNGLSASL RQ+TYS+TRF IYET + +      A LPFY+K  +  V GF GG +G PADMVNVRMQND+K+   LRR  +     +  +   EG   LFSG +M ++R   +T GQLA YD  KQ ++ TGF SDNI THF AS+ A G AT + QP DV+KTRLMNAK G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR   G
Sbjct:    3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPAHLRRKQHY----IIFLPSLEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKYFG 277          
BLAST of slc25a-34 vs. Ensembl Xenopus
Match: fbxo4 (F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443])

HSP 1 Score: 299.286 bits (765), Expect = 9.991e-100
Identity = 160/288 (55.56%), Postives = 198/288 (68.75%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            M  + ++++ +V  WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + V++NDG LALYNGLSASL RQ+TYS+TRF IYET + +      A LPFY+K  +  V GF GG +G PADMVNVRMQND+K+   LRR  +     +  +   EG   LFSG +M ++R   +T GQLA YD  KQ ++ TGF SDNI THF AS+ A G AT + QP DV+KTRLMNAK G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR   G
Sbjct:    1 MRGREMAER-RVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPAHLRRKQHY----IIFLPSLEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKYFG 282          
BLAST of slc25a-34 vs. Ensembl Mouse
Match: Slc25a10 (solute carrier family 25 (mitochondrial carrier, dicarboxylate transporter), member 10 [Source:MGI Symbol;Acc:MGI:1353497])

HSP 1 Score: 327.791 bits (839), Expect = 4.272e-111
Identity = 160/278 (57.55%), Postives = 196/278 (70.50%), Query Frame = 3
Query:  150 KVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK----KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +   WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DG LALYNGLSASL RQ+TYS+TRF IYET +    K     LPFY K  +  ++G  GG VG PAD+VNVRMQNDMK+    RRNY++A DG++RV +EE +  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF +S  A G AT + QP DV+KTRLMN+K G Y G+  C  +  K GP  FFKGL PA IRL P TVLTF+FLEQLR + G
Sbjct:    5 RASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAMETAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFG 281          
BLAST of slc25a-34 vs. Ensembl Mouse
Match: Slc25a11 (solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 [Source:MGI Symbol;Acc:MGI:1915113])

HSP 1 Score: 184.496 bits (467), Expect = 6.753e-55
Identity = 111/283 (39.22%), Postives = 149/283 (52.65%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQTQ----QKKEFGMG-GMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGY 974
            FGG+A   A     PLDL+K  +Q      + +E+         ++K +G+  +Y GLSA LLRQ TY+ TR GIY    E      G    F  KA + M AG  G  VG PA++  +RM  D ++  + RR Y N F+ + R+ +EEGV  L+ G   T  RA  +   QLA Y   KQ L+ +G+FSDNIL HF AS  +  + T  + P D++KTR+ N      KP   +GL      +   G    +KG  P + RLGP TVLTFIFLEQ  MN  Y
Sbjct:   27 FGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQ--MNKAY 307          
BLAST of slc25a-34 vs. Ensembl Mouse
Match: Ucp3 (uncoupling protein 3 (mitochondrial, proton carrier) [Source:MGI Symbol;Acc:MGI:1099787])

HSP 1 Score: 159.073 bits (401), Expect = 3.312e-45
Identity = 95/280 (33.93%), Postives = 146/280 (52.14%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQ------QKKEF-GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGG----IVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGAD-IMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNL 968
            G A+  A   T PLD  KV LQ Q      Q  ++ G+ G  L +V+ +G  + Y+GL A L RQ++++  R G+Y++ K+    KGA+   +   A+ ++AG   G        P D+V VR Q  +++     R Y    D    + +EEGV  L+ G     TR   +   ++  YD+ K+ L+++  F+DN   HF ++ GA   AT++  P DV+KTR MNA  G Y     C    + + GP  F+KG VP+F+RLG   V+ F+  EQL+  L
Sbjct:   21 GTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGAD---HSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRAL 297          

HSP 2 Score: 54.299 bits (129), Expect = 1.094e-7
Identity = 43/193 (22.28%), Postives = 74/193 (38.34%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQ-------QKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMV----AGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDN 716
            G    AMA  C  P D++KV  Q         ++K  G    +  + + +G+  L+ G   ++ R    +      Y+  K+K   +  F +      V    AGF   +V +P D+V  R  N       L R Y +    M ++V +EG    + G   +  R           Y+  K+ LM+     ++
Sbjct:  120 GCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN-----APLGR-YRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKVQVLRES 306          
BLAST of slc25a-34 vs. Ensembl Mouse
Match: Ucp3 (uncoupling protein 3 (mitochondrial, proton carrier) [Source:MGI Symbol;Acc:MGI:1099787])

HSP 1 Score: 159.073 bits (401), Expect = 3.312e-45
Identity = 95/280 (33.93%), Postives = 146/280 (52.14%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQ------QKKEF-GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGG----IVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGAD-IMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNL 968
            G A+  A   T PLD  KV LQ Q      Q  ++ G+ G  L +V+ +G  + Y+GL A L RQ++++  R G+Y++ K+    KGA+   +   A+ ++AG   G        P D+V VR Q  +++     R Y    D    + +EEGV  L+ G     TR   +   ++  YD+ K+ L+++  F+DN   HF ++ GA   AT++  P DV+KTR MNA  G Y     C    + + GP  F+KG VP+F+RLG   V+ F+  EQL+  L
Sbjct:   21 GTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGAD---HSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRAL 297          

HSP 2 Score: 54.299 bits (129), Expect = 1.094e-7
Identity = 43/193 (22.28%), Postives = 74/193 (38.34%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQ-------QKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMV----AGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDN 716
            G    AMA  C  P D++KV  Q         ++K  G    +  + + +G+  L+ G   ++ R    +      Y+  K+K   +  F +      V    AGF   +V +P D+V  R  N       L R Y +    M ++V +EG    + G   +  R           Y+  K+ LM+     ++
Sbjct:  120 GCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN-----APLGR-YRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKVQVLRES 306          
BLAST of slc25a-34 vs. Ensembl Mouse
Match: Ucp2 (uncoupling protein 2 (mitochondrial, proton carrier) [Source:MGI Symbol;Acc:MGI:109354])

HSP 1 Score: 153.68 bits (387), Expect = 3.095e-43
Identity = 90/280 (32.14%), Postives = 140/280 (50.00%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQQKKE-----------FGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNL 968
            G A+ +A   T PLD  KV LQ Q + +            G+ G  L +V+ +G  +LYNGL A L RQ++++  R G+Y++ K+   K   +     +       G +   V  P D+V VR Q   +      R Y +  +    + +EEG+  L+ G S    R   +   +L  YDL K TL++    +D++  HFT++ GA    T++  P DV+KTR MN+  G Y     C   ++ K GP  F+KG +P+F+RLG   V+ F+  EQL+  L
Sbjct:   21 GTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGG--RRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAL 298          
BLAST of slc25a-34 vs. UniProt/SwissProt
Match: sp|Q9UBX3|DIC_HUMAN (Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=2)

HSP 1 Score: 342.428 bits (877), Expect = 5.376e-116
Identity = 166/283 (58.66%), Postives = 208/283 (73.50%), Query Frame = 3
Query:  135 LSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            ++ + +V  WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DGILALY+GLSASL RQ+TYS+TRF IYET + +  KG+   LPF+EK  +  V+G  GG VG PAD+VNVRMQND+K+ +  RRNY +A DG++RV +EEG+  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF AS  A G AT + QP DV+KTRLMN+K G Y G+  C  +  K GPL F+KGLVPA IRL P TVLTF+FLEQLR N G
Sbjct:    1 MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFG 282          
BLAST of slc25a-34 vs. UniProt/SwissProt
Match: sp|Q9QZD8|DIC_MOUSE (Mitochondrial dicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a10 PE=1 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 2.988e-110
Identity = 160/278 (57.55%), Postives = 196/278 (70.50%), Query Frame = 3
Query:  150 KVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK----KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +   WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM L+VV+ DG LALYNGLSASL RQ+TYS+TRF IYET +    K     LPFY K  +  ++G  GG VG PAD+VNVRMQNDMK+    RRNY++A DG++RV +EE +  LFSG +M ++R   +T GQL+ YD  KQ ++ TG+ SDNI THF +S  A G AT + QP DV+KTRLMN+K G Y G+  C  +  K GP  FFKGL PA IRL P TVLTF+FLEQLR + G
Sbjct:    5 RASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAMETAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFG 281          
BLAST of slc25a-34 vs. UniProt/SwissProt
Match: sp|Q54PY7|M2OM_DICDI (Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum OX=44689 GN=ucpC PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.439e-71
Identity = 133/304 (43.75%), Postives = 184/304 (60.53%), Query Frame = 3
Query:  117 NMSNKNL--------SKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQK-----KEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGA-----YSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRM 962
            N  NKN+        + + ++  +  GG+A  +++A THP+D LKV +Q Q +      + G   M + + + +G   LY GLSASLLRQ TY+ TRFG+Y+  K    K    LPF +K  V M++G  G IVG PAD+  VRMQ D K+   LRRNY N FDG+FR+ KEEG++ L+ G S    RA FMT GQ++ YD  KQ ++ +G+F D+I TH  AST AA +A + T P DV+KTR+MN+         Y G   C +  ++  G   F+KG  P F+RLGPQT+LTFIF+EQL +
Sbjct:    5 NTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTGVGPKRGALKMLVHINQTEGFFTLYKGLSASLLRQATYTTTRFGLYDLIKDIVAKDDKPLPFTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGKLPFNLRRNYKNVFDGIFRISKEEGIISLWKGCSPNLIRAMFMTAGQVSSYDQTKQLMLASGYFHDDIKTHLIASTTAAFVAAVATSPLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKGFNPYFMRLGPQTILTFIFVEQLNI 308          
BLAST of slc25a-34 vs. UniProt/SwissProt
Match: sp|Q9SB52|PUMP4_ARATH (Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana OX=3702 GN=PUMP4 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 9.449e-62
Identity = 117/299 (39.13%), Postives = 160/299 (53.51%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQ-------------------------------TQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
            GG+AS +A   THPLDL+KV LQ                               T    + G   + + +VK++G  AL++G+SA+LLRQ  YS TR G+YE  K K    +   L    K    +VAG IG  VGNPAD+  VRMQ D ++    RRNY    D +  +VK EGV  L+ G ++T  RA  +T  QLA YD FK+ +++ G  +D + TH  AS  A  +A++ + P DV+KTR+MN K GAY G   C    +K  G +  +KG VP   R GP TV+ F+ LEQ+R
Sbjct:    9 GGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVGPISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTDPESGKLNLSRKIGAGLVAGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMKVGAYDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVR 307          
BLAST of slc25a-34 vs. UniProt/SwissProt
Match: sp|Q06143|DIC1_YEAST (Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIC1 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.146e-60
Identity = 115/298 (38.59%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  123 SNKNLSKKDKVGY-WYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK-----KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVL-VLFSGVSMTATRACFMTFGQLAFYDLFKQTLM-QTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 992
            +N   S    + Y W++GG A   A   THPLDL KV LQ     +  +  M   ++ N+G++ LY+GLSA++LRQ TY+  RFG Y+  K     +++  N+ +      SM +G IGG+ GN AD+VN+RMQND  +    RRNY NA DG++++ + EG L  LF+G      R   MT  Q+  YD+FK  L+ +  F +    TH TAS  A  +AT +  P DVMKTR+MN        L      + K GP   F+G +P+F RLGP T+L F  +EQL+ +    P++ +
Sbjct:    3 TNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYL--LPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKEDK 298          
BLAST of slc25a-34 vs. TrEMBL
Match: A0A0H3YFG4 (Slc25a-34 OS=Schmidtea mediterranea OX=79327 GN=slc25a-34 PE=2 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 291/291 (100.00%), Postives = 291/291 (100.00%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 992
            MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR
Sbjct:    1 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 291          
BLAST of slc25a-34 vs. TrEMBL
Match: A0A3P7LS67 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9624 PE=3 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 3.562e-156
Identity = 219/289 (75.78%), Postives = 241/289 (83.39%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQ 986
            MS+K   K  KVGYWYFGGVASAMAAA THPLDL+KVHLQTQQKKEFGM  M ++V KNDG  ALYNGLSAS+LRQLTYSMTRFGIYETYK K G  + F E A V+M +GF GG+VGNPADMVNVRMQNDMKI    RRNY +A DG+ +V ++EGV  LF+GVSMTATRA FMTFGQLAFYD FKQ L+ TG+F DN +THFTAS GAAGIAT MTQPFDVMKTRLMNA PG YSG+AACG D+M+TGPLGFFKGLVPAFIRLGP TVLTFIFLEQL+ N GY P Q
Sbjct:    1 MSDK---KPAKVGYWYFGGVASAMAAAVTHPLDLIKVHLQTQQKKEFGMITMGIRVFKNDGFFALYNGLSASILRQLTYSMTRFGIYETYKNKLGRKMTFLESAGVAMFSGFAGGVVGNPADMVNVRMQNDMKIPPAQRRNYKHAIDGLIQVCRKEGVSSLFNGVSMTATRATFMTFGQLAFYDTFKQMLLATGYFHDNPITHFTASIGAAGIATCMTQPFDVMKTRLMNAPPGKYSGIAACGIDVMRTGPLGFFKGLVPAFIRLGPHTVLTFIFLEQLKQNFGYIPTQ 286          
BLAST of slc25a-34 vs. TrEMBL
Match: A0A0X3PD45 (Mitochondrial dicarboxylate carrier OS=Schistocephalus solidus OX=70667 GN=DIC PE=3 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 4.409e-155
Identity = 218/289 (75.43%), Postives = 239/289 (82.70%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQ 986
            MS K   K  KVGYWYFGGVASAMAAA THPLDL+KVHLQTQQKKE GM  M ++V KNDG  ALYNGLSASLLRQLTYSMTRFGIYETYK   G  + F E A V+M++GF GG+VGNPADMVNVRMQNDMKI    RRNY +A DG+ +V ++EGV  LF+GVSMTATRA FMTFGQLAFYD FKQ L+ TG+F DN +THF+AS GAAGIAT MTQPFDVMKTRLMNA PG YSGLAACG D+M+TGPLGFFKGLVPAFIRLGP TVLTFIFLEQL+ N GY P Q
Sbjct:    1 MSEK---KPAKVGYWYFGGVASAMAAAVTHPLDLIKVHLQTQQKKELGMISMGIRVFKNDGFFALYNGLSASLLRQLTYSMTRFGIYETYKTNLGRKMTFAESAGVAMISGFAGGVVGNPADMVNVRMQNDMKIPPAERRNYKHAIDGLIQVTRKEGVGALFNGVSMTATRAMFMTFGQLAFYDTFKQLLLATGYFHDNPITHFSASIGAAGIATCMTQPFDVMKTRLMNAPPGKYSGLAACGLDVMRTGPLGFFKGLVPAFIRLGPHTVLTFIFLEQLKQNFGYIPTQ 286          
BLAST of slc25a-34 vs. TrEMBL
Match: A0A0R3U2L2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS720 PE=3 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 2.643e-154
Identity = 213/279 (76.34%), Postives = 235/279 (84.23%), Query Frame = 3
Query:  150 KVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQ 986
            K GYWYFGG+ASAMAAA THPLDL+KVHLQTQQ KEFGM GM ++V KNDG  ALYNGLSASLLRQLTYSMTRFG+YE+YK   G  + F E  AV+M AGF+GG+VGNPADMVNVRMQND+KI    RRNY +A DG+ RV KEEGVL LF+GVSMTATRA FMTFGQLAFYD FK  L+ TGFFSDN +THF+AS GAAG+AT MTQPFDVMKTRLMNA PG YSGLAACG D+++TGPLGFFKGLVPAFIRLGP TVLTFIFLEQL+ N GY P  
Sbjct:    8 KAGYWYFGGLASAMAAAVTHPLDLIKVHLQTQQTKEFGMIGMGVRVFKNDGFFALYNGLSASLLRQLTYSMTRFGVYESYKNSVGRKMTFAESGAVAMFAGFMGGVVGNPADMVNVRMQNDVKIPAAQRRNYKHAIDGLVRVAKEEGVLSLFNGVSMTATRAMFMTFGQLAFYDTFKAMLLSTGFFSDNPVTHFSASIGAAGVATCMTQPFDVMKTRLMNAPPGKYSGLAACGMDVLRTGPLGFFKGLVPAFIRLGPHTVLTFIFLEQLKANFGYVPSS 286          
BLAST of slc25a-34 vs. TrEMBL
Match: A0A0R3SZT6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS15 PE=3 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.247e-153
Identity = 215/290 (74.14%), Postives = 237/290 (81.72%), Query Frame = 3
Query:  120 MSNKNLSKKD-KVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQ 986
            MS     KK  K GYWYFGG+ASAMAAA THPLDLLKVHLQTQQ KEFGM GM ++V KNDGI  LYNGLSASLLRQLTYSMTRFG+YE+YK   G  + F E   V+MVAGF+GGIVGNP DMVNVRMQND+K+    RRNY +A DG+ RV +EEGV  LF+GVSMTATRA FMTFGQLAFYD FK  L+ TG F DN +THF+AS GAAG+AT MTQPFDVMKTRLMNA PG YSGLAACG D+M+TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL+ N GY P +
Sbjct:    1 MSATTTEKKVVKAGYWYFGGLASAMAAAVTHPLDLLKVHLQTQQTKEFGMIGMGVRVFKNDGIFGLYNGLSASLLRQLTYSMTRFGVYESYKNSVGRKMTFAESGGVAMVAGFVGGIVGNPGDMVNVRMQNDVKVPAAQRRNYKHAIDGLIRVAREEGVGALFNGVSMTATRAMFMTFGQLAFYDTFKTMLLSTGLFHDNPVTHFSASIGAAGVATCMTQPFDVMKTRLMNAPPGKYSGLAACGMDVMRTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLKQNFGYIPGE 290          
BLAST of slc25a-34 vs. Ensembl Cavefish
Match: si:ch1073-100f3.2 (solute carrier family 25 member 10 [Source:NCBI gene;Acc:103026812])

HSP 1 Score: 316.235 bits (809), Expect = 1.377e-106
Identity = 160/280 (57.14%), Postives = 201/280 (71.79%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG++S  AA CTHPLDL+KVHLQTQQ+ +  M GM L+VV++DG+LALY+GLSAS+ RQLTYSMTRF IYET +          +PFY+K  ++   G IGG +G PADMVNVRMQND+K+  ELRR+Y +A DG+ RV +EEG+  LFSG SM ++R   ++ GQL+ YD  KQ ++ TG  +DNI THF AS  A G AT++ QP DV+KTRLMN+K G Y G+  C  D    GP  F+KGLVPA IRL P TVLTFIFLEQLR+  G
Sbjct:    8 EKRVSRWYFGGLSSCAAACCTHPLDLIKVHLQTQQEVKMRMTGMALRVVRSDGVLALYSGLSASMCRQLTYSMTRFAIYETVRDMVADGNHGPMPFYQKVLLASFGGLIGGFIGTPADMVNVRMQNDVKLPPELRRSYAHALDGVIRVWREEGIRKLFSGASMASSRGALVSVGQLSCYDQAKQLVLGTGILTDNIATHFIASFIAGGCATVLCQPMDVVKTRLMNSK-GEYRGVMHCLTDTATLGPQAFYKGLVPAGIRLIPHTVLTFIFLEQLRLYFG 286          
BLAST of slc25a-34 vs. Ensembl Cavefish
Match: si:ch1073-100f3.2 (solute carrier family 25 member 10 [Source:NCBI gene;Acc:103026812])

HSP 1 Score: 293.893 bits (751), Expect = 6.098e-98
Identity = 158/280 (56.43%), Postives = 199/280 (71.07%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK----KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            + +V  WYFGG++S  AA CTHPLDL+KVHLQTQQ+ +  M GM L+VV++DG+LALY+GLSAS+ RQLTYSMTRF IYET +          +PFY+K  ++   G IGG +G PADMVNVRMQND+K+  ELRR+Y +A DG+ RV +EEG+  LFSG SM ++R   ++ GQL+ YD  KQ ++ TG  +DNI THF AS  A G AT++ QP DV+KTRLMN+K G Y  + A G D   +  L F  GLVPA IRL P TVLTFIFLEQLR+  G
Sbjct:    8 EKRVSRWYFGGLSSCAAACCTHPLDLIKVHLQTQQEVKMRMTGMALRVVRSDGVLALYSGLSASMCRQLTYSMTRFAIYETVRDMVADGNHGPMPFYQKVLLASFGGLIGGFIGTPADMVNVRMQNDVKLPPELRRSYAHALDGVIRVWREEGIRKLFSGASMASSRGALVSVGQLSCYDQAKQLVLGTGILTDNIATHFIASFIAGGCATVLCQPMDVVKTRLMNSK-GEYR-VRAFGID--SSSGLNF--GLVPAGIRLIPHTVLTFIFLEQLRLYFG 281          
BLAST of slc25a-34 vs. Ensembl Cavefish
Match: slc25a10 (solute carrier family 25 member 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1095])

HSP 1 Score: 258.84 bits (660), Expect = 3.942e-84
Identity = 138/258 (53.49%), Postives = 172/258 (66.67%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGAN--LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFK 887
            MS K +S+      WYFGG+AS  AA CTHPLDL+KVHLQTQQ+ +  M GM + VVKNDG+LALYNGLSASL RQ++YS+TRF IYET +   G+   +PFY+K  +    GF GG +G PADMVNVR  N           Y +A DG+FRV +EEG   LFSG +M ++R   +T GQLA YD  KQ ++ TG   DN+LTHF +S  A G AT + QP DV+KTRLMN+K G Y G+  C A+  K GPL F+K
Sbjct:    1 MSEKRISR------WYFGGLASCGAACCTHPLDLVKVHLQTQQEVKMRMVGMAMHVVKNDGVLALYNGLSASLCRQMSYSLTRFAIYETVRDMMGSEGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRYANT-------HHTYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAKQLVLTTGVMGDNVLTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYRGVLHCLAETAKLGPLAFYK 244          
BLAST of slc25a-34 vs. Ensembl Cavefish
Match: slc25a11 (solute carrier family 25 member 11 [Source:NCBI gene;Acc:111191416])

HSP 1 Score: 194.126 bits (492), Expect = 1.822e-58
Identity = 110/277 (39.71%), Postives = 149/277 (53.79%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQTQ----QKKEFGMG-GMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            FGG+A   A     PLDL+K  +Q      + +E+         +++N+G+  +Y GLSA LLRQ TY+ TR GIY    E   K  G    F+ KA + M AG IG  VG PA++  +RM  D ++  + RR Y N F+ + R+ +EEG+  L+ G   T  RA  +   QLA Y   KQ LM TG+FSDNI  HF AS  +  + T  + P D+ KTR+ N      KP   +GL      +   G    +KG  P + RLGP TVLTFIFLEQ+
Sbjct:   51 FGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSLHAVASILRNEGVGGIYTGLSAGLLRQATYTTTRLGIYTVLFEKMTKADGTPPNFFMKAVIGMTAGAIGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALIRITREEGIPTLWRGCVPTMARAVVVNAAQLASYSQSKQALMDTGYFSDNIFLHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLLKVVRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 327          
BLAST of slc25a-34 vs. Ensembl Cavefish
Match: slc25a11 (solute carrier family 25 member 11 [Source:NCBI gene;Acc:111191416])

HSP 1 Score: 172.94 bits (437), Expect = 6.391e-51
Identity = 95/221 (42.99%), Postives = 122/221 (55.20%), Query Frame = 3
Query:  321 GLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            GLSA LLRQ TY+ TR GIY    E   K  G    F+ KA + M AG IG  VG PA++  +RM  D ++  + RR Y N F+ + R+ +EEG+  L+ G   T  RA  +   QLA Y   KQ LM TG+FSDNI  HF AS  +  + T  + P D+ KTR+ N      KP   +GL      +   G    +KG  P + RLGP TVLTFIFLEQ+
Sbjct:   56 GLSAGLLRQATYTTTRLGIYTVLFEKMTKADGTPPNFFMKAVIGMTAGAIGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALIRITREEGIPTLWRGCVPTMARAVVVNAAQLASYSQSKQALMDTGYFSDNIFLHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLLKVVRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 276          
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:555812])

HSP 1 Score: 146.747 bits (369), Expect = 2.730e-41
Identity = 91/289 (31.49%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQQKKEFGMG-------------GMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAA------VSMVAGFIGGIVG----NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNL 968
            G A+ +A   T PLD  KV LQ Q + + G G             G    +V+ +G  +LY+GL A L RQ++++  R G+Y++ K        FY   A        ++AG   G +      P D+V VR Q  + +    +R Y+   +    + +EEGV  L+ G     TR   +   +L  YD+ K T+++    +DN+  HF ++ GA    T++  P DV+KTR MN+ PG Y     C   ++ K G + F+KG VP+F+RLG   V+ F+  EQL+  +
Sbjct:   21 GTAACIADLITFPLDTAKVRLQVQGECQRGEGAARSAGVQYRGVFGTIAAMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKN-------FYTNGAEHAGIGCRLLAGCTTGAMAVTFAQPTDVVKVRFQAQVNMLGTSKR-YSGTMNAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIKDTILKYKLLTDNLPCHFVSAFGAGFCTTVVASPVDVVKTRYMNSAPGQYRSAFNCAYLMLTKEGAMAFYKGFVPSFLRLGSWNVVMFVTYEQLKRGI 301          

HSP 2 Score: 49.6766 bits (117), Expect = 4.428e-7
Identity = 38/159 (23.90%), Postives = 64/159 (40.25%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQ------QKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK------KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSG 611
            G    AMA     P D++KV  Q Q       K+  G    +  + + +G+  L+ G   ++ R    +      Y+  K      K    NLP +  +A    AGF   +V +P D+V  R  N           Y +AF+  + ++ +EG +  + G
Sbjct:  125 GCTTGAMAVTFAQPTDVVKVRFQAQVNMLGTSKRYSGTMNAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIKDTILKYKLLTDNLPCHFVSAFG--AGFCTTVVASPVDVVKTRYMNSAP------GQYRSAFNCAYLMLTKEGAMAFYKG 275          
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007951.1 (pep scaffold:Pmarinus_7.0:GL477057:42731:45697:1 gene:ENSPMAG00000007192.1 transcript:ENSPMAT00000007951.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 2.080e-18
Identity = 35/86 (40.70%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  705 FSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMK-TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
             +DN+  H  A+ GA   AT++  P DV+KTR MN+KPG Y     C   ++   GP  F+KG +P+F+RLG   ++ F+  EQL+
Sbjct:    5 LADNLPCHLVAAFGAGFCATVVASPVDVVKTRYMNSKPGQYRSAMNCALCLISMEGPTAFYKGFIPSFLRLGSWNIVMFVTFEQLK 90          
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 78.5666 bits (192), Expect = 3.292e-16
Identity = 75/306 (24.51%), Postives = 138/306 (45.10%), Query Frame = 3
Query:  114 LNMSNKNLSKKDKVGYWY----FGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGM--FLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGAN---LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRR--NYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDN----ILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSG--LAACG--ADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            L + ++   ++ K G W      GG A A++   T PLD +KV +Q    K   +  +  F +++K  GI +L+ G   ++++    +  +F  YE  KK  G+N   L  +E+     +AG     +  P +++  R+         LR+   Y+   D   ++  +EGV+  + G               LA Y+  K T + T +  D     IL      T ++    + + P  +++TR M A+     G  L+  G   +I+K  GPLG ++G+ P F+++ P   ++++  E L+  LG
Sbjct:  194 LTVPDEFTEEERKSGMWLRQLMAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNISILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFIGSNNVSLGIHERFMAGSLAGATAQTIIYPMEVMKTRLT--------LRKTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWL-TKYAKDTADPGILVLLACGTVSSSCGQVASYPLALIRTR-MQAQASMEGGPQLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVLG 489          
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Match: slc25a1b (slc25a1 solute carrier family 25 member 1b [Source:NCBI gene;Acc:795332])

HSP 1 Score: 75.485 bits (184), Expect = 1.033e-15
Identity = 66/277 (23.83%), Postives = 113/277 (40.79%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQK----KEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYE---TYKKKKGANLPFYEKAAVSMVAGFIGGI-VGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSD------NILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMK-TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            GG+A  +    T P + +K  LQ  +K    +  G+G    + V++ GI  LY GLS+ +   +  S  RFG++E    + +     L         + AG    + V  P + + V+  +D   +    R +   F G+  +V+++G+   + G++ T  +      G       F  T ++  +  D      N +        A   +     P DV+KTR+   +   Y     C   I K  GP  FFKG VP   R+     + FI  E++
Sbjct:    4 GGIAGGIEICITFPTEYVKTQLQLDEKANPPRYKGIGDCVSQTVRDHGIKGLYRGLSSLVYGSIPKSAVRFGMFEFLSNHMRDDQGKLNSTRGLLCGLGAGVAEAVLVVCPMETIKVKFIHDQCSSNPQYRGF---FHGVREIVRQQGIKGTYQGLTATVLKQ-----GSNQAIRFFVMTSLRNWYKGDNPNKEINPIVTGAFGATAGAASVFGNTPLDVIKTRMQGLQAHKYRSTYDCAYQIFKYEGPRAFFKGTVPRLGRVCLDVAIVFIIYEEV 272          
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.245e-14
Identity = 70/296 (23.65%), Postives = 127/296 (42.91%), Query Frame = 3
Query:  138 SKKDKVGYWY----FGGVASAMAAACTHPLDLLKVHLQTQQKKE--FGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKG---ANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQT-GFFSDN--ILTHFTASTGAAGIATLMTQPFDVMKTRLMNAK----PGAYS-GLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
             ++ + G W+     GG A  ++  CT PLD LKV +Q +  +    G+ G    +++  G+ +L+ G   ++++    +  +F  YE  KK  G     +   E+     +AG     V  P ++V  R+      A      Y++  D   ++ K EG+   F G               LA Y+  K   +Q  G    N  I      +T ++    L + P  +++TR+  A     PGA   G+      I++  G LG ++G+ P F+++ P   ++++  E L+  LG
Sbjct:   16 EEERRSGTWWRQLVAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLIGMRQEQIGVQERLVAGSLAGATAQTVIYPMEVVKTRL------ALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLKGALG 305          
BLAST of slc25a-34 vs. Ensembl Yeast
Match: DIC1 (Mitochondrial dicarboxylate carrier; integral membrane protein, catalyzes a dicarboxylate-phosphate exchange across the inner mitochondrial membrane, transports cytoplasmic dicarboxylates into the mitochondrial matrix [Source:SGD;Acc:S000004340])

HSP 1 Score: 200.675 bits (509), Expect = 3.091e-62
Identity = 115/298 (38.59%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  123 SNKNLSKKDKVGY-WYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK-----KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVL-VLFSGVSMTATRACFMTFGQLAFYDLFKQTLM-QTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 992
            +N   S    + Y W++GG A   A   THPLDL KV LQ     +  +  M   ++ N+G++ LY+GLSA++LRQ TY+  RFG Y+  K     +++  N+ +      SM +G IGG+ GN AD+VN+RMQND  +    RRNY NA DG++++ + EG L  LF+G      R   MT  Q+  YD+FK  L+ +  F +    TH TAS  A  +AT +  P DVMKTR+MN        L      + K GP   F+G +P+F RLGP T+L F  +EQL+ +    P++ +
Sbjct:    3 TNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYL--LPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKEDK 298          
BLAST of slc25a-34 vs. Ensembl Yeast
Match: OAC1 (Mitochondrial inner membrane transporter; transports oxaloacetate, sulfate, thiosulfate, and isopropylmalate; member of the mitochondrial carrier family [Source:SGD;Acc:S000001603])

HSP 1 Score: 116.316 bits (290), Expect = 3.826e-30
Identity = 87/303 (28.71%), Postives = 141/303 (46.53%), Query Frame = 3
Query:  141 KKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLK-------VVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANL-PFYEKAAVSMV---------AGFIGGIVGNPADMVNVRMQND---MKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTAST-GAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMK-TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPE 983
            K  K G +  GG+A+ +A   T+P++L+K+ +Q Q +       ++         + KN+GI  L  GL+A+ + Q+  + +R G YE  +        P  E   V  V         +G IG ++G+P  +V  R+Q+    +KI ++   +Y   ++G+  + K EGV  LF G+     R    +  QL  Y+  K  L++     D    H TAST    G+A +M  P+DV+ TR+ N K   Y G   C    ++  G    +KG      R+ P T++   F+EQ  M L Y  E
Sbjct:   19 KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQ--THYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMN-PWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ-TMKLVYSIE 317          
BLAST of slc25a-34 vs. Ensembl Yeast
Match: SFC1 (Mitochondrial succinate-fumarate transporter; transports succinate into and fumarate out of the mitochondrion; required for ethanol and acetate utilization [Source:SGD;Acc:S000003856])

HSP 1 Score: 104.375 bits (259), Expect = 1.007e-25
Identity = 88/299 (29.43%), Postives = 125/299 (41.81%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQK-------KEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGI---------VGNPADMVNVRMQNDMKIAKELR--RNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTG--AAGIATLMTQPFDVMKTRLMN------AKPGAYSGLAACGADIMK-TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR---MNLGYF 977
            GG A    A C HPLD +KV +Q  ++       K  G       + + +G LALY GL A ++  +     RF  YE Y+      L   E   VS    F+ G+         V NP ++V +R+Q       E      YNNA    + +VKEEGV  L+ GVS+TA R           Y   K+  +Q     D + +  T+  G  +  I      P D +KTRL         K      +   GA ++K  G    +KG+ P  +R+ P   +TF   E +R    NLG F
Sbjct:   17 GGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYR----TLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKE-FLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGIF 310          

HSP 2 Score: 72.4034 bits (176), Expect = 1.168e-14
Identity = 50/203 (24.63%), Postives = 87/203 (42.86%), Query Frame = 3
Query:  156 GYWYFGGVASAMAAAC--THPLDLLKVHLQTQQ--KKEFGMGGMF-------LKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK-----KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDN 716
            G  +  GV + +  A    +P++++K+ LQ Q     E   G  +         +VK +G+ ALY G+S +  RQ T     F +Y   K+      +   LP +E + + +++G IG     P D +  R+Q D  I+ E +           +++KEEG   L+ G++    R           Y+  ++ L   G F  N
Sbjct:  111 GNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGIFKKN 313          
BLAST of slc25a-34 vs. Ensembl Yeast
Match: YEA6 (Putative mitochondrial NAD+ transporter; member of the mitochondrial carrier subfamily (see also YIA6); has putative human ortholog; YEA6 has a paralog, YIA6, that arose from the whole genome duplication [Source:SGD;Acc:S000000732])

HSP 1 Score: 74.3294 bits (181), Expect = 2.858e-15
Identity = 71/292 (24.32%), Postives = 123/292 (42.12%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQ-------TQQKKEF-GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANL----PFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFK-------QTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTR--LMNAKPGAYSG--LAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYF 977
            G ++ A++A    P D+ K  LQ       T Q + + G  G F  + K++G   LY GL  ++L  +   M  F +Y+ + +K   ++    PF   A+ ++ AG I  +  NP  +V  R+     I K    +Y    D   +++++EG   L++G+ + A         Q   Y+  K        T + T   S N      AS  +  +A+ +T P ++++TR  L +  P       L        + G  GF+ G     +R  P  V+T +  E  +  L  F
Sbjct:   45 GALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYD-FCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGK-YSTHYKGTIDTFRKIIQQEGAKALYAGL-VPALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYLTTF 333          
BLAST of slc25a-34 vs. Ensembl Yeast
Match: MME1 (Transporter of the mitochondrial inner membrane that exports magnesium; involved in mitochondrial Mg2+ homeostasis; has similarity to human mitochondrial ATP-Mg/Pi carriers [Source:SGD;Acc:S000004776])

HSP 1 Score: 72.7886 bits (177), Expect = 9.795e-15
Identity = 78/313 (24.92%), Postives = 124/313 (39.62%), Query Frame = 3
Query:  138 SKKDKVGYWYF---GGVASAMAAACTHPLDLLKVHLQ--TQQKKEFGMGGMFLKVVKNDGIL-ALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGN----PADMVNVRMQNDMKIAKELRR---NYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQ-------TGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSG--------------LAACGADI--------MKTGPLGFFKGLVPAFIRLGPQTVLTFIFLE 950
            S +D    W+    GG+   +  +  H LD +K   Q     KK   M   +  +   +G+   LY G  A++L     +   FG YE Y K+              + AGF+G  + +    P++++  R+Q   +      +   NY+N  + +  V+KEEG   LF G   T  R    +  Q AFY+ F+Q   +        G  S  I         A G+A ++T P DV+KTR+   +P + S                AA    I           G LGFF G+ P F+    Q+ +  +  +
Sbjct:   46 SDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYE-YTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELS--IPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQ 355          
BLAST of slc25a-34 vs. Ensembl Nematostella
Match: EDO36980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH35])

HSP 1 Score: 345.125 bits (884), Expect = 2.925e-118
Identity = 164/285 (57.54%), Postives = 210/285 (73.68%), Query Frame = 3
Query:  129 KNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK---KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGY 974
            K + KK +   WY GG ASAMAA CTHPLDLLKVHLQTQQ+   G+  M + VV+  G+ ALYNGL+AS+LRQLTYS TR+G+YE +    +K    LPFY+K +++  +GF+GGI+GNPADMVNVRMQND+K+  + RRNY + FDG+++  K EGV   F GV+MT+TRA  +T  Q+A YD  KQ L+ TGFF DN++THFTAS  A  IAT +TQPFDVMKTR+M A+PG Y  +  C     K GP+GF+KG +PA++RLGPQT+LT+IFLEQLR+   Y
Sbjct:   15 KVVVKKQR---WYLGGCASAMAACCTHPLDLLKVHLQTQQQVTSGLSTMAVHVVRTQGVTALYNGLTASVLRQLTYSTTRYGLYEIWSGMLRKGTEPLPFYQKISLAAASGFLGGILGNPADMVNVRMQNDVKLPLDQRRNYKHVFDGLYQTAKYEGVPTWFKGVTMTSTRALLITVAQVACYDQAKQILLSTGFFKDNMVTHFTASFIAGTIATGITQPFDVMKTRIMEARPGQYKSVFHCVMYTAKLGPMGFYKGFIPAWVRLGPQTILTWIFLEQLRLLFPY 296          
BLAST of slc25a-34 vs. Ensembl Nematostella
Match: EDO47873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL59])

HSP 1 Score: 194.897 bits (494), Expect = 1.856e-59
Identity = 114/289 (39.45%), Postives = 160/289 (55.36%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGG----------MFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIY----ETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYF 977
            GG++   A     PLDL+K  +Q       G+GG          + + +++++G L +YNGLSA LLRQ TY+ TR G+Y    + +K   G+   F++K A+ M AG IG  VG PA++  +RM +D ++  E RR Y N F+ ++R+ KEEGVL L+ G   TA RA  +   QLA Y   KQ L+ T +F DNI+ HF AS  +    T+ + P D+ KTR+ N      KP  Y G       I++  G    +KG  P + R+GP TVLTFIFLEQL     YF
Sbjct:   17 GGLSGMGATFFVQPLDLVKNRMQMS-----GIGGATKEYRSSVHVVMSILRSEGFLGVYNGLSAGLLRQATYTTTRLGVYTNLLQHFKNPDGSAPGFFKKCALGMTAGAIGSFVGTPAEISLIRMTSDGRLPPEQRRGYTNVFNALYRMSKEEGVLTLWRGYIPTAVRAMVVNAAQLATYSQAKQLLLSTKYFEDNIVCHFGASMISGLATTVASMPVDIAKTRIQNMRIIDGKP-EYKGTMDVLVRIVRNEGVFALWKGFTPYYFRIGPHTVLTFIFLEQLNRAANYF 299          
BLAST of slc25a-34 vs. Ensembl Nematostella
Match: EDO25509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWA0])

HSP 1 Score: 148.288 bits (373), Expect = 1.625e-42
Identity = 81/234 (34.62%), Postives = 129/234 (55.13%), Query Frame = 3
Query:  297 DGILALYN-GLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGAD-----IMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            +G+L L+  GL+AS+LR+ +YS  R G+Y+  +         +    K     V+G +G  + NPAD+V +R+Q ++++  +  R Y N F   +++ K+EG+  L+ GV  T  RA  +T  QL+ YD  K  L++T +F+D+  THFT++  +  + T  T P DV+KTRLMN K  A   L     D     I   G L  ++G +P ++RLGP  + +    EQLR+  G
Sbjct:    3 EGVLTLWKRGLAASMLREGSYSSIRMGLYDPVRTILVGDAKEVTLTNKILAGFVSGGLGSCLINPADVVKIRIQGEIRVPGQPTR-YKNTFHAFYQIWKDEGIRGLYKGVGATTLRAAILTSAQLSSYDHSKHMLLKTKYFNDDFKTHFTSALISGFVTTTATSPVDVIKTRLMNDKSTAKDALYKNSLDCLVKTIRNEGILALYRGFLPNYLRLGPHFIFSLPLYEQLRIAFG 235          

HSP 2 Score: 68.1662 bits (165), Expect = 3.207e-13
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQ---------TQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYK----KKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSG 611
            G V+  + +   +P D++K+ +Q         T+ K  F     F ++ K++GI  LY G+ A+ LR    +  +   Y+  K    K K  N  F      ++++GF+     +P D++  R+ ND   AK+    Y N+ D + + ++ EG+L L+ G
Sbjct:   54 GFVSGGLGSCLINPADVVKIRIQGEIRVPGQPTRYKNTFHA---FYQIWKDEGIRGLYKGVGATTLRAAILTSAQLSSYDHSKHMLLKTKYFNDDFKTHFTSALISGFVTTTATSPVDVIKTRLMNDKSTAKDAL--YKNSLDCLVKTIRNEGILALYRG 208          
BLAST of slc25a-34 vs. Ensembl Nematostella
Match: EDO39987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H5])

HSP 1 Score: 140.198 bits (352), Expect = 9.202e-39
Identity = 94/288 (32.64%), Postives = 144/288 (50.00%), Query Frame = 3
Query:  168 FGGVASAMAAACTHPLDLLKVHLQ-------TQQK--KEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK---KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKI-AKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAK---------PGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRM 962
            +GG+AS  A  CT P+D  K  LQ       T+QK  +  GM   F ++ K +GI AL+NG+S +LLRQ TY   + GIY + K+   K   +   +      +VAG +G  V NP D++ +RMQ + +  A   + +   AF  M+R   +EG+  L+ GV  T+ RA  +   +L  YD  K+ ++      D+  THF AS  A     + + P DV KTR+MN +         P  Y   + C     +T G    ++G +P F RL P  ++ F+  EQ ++
Sbjct:    8 YGGLASMTAELCTFPIDTTKTRLQLQGQVTDTKQKAIRYRGMFHAFFRITKEEGIRALFNGVSPALLRQATYGSLKLGIYHSLKRILVKDPKDETLFVNGFCGVVAGALGSAVCNPTDVLKIRMQAEYRAGAGSSKTSMLVAFGDMYR---QEGIRGLYRGVGPTSQRAAVIAGVELPVYDSAKRFILDKKLMGDHPGTHFVASAIAGLAGAIASNPIDVAKTRMMNQRNLKVKTEGGPVLYRSASHCLVVTFRTEGFFALYRGFIPNFARLCPWNIVFFMAYEQYKI 292          
BLAST of slc25a-34 vs. Ensembl Nematostella
Match: EDO34326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL4])

HSP 1 Score: 132.494 bits (332), Expect = 8.415e-36
Identity = 84/304 (27.63%), Postives = 142/304 (46.71%), Query Frame = 3
Query:  147 DKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQK-----------KEFGMGGMFL----KVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGA----NLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN------AKPGAYSGLAAC-GADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFP 980
            + V  +  GG++   A   T+P++++K+ +Q   +           +E    G+      +V + +G+  LY G+  +LLRQ  YS TR G YE  K   GA    +   ++K    + +G IG  +  P D+V +R Q  +KI + +   Y N F   +++ K+EG L L++G+  T  RA  ++  Q+  YD  K  L+      + +  H  ++  A  +AT +  P D+++TR M        +P  Y G   C    +   G L  +KG  P + R G  T++ F   E+LR   G  P
Sbjct:    7 EHVARFVLGGLSCMTATTVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYREEGVRGLYRGIFPALLRQAIYSSTRLGAYEPIKNLLGATDSTSAALWKKIVAGVSSGVIGSAIATPTDLVKIRFQA-VKIGETI--PYKNMFHAFYKIAKKEGFLGLWTGMKPTVKRAACISGTQIPTYDHTKHLLLNAELMREGVALHLASALVAGFVATCVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYKGFFPNWTRTGLDTIIIFFVYERLRRYAGLDP 307          
BLAST of slc25a-34 vs. Ensembl Medaka
Match: slc25a10 (solute carrier family 25 member 10 [Source:NCBI gene;Acc:101168182])

HSP 1 Score: 318.546 bits (815), Expect = 1.540e-107
Identity = 166/288 (57.64%), Postives = 206/288 (71.53%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK----KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLG 971
            MS+K +S+      WYFGG+AS  AA CTHPLDLLKVHLQTQQ+ +  M GM ++VVKNDG+LALY+GLSASL RQ++YS+TRF IYE+ +     K    +PFY+K  +    GF GG +G PADMVNVRMQNDMK+  + RRNY +A DG+FRV +EEG+  LFSG SM ++R   +T GQLA YD  KQ ++ TG   DNILTHF +S  A G AT + QP DV+KTRLMN+K G Y+G+  C  +  + GPL F+KGLVPA IRL P TVLTFIFLEQL+   G
Sbjct:    1 MSDKRVSR------WYFGGLASCGAACCTHPLDLLKVHLQTQQEVKKRMMGMAIQVVKNDGVLALYSGLSASLCRQMSYSLTRFAIYESVRDLMGTKSHGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRMQNDMKLPPQHRRNYKHALDGLFRVFREEGIRRLFSGASMASSRGAMVTVGQLACYDQAKQLVLGTGVMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYTGVLHCFKETARLGPLAFYKGLVPAGIRLIPHTVLTFIFLEQLKKYFG 281          
BLAST of slc25a-34 vs. Ensembl Medaka
Match: ucp3 (mitochondrial uncoupling protein 2 [Source:NCBI gene;Acc:101160932])

HSP 1 Score: 155.606 bits (392), Expect = 4.891e-44
Identity = 97/290 (33.45%), Postives = 151/290 (52.07%), Query Frame = 3
Query:  165 YFG-GVASAMAAACTHPLDLLKVHLQTQ---QKKE-------FGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVS------MVAGFIGGIVG----NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNL 968
            +FG G A+ +A   T PLD  KV LQ Q   QK E        G+ G    +V+ +G  +LYNGL A L RQ++++  R G+Y++ K+       FY +   S      ++AG   G +      P D+V VR Q  ++     RR YN+  +    + ++EG+  L+ G     TR   +   +L  YD+ K+ +++    SDN+  HFTA+ GA    T++  P DV+KTR MN+  G YS    C   ++K  GP  F+KG VP+F+RLG   ++ F+  EQ++  +
Sbjct:   17 FFGAGTAACIADLITFPLDTAKVRLQIQGEAQKAEGFTAVKYRGVFGTITTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSMKQ-------FYTRGTESAGIVTRLMAGCTTGAMAVAFAQPTDVVKVRFQAQVRQLDGERR-YNSTINAYKTIARDEGIRGLWRGCMPNITRNAIVNCAELVTYDMIKELIIKYDLMSDNLPCHFTAAFGAGFCTTVVASPVDVVKTRFMNSGSGLYSSAVNCALTMLKNEGPAAFYKGFVPSFLRLGSWNIVMFVTYEQIKRGM 298          
BLAST of slc25a-34 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 154.066 bits (388), Expect = 2.494e-43
Identity = 91/282 (32.27%), Postives = 146/282 (51.77%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQQKKEF-------------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGI----VGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
            G A+ +A   T PLD  KV LQ Q +                G+ G  + +V+ +G L+LY+GL A L RQ++++  R G+Y++ K+   +G++   +      ++AG   G     +  P D+V +R Q   + + E  + Y    D    + KEEGV  L+ G      R+  +   +L  YD  K  L+++   +DN+  HF ++ GA    T++  P DV+KTR MN+ PG Y  +  C A +M K GP  F+KG +P+F+RLG   V+ F+  EQL+
Sbjct:   21 GTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSD---HVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQTR-SNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMNSAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLK 298          
BLAST of slc25a-34 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 154.066 bits (388), Expect = 2.799e-43
Identity = 91/282 (32.27%), Postives = 146/282 (51.77%), Query Frame = 3
Query:  174 GVASAMAAACTHPLDLLKVHLQTQQKKEF-------------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGI----VGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
            G A+ +A   T PLD  KV LQ Q +                G+ G  + +V+ +G L+LY+GL A L RQ++++  R G+Y++ K+   +G++   +      ++AG   G     +  P D+V +R Q   + + E  + Y    D    + KEEGV  L+ G      R+  +   +L  YD  K  L+++   +DN+  HF ++ GA    T++  P DV+KTR MN+ PG Y  +  C A +M K GP  F+KG +P+F+RLG   V+ F+  EQL+
Sbjct:   21 GTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSD---HVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQTR-SNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMNSAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLK 298          
BLAST of slc25a-34 vs. Ensembl Medaka
Match: ucp1 (mitochondrial uncoupling protein 2 [Source:NCBI gene;Acc:101167272])

HSP 1 Score: 152.91 bits (385), Expect = 5.195e-43
Identity = 91/277 (32.85%), Postives = 142/277 (51.26%), Query Frame = 3
Query:  171 GGVASAMAAACTHPLDLLKVHLQTQQKKEF-------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGIVG----NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIM-KTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 959
             G A+ +A   T PLD  KV LQ Q +K+        G+ G    +++ +G  +LYNGL A L RQ+ ++  R G+Y+  K     G + P      + ++AG   G +      P D+V VR Q  M +    RR Y+       ++ + EG+  L+ G     TR   +   +L  YDL K+ +++    SDN+  HF ++ GA  + T++  P DV+KTR MN+ PG Y     C   ++ K GP  F+KG VP+F+RLG   V+ F+  EQ++
Sbjct:   20 AGAAACVADIVTFPLDTAKVRLQIQGEKKAVEGIRYRGVFGTISTMIRTEGPRSLYNGLVAGLQRQVCFASIRIGLYDNVKNFYTGGKDNP---NVLIRILAGCTTGAMAVSFAQPTDVVKVRFQAQMNLNGVARR-YSGTMQAYRQIFQNEGMRGLWKGTLPNITRNALVNCTELVTYDLIKEAILRHQLLSDNLPCHFVSAFGAGFVTTVIASPVDVVKTRYMNSPPGQYRSAINCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVTFEQIK 292          
BLAST of slc25a-34 vs. Planmine SMEST
Match: SMESG000046675.1 (SMESG000046675.1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 291/291 (100.00%), Postives = 291/291 (100.00%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 992
            MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR
Sbjct:    1 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR 291          
BLAST of slc25a-34 vs. Planmine SMEST
Match: SMESG000062675.1 (SMESG000062675.1)

HSP 1 Score: 330.102 bits (845), Expect = 3.315e-112
Identity = 158/281 (56.23%), Postives = 200/281 (71.17%), Query Frame = 3
Query:  144 KDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKK--KGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFP 980
            K +   WYFGG++SA+A + THPLDL+KVHLQTQQKKEFG   M + V+K+DG LALY+G+SAS +RQ+ YS  RFGIYE YK    K   +  YE+ AVS  AG +GG++GNP D++NVRMQND+K+  + RRNYN+ FDG F+V+K EG   L +GVSMTA+RA  MT GQ   YD  K  L++T FF D+ +THFTA+ GAA     +  P DVMKTRLMN  PG Y G+ +C  DI+KTGPL F+KGL+PAFIR+ P  V+  +  EQL  N GYFP
Sbjct:    5 KKRESRWYFGGLSSALAISATHPLDLIKVHLQTQQKKEFGFLRMGMNVIKHDGFLALYSGISASFIRQIFYSFPRFGIYEIYKNNLDKSKKIKLYEQIAVSGFAGLVGGVIGNPFDVLNVRMQNDVKLPLDQRRNYNHVFDGFFKVIKSEGFPGLMNGVSMTASRAVLMTIGQTTVYDRCKFMLLKTVFFVDDPITHFTAAIGAALSTIFLANPLDVMKTRLMNVPPGKYDGIVSCFKDIVKTGPLAFYKGLLPAFIRICPHFVILHLIREQLTTNFGYFP 285          
BLAST of slc25a-34 vs. Planmine SMEST
Match: SMESG000020904.1 (SMESG000020904.1)

HSP 1 Score: 302.368 bits (773), Expect = 2.495e-101
Identity = 153/267 (57.30%), Postives = 188/267 (70.41%), Query Frame = 3
Query:  162 WYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKK--KKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            WY+GGV+S +A   THPLDL KVHLQT + +  G+  +F+ V+KNDG+L LYNGLSAS+LRQ+TYS  RFG+++ YK    K   +   E    +   G IGGI GNPAD +NVRMQNDMK+ +  RRNY +AF G+F+V K EG   LFSGV+MT  RA  MT GQ A YD  K  L+ T  F DN  TH  ++ GAAGIAT +TQPFDVMKTRLMNA+ G Y+GL  C  DI+  GPLGFFKG+VPAF+R+GP T+L FI  EQL
Sbjct:   15 WYYGGVSSTLAIGATHPLDLAKVHLQTSKTQSKGLISVFVNVIKNDGVLGLYNGLSASILRQITYSFPRFGLHDWYKNTVSKKRKVSVVENVMAAGFGGAIGGITGNPADTINVRMQNDMKLPEASRRNYKSAFHGLFQVFKNEGFKGLFSGVTMTTNRAILMTIGQGAGYDQMKLILLSTNLFDDNPATHILSAFGAAGIATFLTQPFDVMKTRLMNAQVGQYTGLGHCAKDILLNGPLGFFKGIVPAFVRIGPHTILLFIIKEQL 281          
BLAST of slc25a-34 vs. Planmine SMEST
Match: SMESG000020909.1 (SMESG000020909.1)

HSP 1 Score: 206.068 bits (523), Expect = 3.144e-65
Identity = 99/161 (61.49%), Postives = 117/161 (72.67%), Query Frame = 3
Query:  474 NPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 956
            NPAD +NVRMQNDMK+ +  RRNY +AF G+F+V K EG   LFSGV+MT  RA  MT GQ A YD  K  L+ T  F DN  TH  ++ GAAGIAT +TQPFDVMKTRLMNA+ G Y+GL  C  DI+  GPLGFFKG+VPAF+R+GP T+L FI  EQL
Sbjct:   15 NPADTINVRMQNDMKLPEASRRNYKSAFHGLFQVFKNEGFKGLFSGVTMTTNRAILMTIGQGAGYDQMKLILLSTNLFDDNPATHILSAFGAAGIATFLTQPFDVMKTRLMNAQVGQYTGLGHCAKDILLNGPLGFFKGIVPAFVRIGPHTILLFIIKEQL 175          
BLAST of slc25a-34 vs. Planmine SMEST
Match: SMESG000019229.1 (SMESG000019229.1)

HSP 1 Score: 195.282 bits (495), Expect = 3.314e-59
Identity = 118/298 (39.60%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  120 MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQ----QKKEFGMGGMFLK-VVKNDGILALYNGLSASLLRQLTYSMTRFGIYET-YKKKKGANLP--FYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAK----PGAYSGLAACGADIMK-TGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGY 974
            MS++N+S  + V +  FGG A  +A     PLDL+K  +Q       KK +      +K + +N+G+ A+Y+GLSA LLRQ TY+ TR G+Y   ++K    + P  F  KA + M AG IG  VG P ++  +RM +D ++  + RRNY N F  + R+V+EEGVL L+ G   T  RA  +   QLA Y   KQ +++T  F+D I  HF AS  +  I T+ + P D++KTR+ N         YSG       I K  G L  +KG  P F+RLGP TV+TF+ LEQ  MN  Y
Sbjct:    1 MSSQNISIPNYVKF-AFGGSAGMIATLFVQPLDLVKNRMQMSGQDGSKKAYKSSFDAIKQITRNEGLFAIYSGLSAGLLRQATYTTTRLGVYTALFEKFSSKDKPPSFVTKAGIGMSAGLIGSFVGTPTEVALIRMTSDGRLPMDQRRNYRNVFHALARIVREEGVLALWRGCLPTMGRAAVVNLAQLASYSQAKQMILETELFNDGIFVHFGASMISGFITTVASMPVDIVKTRIQNMTVVNGVAEYSGAINAFIRITKHEGVLSLWKGFTPYFLRLGPHTVITFVVLEQ--MNTAY 295          
The following BLAST results are available for this feature:
BLAST of slc25a-34 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A101.119e-11658.66solute carrier family 25 member 10 [Source:HGNC Sy... [more]
SLC25A105.357e-11457.19solute carrier family 25 member 10 [Source:HGNC Sy... [more]
AC139530.21.761e-9457.66novel protein[more]
SLC25A101.968e-6858.10solute carrier family 25 member 10 [Source:HGNC Sy... [more]
SLC25A116.643e-5640.28solute carrier family 25 member 11 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-25A109.132e-11859.36Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
slc-25A109.132e-11859.36Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
misc-11.336e-5740.99Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
misc-11.336e-5740.99Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
ucp-42.337e-3027.92UnCoupling Protein (Mitochondrial substrate carrie... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dic11.104e-10454.84gene:FBgn0027610 transcript:FBtr0082747[more]
Dic11.104e-10454.84gene:FBgn0027610 transcript:FBtr0346113[more]
Dic11.104e-10454.84gene:FBgn0027610 transcript:FBtr0082748[more]
Dic23.663e-8749.29gene:FBgn0038797 transcript:FBtr0334587[more]
Dic23.663e-8749.29gene:FBgn0038797 transcript:FBtr0083891[more]
back to top
BLAST of slc25a-34 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-100f3.24.448e-11058.93si:ch1073-100f3.2 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
slc25a107.322e-10656.60solute carrier family 25 member 10 [Source:ZFIN;Ac... [more]
slc25a112.331e-5739.29solute carrier family 25 member 11 [Source:ZFIN;Ac... [more]
ucp13.318e-4534.29uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
ucp13.318e-4534.29uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo48.497e-11360.36F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443... [more]
fbxo41.154e-10257.14F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443... [more]
fbxo43.888e-10056.34F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443... [more]
fbxo49.324e-10056.79F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443... [more]
fbxo49.991e-10055.56F-box protein 4 [Source:Xenbase;Acc:XB-GENE-971443... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a104.272e-11157.55solute carrier family 25 (mitochondrial carrier, d... [more]
Slc25a116.753e-5539.22solute carrier family 25 (mitochondrial carrier ox... [more]
Ucp33.312e-4533.93uncoupling protein 3 (mitochondrial, proton carrie... [more]
Ucp33.312e-4533.93uncoupling protein 3 (mitochondrial, proton carrie... [more]
Ucp23.095e-4332.14uncoupling protein 2 (mitochondrial, proton carrie... [more]
back to top
BLAST of slc25a-34 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBX3|DIC_HUMAN5.376e-11658.66Mitochondrial dicarboxylate carrier OS=Homo sapien... [more]
sp|Q9QZD8|DIC_MOUSE2.988e-11057.55Mitochondrial dicarboxylate carrier OS=Mus musculu... [more]
sp|Q54PY7|M2OM_DICDI2.439e-7143.75Probable mitochondrial 2-oxoglutarate/malate carri... [more]
sp|Q9SB52|PUMP4_ARATH9.449e-6239.13Mitochondrial uncoupling protein 4 OS=Arabidopsis ... [more]
sp|Q06143|DIC1_YEAST2.146e-6038.59Mitochondrial dicarboxylate transporter OS=Sacchar... [more]
back to top
BLAST of slc25a-34 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFG40.000e+0100.00Slc25a-34 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A3P7LS673.562e-15675.78Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A0X3PD454.409e-15575.43Mitochondrial dicarboxylate carrier OS=Schistoceph... [more]
A0A0R3U2L22.643e-15476.34Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3SZT61.247e-15374.14Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-100f3.21.377e-10657.14solute carrier family 25 member 10 [Source:NCBI ge... [more]
si:ch1073-100f3.26.098e-9856.43solute carrier family 25 member 10 [Source:NCBI ge... [more]
slc25a103.942e-8453.49solute carrier family 25 member 10 [Source:ZFIN;Ac... [more]
slc25a111.822e-5839.71solute carrier family 25 member 11 [Source:NCBI ge... [more]
slc25a116.391e-5142.99solute carrier family 25 member 11 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ucp22.730e-4131.49uncoupling protein 2 [Source:NCBI gene;Acc:555812][more]
ENSPMAT00000007951.12.080e-1840.70pep scaffold:Pmarinus_7.0:GL477057:42731:45697:1 g... [more]
slc25a23a3.292e-1624.51solute carrier family 25 member 23a [Source:ZFIN;A... [more]
slc25a1b1.033e-1523.83slc25a1 solute carrier family 25 member 1b [Source... [more]
ENSPMAT00000004577.11.245e-1423.65pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DIC13.091e-6238.59Mitochondrial dicarboxylate carrier; integral memb... [more]
OAC13.826e-3028.71Mitochondrial inner membrane transporter; transpor... [more]
SFC11.007e-2529.43Mitochondrial succinate-fumarate transporter; tran... [more]
YEA62.858e-1524.32Putative mitochondrial NAD+ transporter; member of... [more]
MME19.795e-1524.92Transporter of the mitochondrial inner membrane th... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO369802.925e-11857.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478731.856e-5939.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255091.625e-4234.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO399879.202e-3932.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343268.415e-3627.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-34 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a101.540e-10757.64solute carrier family 25 member 10 [Source:NCBI ge... [more]
ucp34.891e-4433.45mitochondrial uncoupling protein 2 [Source:NCBI ge... [more]
ucp22.494e-4332.27uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ucp22.799e-4332.27uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ucp15.195e-4332.85mitochondrial uncoupling protein 2 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-34 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046675.10.000e+0100.00SMESG000046675.1[more]
SMESG000062675.13.315e-11256.23SMESG000062675.1[more]
SMESG000020904.12.495e-10157.30SMESG000020904.1[more]
SMESG000020909.13.144e-6561.49SMESG000020909.1[more]
SMESG000019229.13.314e-5939.60SMESG000019229.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010330
GenBankAKN21602.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010330 ID=SMED30010330|Name=slc25a-34|organism=Schmidtea mediterranea sexual|type=transcript|length=1172bp
ATTTGTTTTAAATATTATATAAATTAATATTAGTGCGTGACTACGTTTAT
TATATTTAATATTTGTTTGTTAAAACAGCATAATTAAGAGTTATATTTTA
AATTTTCATATTTTTAAACATGTCCAATAAAAATTTGTCAAAGAAAGATA
AGGTTGGGTACTGGTATTTTGGTGGAGTAGCAAGTGCCATGGCTGCTGCT
TGTACACATCCTCTTGATTTATTGAAAGTACACTTACAAACTCAGCAGAA
AAAAGAATTTGGAATGGGTGGAATGTTTTTAAAAGTCGTCAAAAATGATG
GAATTCTTGCTCTTTACAACGGTCTTAGTGCATCATTATTAAGACAATTA
ACATATTCAATGACACGATTTGGTATCTATGAAACTTATAAAAAGAAAAA
GGGTGCGAATTTACCTTTCTATGAAAAGGCAGCTGTGTCTATGGTAGCTG
GATTTATTGGTGGAATTGTTGGTAATCCTGCTGATATGGTTAATGTTAGG
ATGCAAAACGACATGAAAATTGCAAAGGAACTCAGGAGAAATTATAATAA
TGCATTTGATGGGATGTTTCGAGTAGTAAAAGAAGAAGGCGTACTTGTCT
TGTTTAGCGGAGTATCTATGACAGCCACTCGAGCTTGTTTTATGACTTTC
GGACAGCTAGCATTTTACGATCTATTCAAGCAAACATTAATGCAAACGGG
TTTCTTTTCCGATAATATTCTCACGCATTTTACAGCTAGTACTGGAGCGG
CTGGAATTGCAACTTTGATGACGCAACCTTTTGATGTTATGAAAACACGA
TTAATGAACGCCAAGCCTGGCGCTTATTCGGGACTGGCCGCGTGTGGGGC
GGATATTATGAAAACAGGGCCGTTAGGGTTTTTTAAAGGATTGGTTCCAG
CTTTTATTCGACTTGGTCCACAAACTGTATTGACATTCATATTTTTGGAG
CAACTGCGAATGAATTTGGGCTACTTTCCAGAGCAATCGAGATAATACAT
TATTTATTATAGTTTTAGTTATATTTCAAATTGATATCTGCAATTTGATA
TTTCGATAGTGTTATTAAATGCTTTTTCGATGTTTAATCAATCCACTTTG
AACAATATCAATAAAATAGACTTCTTTATTGAGTTTGATGAATAAATATA
TTGATAATTAATTGAAAAAAAA
back to top

protein sequence of SMED30010330-orf-1

>SMED30010330-orf-1 ID=SMED30010330-orf-1|Name=SMED30010330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MSNKNLSKKDKVGYWYFGGVASAMAAACTHPLDLLKVHLQTQQKKEFGMG
GMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANLPF
YEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMF
RVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNI
LTHFTASTGAAGIATLMTQPFDVMKTRLMNAKPGAYSGLAACGADIMKTG
PLGFFKGLVPAFIRLGPQTVLTFIFLEQLRMNLGYFPEQSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
GO:0015116sulfate transmembrane transporter activity
GO:0015117thiosulfate transmembrane transporter activity
GO:0015131oxaloacetate transmembrane transporter activity
GO:0015140malate transmembrane transporter activity
GO:0015141succinate transmembrane transporter activity
GO:0015297antiporter activity
GO:1901677phosphate transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006839mitochondrial transport
GO:0008272sulfate transport
GO:0015709thiosulfate transport
GO:0015729oxaloacetate transport
GO:0035435phosphate ion transmembrane transport
GO:0071422succinate transmembrane transport
GO:0071423malate transmembrane transport
GO:1902356oxaloacetate(2-) transmembrane transport
GO:1902358sulfate transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR023395Mt_carrier_dom_sf
IPR018108Mitochondrial_sb/sol_carrier
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 125..145
NoneNo IPR availablePANTHERPTHR45618:SF13MITOCHONDRIAL DICARBOXYLATE CARRIER-RELATEDcoord: 6..286
NoneNo IPR availablePANTHERPTHR45618FAMILY NOT NAMEDcoord: 6..286
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..28
score: 5.0
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 200..217
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 14..27
score: 29.04
coord: 27..41
score: 27.54
coord: 207..229
score: 25.73
coord: 68..88
score: 21.23
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 15..289
e-value: 3.2E-78
score: 264.4
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 10..279
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 98..192
e-value: 1.1E-15
score: 57.3
coord: 15..93
e-value: 1.5E-18
score: 66.5
coord: 199..281
e-value: 4.1E-14
score: 52.3
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 198..282
score: 19.917
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 13..93
score: 21.526
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 98..189
score: 20.454