F-box/WD repeat-containing protein 1A

Overview
NameF-box/WD repeat-containing protein 1A
Smed IDSMED30010327
Length (bp)2795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box/WD repeat-containing protein 1A (SMED30010327) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box/WD repeat-containing protein 1A (SMED30010327) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box/WD repeat-containing protein 1A (SMED30010327) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box/WD repeat-containing protein 1A (SMED30010327) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010327

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30010327SMESG000052999.1 dd_Smed_v4_3757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 316/521 (60.65%), Postives = 379/521 (72.74%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  100 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGNAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 558          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 313/521 (60.08%), Postives = 378/521 (72.55%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:   90 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGNAPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 548          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 313/521 (60.08%), Postives = 378/521 (72.55%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  126 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGNAPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 584          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Match: FBXW11 (F-box and WD repeat domain containing 11 [Source:HGNC Symbol;Acc:HGNC:13607])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 299/537 (55.68%), Postives = 373/537 (69.46%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     ++Y+ +N    G       +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:   68 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERRGWDQYLFKNRPTDGPP---NSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 533          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Match: FBXW11 (F-box and WD repeat domain containing 11 [Source:HGNC Symbol;Acc:HGNC:13607])

HSP 1 Score: 514.227 bits (1323), Expect = 3.425e-173
Identity = 242/334 (72.46%), Postives = 288/334 (86.23%), Query Frame = 1
Query:  712 YYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:  170 FYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 499          

HSP 2 Score: 147.517 bits (371), Expect = 9.637e-37
Identity = 67/120 (55.83%), Postives = 88/120 (73.33%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGW 471
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V   W++VI EG LWKKLIE MV TDPLW+GL ER GW
Sbjct:   34 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGW 153          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 285/537 (53.07%), Postives = 361/537 (67.23%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S  + +  + +    LK+++ +Q++ +  ++  +SHYQ G++D +++PMLQRDFI++LPA     + E IL  +++ SL +  +VS SWR  +  G  WKKLIE  V +D LW GL E+  W   L I  R +  +  C +                                  +    ++  + +++  ++  +       Y +LYP II +I  I  NW  G Y + +I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD +   C R+L+GH GSVLCLQYDN VIISGSSD+TVRVW + +  C+ T+ HHCEAVLHLRFA+ I+VTCSKDRSIAVWDM +P DI +RRVLVGHRAAVNVVDFD + IVSASGDRTIKVW+  + EF+ T+ GHRRGIACLQYR  LVVSGSSDNTIRLW I +G CLR LEGHEELVRCIRFD K IVSGAYDGKIKVWDL AAL+P++ ++ +CL +L QHTGRVFRLQFD+FQIVSSSHDDTILIWDFLD       S  N    P
Sbjct:   29 LSIDYLQGHEGLIEEVLKWSEHEQLDFMDKIVHRLSHYQLGKVDNFIRPMLQRDFISNLPA----HLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNI-SRDMSVRRICEK----------------------------------FNYDVNIKRDKLDQLILMHVF-------YSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDAPPSGLPSSTNRATLP 519          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 285/537 (53.07%), Postives = 361/537 (67.23%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S  + +  + +    LK+++ +Q++ +  ++  +SHYQ G++D +++PMLQRDFI++LPA     + E IL  +++ SL +  +VS SWR  +  G  WKKLIE  V +D LW GL E+  W   L I  R +  +  C +                                  +    ++  + +++  ++  +       Y +LYP II +I  I  NW  G Y + +I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD +   C R+L+GH GSVLCLQYDN VIISGSSD+TVRVW + +  C+ T+ HHCEAVLHLRFA+ I+VTCSKDRSIAVWDM +P DI +RRVLVGHRAAVNVVDFD + IVSASGDRTIKVW+  + EF+ T+ GHRRGIACLQYR  LVVSGSSDNTIRLW I +G CLR LEGHEELVRCIRFD K IVSGAYDGKIKVWDL AAL+P++ ++ +CL +L QHTGRVFRLQFD+FQIVSSSHDDTILIWDFLD       S  N    P
Sbjct:   29 LSIDYLQGHEGLIEEVLKWSEHEQLDFMDKIVHRLSHYQLGKVDNFIRPMLQRDFISNLPA----HLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNI-SRDMSVRRICEK----------------------------------FNYDVNIKRDKLDQLILMHVF-------YSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDAPPSGLPSSTNRATLP 519          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 285/537 (53.07%), Postives = 361/537 (67.23%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S  + +  + +    LK+++ +Q++ +  ++  +SHYQ G++D +++PMLQRDFI++LPA     + E IL  +++ SL +  +VS SWR  +  G  WKKLIE  V +D LW GL E+  W   L I  R +  +  C +                                  +    ++  + +++  ++  +       Y +LYP II +I  I  NW  G Y + +I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD +   C R+L+GH GSVLCLQYDN VIISGSSD+TVRVW + +  C+ T+ HHCEAVLHLRFA+ I+VTCSKDRSIAVWDM +P DI +RRVLVGHRAAVNVVDFD + IVSASGDRTIKVW+  + EF+ T+ GHRRGIACLQYR  LVVSGSSDNTIRLW I +G CLR LEGHEELVRCIRFD K IVSGAYDGKIKVWDL AAL+P++ ++ +CL +L QHTGRVFRLQFD+FQIVSSSHDDTILIWDFLD       S  N    P
Sbjct:   29 LSIDYLQGHEGLIEEVLKWSEHEQLDFMDKIVHRLSHYQLGKVDNFIRPMLQRDFISNLPA----HLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNI-SRDMSVRRICEK----------------------------------FNYDVNIKRDKLDQLILMHVF-------YSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDAPPSGLPSSTNRATLP 519          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 285/537 (53.07%), Postives = 361/537 (67.23%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S  + +  + +    LK+++ +Q++ +  ++  +SHYQ G++D +++PMLQRDFI++LPA     + E IL  +++ SL +  +VS SWR  +  G  WKKLIE  V +D LW GL E+  W   L I  R +  +  C +                                  +    ++  + +++  ++  +       Y +LYP II +I  I  NW  G Y + +I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD +   C R+L+GH GSVLCLQYDN VIISGSSD+TVRVW + +  C+ T+ HHCEAVLHLRFA+ I+VTCSKDRSIAVWDM +P DI +RRVLVGHRAAVNVVDFD + IVSASGDRTIKVW+  + EF+ T+ GHRRGIACLQYR  LVVSGSSDNTIRLW I +G CLR LEGHEELVRCIRFD K IVSGAYDGKIKVWDL AAL+P++ ++ +CL +L QHTGRVFRLQFD+FQIVSSSHDDTILIWDFLD       S  N    P
Sbjct:   29 LSIDYLQGHEGLIEEVLKWSEHEQLDFMDKIVHRLSHYQLGKVDNFIRPMLQRDFISNLPA----HLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNI-SRDMSVRRICEK----------------------------------FNYDVNIKRDKLDQLILMHVF-------YSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDAPPSGLPSSTNRATLP 519          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 281/507 (55.42%), Postives = 346/507 (68.24%), Query Frame = 1
Query:  193 LLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            ++  +SHYQ G++D +++PMLQRDFI++LPA     + E IL  +++ SL +  +VS SWR  +  G  WKKLIE  V +D LW GL E+  W   L I  R +  +  C +                                  +    ++  + +++  ++  +       Y +LYP II +I  I  NW  G Y + +I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD +   C R+L+GH GSVLCLQYDN VIISGSSD+TVRVW + +  C+ T+ HHCEAVLHLRFA+ I+VTCSKDRSIAVWDM +P DI +RRVLVGHRAAVNVVDFD + IVSASGDRTIKVW+  + EF+ T+ GHRRGIACLQYR  LVVSGSSDNTIRLW I +G CLR LEGHEELVRCIRFD K IVSGAYDGKIKVWDL AAL+P++ ++ +CL +L QHTGRVFRLQFD+FQIVSSSHDDTILIWDFLD       S  N    P
Sbjct:    4 IVHRLSHYQLGKVDNFIRPMLQRDFISNLPA----HLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNI-SRDMSVRRICEK----------------------------------FNYDVNIKRDKLDQLILMHVF-------YSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDAPPSGLPSSTNRATLP 464          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0084032)

HSP 1 Score: 509.99 bits (1312), Expect = 7.879e-172
Identity = 238/318 (74.84%), Postives = 279/318 (87.74%), Query Frame = 1
Query:  712 YYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
            ++R L+P I+ +I  I+ NW +G++ L++I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD   L+CV+ L GH GSVLCLQYD+ VIISGSSDSTVRVW +++   VNT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +PS+I LRRVLVGHRAAVNVVDFD+K IVSASGDRTIKVW+T SCEF+ T+NGH+RGIACLQYR+ LVVSGSSDN+IRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++ +N+LCL TL +HTGRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  174 FHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLN 491          

HSP 2 Score: 139.043 bits (349), Expect = 3.202e-34
Identity = 68/129 (52.71%), Postives = 89/129 (68.99%), Query Frame = 1
Query:  106 SESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIP 492
            S +++ +++     F ++++  Q++ V+ LL  M HYQHGQI+AYLKPMLQRDFIT LP KGL  ++E ILSYLDA+SL ++  V   W +VI EG LWKKLIE  V TD LWRGL ER  W+  L  P
Sbjct:   35 SPTYQTERELCFQYFTQWSESGQVDFVEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKP 163          

HSP 3 Score: 58.5362 bits (140), Expect = 1.872e-8
Identity = 34/91 (37.36%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  790 LKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWD---------ARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWT 1035
            L+ +E H E    V C+++D K+IVSG  D  IKVWD         A    C+  L  H G V  LQ+D   I+S S D T+ +W   ++T
Sbjct:  406 LRVLEGHEEL---VRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLNFT 493          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0333931)

HSP 1 Score: 509.99 bits (1312), Expect = 7.879e-172
Identity = 238/318 (74.84%), Postives = 279/318 (87.74%), Query Frame = 1
Query:  712 YYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
            ++R L+P I+ +I  I+ NW +G++ L++I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD   L+CV+ L GH GSVLCLQYD+ VIISGSSDSTVRVW +++   VNT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +PS+I LRRVLVGHRAAVNVVDFD+K IVSASGDRTIKVW+T SCEF+ T+NGH+RGIACLQYR+ LVVSGSSDN+IRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++ +N+LCL TL +HTGRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  174 FHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLN 491          

HSP 2 Score: 139.043 bits (349), Expect = 3.202e-34
Identity = 68/129 (52.71%), Postives = 89/129 (68.99%), Query Frame = 1
Query:  106 SESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIP 492
            S +++ +++     F ++++  Q++ V+ LL  M HYQHGQI+AYLKPMLQRDFIT LP KGL  ++E ILSYLDA+SL ++  V   W +VI EG LWKKLIE  V TD LWRGL ER  W+  L  P
Sbjct:   35 SPTYQTERELCFQYFTQWSESGQVDFVEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKP 163          

HSP 3 Score: 58.5362 bits (140), Expect = 1.872e-8
Identity = 34/91 (37.36%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  790 LKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWD---------ARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWT 1035
            L+ +E H E    V C+++D K+IVSG  D  IKVWD         A    C+  L  H G V  LQ+D   I+S S D T+ +W   ++T
Sbjct:  406 LRVLEGHEEL---VRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLNFT 493          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0330049)

HSP 1 Score: 510.375 bits (1313), Expect = 9.962e-171
Identity = 238/318 (74.84%), Postives = 279/318 (87.74%), Query Frame = 1
Query:  712 YYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
            ++R L+P I+ +I  I+ NW +G++ L++I C SE+SKGVYCLQYDD KIVSGLRDN+IK+WD   L+CV+ L GH GSVLCLQYD+ VIISGSSDSTVRVW +++   VNT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +PS+I LRRVLVGHRAAVNVVDFD+K IVSASGDRTIKVW+T SCEF+ T+NGH+RGIACLQYR+ LVVSGSSDN+IRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++ +N+LCL TL +HTGRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  174 FHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLN 491          

HSP 2 Score: 138.658 bits (348), Expect = 9.158e-34
Identity = 68/129 (52.71%), Postives = 89/129 (68.99%), Query Frame = 1
Query:  106 SESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIP 492
            S +++ +++     F ++++  Q++ V+ LL  M HYQHGQI+AYLKPMLQRDFIT LP KGL  ++E ILSYLDA+SL ++  V   W +VI EG LWKKLIE  V TD LWRGL ER  W+  L  P
Sbjct:   35 SPTYQTERELCFQYFTQWSESGQVDFVEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKP 163          

HSP 3 Score: 58.9214 bits (141), Expect = 1.583e-8
Identity = 34/91 (37.36%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  790 LKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWD---------ARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWT 1035
            L+ +E H E    V C+++D K+IVSG  D  IKVWD         A    C+  L  H G V  LQ+D   I+S S D T+ +W   ++T
Sbjct:  406 LRVLEGHEEL---VRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLNFT 493          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 209.534 bits (532), Expect = 3.172e-55
Identity = 125/320 (39.06%), Postives = 175/320 (54.69%), Query Frame = 1
Query:  757 IQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG-----VVSQDSG 1692
            I+ NW S      K+         + CLQ+   +IVSG  DN++KVW A   +C+R L GH G V   Q   N+IISGS+D T++VW + S  CV+T+  H   V  +    S +V+ S+D ++ VWD+   S +    VLVGH AAV  V +D K IVS + D  +K+W+ +  E LHT+ GH   +  LQ+    VVSGS D +IR+W +ETG C  TL GH+ L   +      +VSG  D  +KVWD+             CLQTL   N+H   V  LQF+   +V+SS D T+ +WD + TG     +V+ DSG
Sbjct:  975 IEMNWRSRPVRKPKV-LKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLH---VLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTG---------QCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWD-VKTGDFIRNLVALDSG 1280          

HSP 2 Score: 154.066 bits (388), Expect = 1.206e-37
Identity = 91/240 (37.92%), Postives = 128/240 (53.33%), Query Frame = 1
Query: 1054 HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVV--------SQDSGMNMVRSPVVSLDNDDEPIK 1749
            H    +  L+F+ + +V+ S D ++ VW      + +  R LVGH   V         I+S S DRT+KVW+  S   +HT+ GH   + C+    + VVSGS D T+R+W IE G+CL  L GH   VRC+++D K IVSGAYD  +K+W          P    CL TL  HT RV+ LQFD   +VS S D +I +WD ++TG          S  SGM + ++ +VS  N D  +K
Sbjct:  993 HDDHVITCLQFSGNRIVSGSDDNTLKVWSAV---NGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWH---------PERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWD-VETGNCKHTLMGHQSLTSGMELRQNILVS-GNADSTVK 1218          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073245)

HSP 1 Score: 209.534 bits (532), Expect = 3.172e-55
Identity = 125/320 (39.06%), Postives = 175/320 (54.69%), Query Frame = 1
Query:  757 IQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG-----VVSQDSG 1692
            I+ NW S      K+         + CLQ+   +IVSG  DN++KVW A   +C+R L GH G V   Q   N+IISGS+D T++VW + S  CV+T+  H   V  +    S +V+ S+D ++ VWD+   S +    VLVGH AAV  V +D K IVS + D  +K+W+ +  E LHT+ GH   +  LQ+    VVSGS D +IR+W +ETG C  TL GH+ L   +      +VSG  D  +KVWD+             CLQTL   N+H   V  LQF+   +V+SS D T+ +WD + TG     +V+ DSG
Sbjct:  975 IEMNWRSRPVRKPKV-LKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLH---VLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTG---------QCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWD-VKTGDFIRNLVALDSG 1280          

HSP 2 Score: 154.066 bits (388), Expect = 1.206e-37
Identity = 91/240 (37.92%), Postives = 128/240 (53.33%), Query Frame = 1
Query: 1054 HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVV--------SQDSGMNMVRSPVVSLDNDDEPIK 1749
            H    +  L+F+ + +V+ S D ++ VW      + +  R LVGH   V         I+S S DRT+KVW+  S   +HT+ GH   + C+    + VVSGS D T+R+W IE G+CL  L GH   VRC+++D K IVSGAYD  +K+W          P    CL TL  HT RV+ LQFD   +VS S D +I +WD ++TG          S  SGM + ++ +VS  N D  +K
Sbjct:  993 HDDHVITCLQFSGNRIVSGSDDNTLKVWSAV---NGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWH---------PERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWD-VETGNCKHTLMGHQSLTSGMELRQNILVS-GNADSTVK 1218          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 376/537 (70.02%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   53 NYEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEG----RSP 518          

HSP 2 Score: 88.9669 bits (219), Expect = 8.872e-18
Identity = 55/172 (31.98%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VWD+          +   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  226 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDV---------NSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 387          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 376/537 (70.02%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   57 NYEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEG----RSP 522          

HSP 2 Score: 88.5817 bits (218), Expect = 9.850e-18
Identity = 55/172 (31.98%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VWD+          +   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  230 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDV---------NSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 391          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 376/537 (70.02%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   53 NYEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEG----RSP 518          

HSP 2 Score: 88.9669 bits (219), Expect = 8.872e-18
Identity = 55/172 (31.98%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VWD+          +   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  226 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDV---------NSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 387          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 376/537 (70.02%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   50 NYEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEG----RSP 515          

HSP 2 Score: 88.5817 bits (218), Expect = 9.993e-18
Identity = 55/172 (31.98%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VWD+          +   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  223 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDV---------NSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 384          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 376/537 (70.02%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   60 NYEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEG----RSP 525          

HSP 2 Score: 88.5817 bits (218), Expect = 9.627e-18
Identity = 55/172 (31.98%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VWD+          +   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  233 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDV---------NSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 394          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 313/537 (58.29%), Postives = 380/537 (70.76%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:   80 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAES----TRSP 550          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 313/537 (58.29%), Postives = 380/537 (70.76%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:   88 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAES----TRSP 558          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 313/537 (58.29%), Postives = 380/537 (70.76%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  116 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAES----TRSP 586          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 313/537 (58.29%), Postives = 380/537 (70.76%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  121 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAES----TRSP 591          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 313/537 (58.29%), Postives = 380/537 (70.76%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:   85 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAES----TRSP 555          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 317/521 (60.84%), Postives = 380/521 (72.94%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                            P+E    NS           +YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL+AAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  126 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------------PDENAPPNS-----------FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 584          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 317/521 (60.84%), Postives = 380/521 (72.94%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                            P+E    NS           +YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL+AAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:   90 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------------PDENAPPNS-----------FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 548          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 317/521 (60.84%), Postives = 380/521 (72.94%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                            P+E    NS           +YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL+AAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:   27 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------------PDENAPPNS-----------FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 485          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Match: Fbxw11 (F-box and WD-40 domain protein 11 [Source:MGI Symbol;Acc:MGI:2144023])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 299/537 (55.68%), Postives = 372/537 (69.27%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     ++Y+ +N    G       +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:   89 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERRGWDQYLFKNRPTDGPP---NSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKSSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 554          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Match: Fbxw11 (F-box and WD-40 domain protein 11 [Source:MGI Symbol;Acc:MGI:2144023])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 299/537 (55.68%), Postives = 372/537 (69.27%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     ++Y+ +N    G       +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:   68 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERRGWDQYLFKNRPTDGPP---NSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKSSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 533          
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q3ULA2|FBW1A_MOUSE (F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 317/521 (60.84%), Postives = 380/521 (72.94%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                            P+E    NS           +YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL+AAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  126 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------------PDENAPPNS-----------FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 584          
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q9Y297|FBW1A_HUMAN (F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 313/521 (60.08%), Postives = 378/521 (72.55%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:  126 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGNAPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 584          
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q91854|TRCB_XENLA (Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 310/521 (59.50%), Postives = 375/521 (71.98%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             S +++K+++     F ++++  Q+  V+ L+  M HYQHG I+ YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLC+A  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +G + P  +         Y  + P+        II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC RVL GH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+
Sbjct:   55 LSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGW-------GQYLFKNKP--------------------------------------PDGKTPPNSF---------YRALYPK--------IIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 513          
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q9UKB1|FBW1B_HUMAN (F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 299/537 (55.68%), Postives = 373/537 (69.46%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     ++Y+ +N    G       +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:   68 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERRGWDQYLFKNRPTDGPP---NSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 533          
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q5SRY7|FBW1B_MOUSE (F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 299/537 (55.68%), Postives = 372/537 (69.27%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LP +GL  ++E ILSYLDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     ++Y+ +N    G       +YR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD  +LEC++VLTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRF++ ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+       S  N  RSP
Sbjct:   68 NYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERRGWDQYLFKNRPTDGPP---NSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKSSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNV----PPSAQNETRSP 533          
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Match: A0A1D5PQA9 (Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Gallus gallus OX=9031 GN=BTRC PE=4 SV=2)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 321/537 (59.78%), Postives = 385/537 (71.69%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +GT+ P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  255 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGW-------GQYLFKNKP--------------------------------------PDGTAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAES----TRSP 725          
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Match: A0A1D5PSH9 (Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Gallus gallus OX=9031 GN=BTRC PE=4 SV=2)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 321/537 (59.78%), Postives = 385/537 (71.69%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +GT+ P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  229 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGW-------GQYLFKNKP--------------------------------------PDGTAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAES----TRSP 699          
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Match: A0A1D5NTM3 (Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Gallus gallus OX=9031 GN=BTRC PE=4 SV=2)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 321/537 (59.78%), Postives = 385/537 (71.69%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +GT+ P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  278 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGW-------GQYLFKNKP--------------------------------------PDGTAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAES----TRSP 748          
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Match: F1NYG1 (Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Gallus gallus OX=9031 GN=BTRC PE=4 SV=3)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 321/537 (59.78%), Postives = 385/537 (71.69%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +GT+ P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  265 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGW-------GQYLFKNKP--------------------------------------PDGTAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAES----TRSP 735          
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Match: A0A3Q2TWQ2 (Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Gallus gallus OX=9031 GN=BTRC PE=4 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 321/537 (59.78%), Postives = 385/537 (71.69%), Query Frame = 1
Query:  103 FSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
             S S++K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDAKSLCAA  V   W +V  +G LWKKLIE MV TD LWRGL ER GW       G+++    P                                       +GT+ P  +                 YR LYP II +I+ I+ NW  G+++L++I C SE+SKGVYCLQYDD+KIVSGLRDN+IK+WD  TLEC R+LTGH GSVLCLQYD  VII+GSSDSTVRVW +++   +NT+ HHCEAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      +S     RSP
Sbjct:  291 LSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGW-------GQYLFKNKP--------------------------------------PDGTAPPNSF-----------------YRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAES----TRSP 761          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Match: fbxw11a (F-box/WD repeat-containing protein 11 [Source:NCBI gene;Acc:103028966])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 304/537 (56.61%), Postives = 375/537 (69.83%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            SF+K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V        RE   W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YY  LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD  +LEC+++LTGH GSVLCLQYD+ VI++GSSDSTVRVW  SS   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   86 SFEKEKEMCIQMFEQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVC-------RE---WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRT---NEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKHSLECLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDASSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSANGQSEG----RSP 551          

HSP 2 Score: 88.5817 bits (218), Expect = 1.071e-17
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY ++ ++SG  DN+I++W   +  CL+ L GH   V C+++D + IV+G+ D  ++VWD          ++   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  259 KGVYCLQYDDDKIISGLRDNSIKIWDKHSLECLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWD---------ASSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 420          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Match: fbxw11a (F-box/WD repeat-containing protein 11 [Source:NCBI gene;Acc:103028966])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 304/537 (56.61%), Postives = 375/537 (69.83%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            SF+K+++     F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V        RE   W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YY  LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD  +LEC+++LTGH GSVLCLQYD+ VI++GSSDSTVRVW  SS   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM + +DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   51 SFEKEKEMCIQMFEQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVC-------RE---WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRT---NEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKHSLECLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDASSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSANGQSEG----RSP 516          

HSP 2 Score: 88.5817 bits (218), Expect = 9.451e-18
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY ++ ++SG  DN+I++W   +  CL+ L GH   V C+++D + IV+G+ D  ++VWD          ++   L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  224 KGVYCLQYDDDKIISGLRDNSIKIWDKHSLECLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWD---------ASSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 385          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Match: fbxw11b (F-box/WD repeat-containing protein 11-like [Source:NCBI gene;Acc:103029337])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 301/536 (56.16%), Postives = 374/536 (69.78%), Query Frame = 1
Query:  115 FKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            ++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD ++LEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   60 YEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQMEG----RSP 524          

HSP 2 Score: 87.8113 bits (216), Expect = 1.821e-17
Identity = 54/172 (31.40%), Postives = 88/172 (51.16%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY ++ ++SG  DN+I++W  ++  CL+ L GH   V C+++D + IV+G+ D  ++VWD+ +            L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  232 KGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGE---------VLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 393          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Match: fbxw11b (F-box/WD repeat-containing protein 11-like [Source:NCBI gene;Acc:103029337])

HSP 1 Score: 434.876 bits (1117), Expect = 8.248e-143
Identity = 234/482 (48.55%), Postives = 307/482 (63.69%), Query Frame = 1
Query:  115 FKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNT---IRLWQIETG---------TCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLV 1515
            ++K++      F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLC+A  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YYR LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD KI+SGLRDNSIK+WD ++LEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW ++S   +NT+ HH EAVLHLRF + ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNT   I++W ++            CLRTL  H   V  ++FD   I+S ++D  I +WD +
Sbjct:   60 YEKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTT---EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTISKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFL 474          

HSP 2 Score: 87.8113 bits (216), Expect = 1.306e-17
Identity = 54/172 (31.40%), Postives = 88/172 (51.16%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY ++ ++SG  DN+I++W  ++  CL+ L GH   V C+++D + IV+G+ D  ++VWD+ +            L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  232 KGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGE---------VLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 393          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 207.994 bits (528), Expect = 2.008e-57
Identity = 116/338 (34.32%), Postives = 181/338 (53.55%), Query Frame = 1
Query:  655 EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            EE ++E       +++ P +    +    +   RI  NW  G     K+         + CLQ+   +IVSG  DN++KVW A T +C+R L GH G V   Q  +N+IISGS+D T++VW+  +  C++T+Y H   V  +      +V+ S+D ++ VWD+     +    VL+GH AAV  V +D + +VS + D  +KVW+ ++   LHT+ GH   +  LQ+    VVSGS D +IR+W +ETG C+ TL GH+ L   +      +VSG  D  +K+WD+             CLQTL   ++H   V  LQF++  +++SS D T+ +WD 
Sbjct:  168 EEGIDEPLHGKRRKVVKPGFSHSPWKSAYIRQHRIDTNWRRGDLKSPKV-LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLH---VLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDI---------KTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDL 492          

HSP 2 Score: 159.844 bits (403), Expect = 7.038e-41
Identity = 92/239 (38.49%), Postives = 125/239 (52.30%), Query Frame = 1
Query: 1054 HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD-------TGVVSQDSGMNMVRSPVVSLDNDDEPIK 1749
            H    +  L+F  + +V+ S D ++ VW        +  R LVGH   V         I+S S DRT+KVWN ++ + +HT+ GH   + C+      VVSGS D T+R+W IETG CL  L GH   VRC+++D + +VSGAYD  +KVWD         P    CL TL  HT RV+ LQFD   +VS S D +I +WD          TG  S  SGM +  + +VS  N D  +K
Sbjct:  220 HDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTG---KCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWD---------PETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVS-GNADSTVK 445          

HSP 3 Score: 147.902 bits (372), Expect = 6.313e-37
Identity = 72/200 (36.00%), Postives = 119/200 (59.50%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNG---HRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTL 1419
            V C+   +K++VSG RD +++VWD  T +C+ VL GHV +V C+QYD   ++SG+ D  V+VW   + TC++T+  H   V  L+F    +V+ S D SI VWD+   + I     L GH++  + ++     +VS + D T+K+W+ ++ + L T+ G   H+  + CLQ+  N V++ S D T++LW + TG  +R L
Sbjct:  305 VRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIH---TLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNL 501          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 475.322 bits (1222), Expect = 3.992e-158
Identity = 233/336 (69.35%), Postives = 277/336 (82.44%), Query Frame = 1
Query:  712 YYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLT--GHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +YR LYP II +I+ I+ NW  G++NL++I+C SESSKGVYCLQYDD+KIVSGLRDN+IKV    T++ V+  T  GH+   + L Y    + +GSSDSTVRVW +++   VNT+ HHCEAVLHLRF + ++VTCSKDRSIAVWD+ +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVWNT +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDLVAAL+P++PA +LCL+TL +H+GRVFRLQFDEFQIVSSSHDDTILIWDFL+      ++     RSP
Sbjct:  234 FYRALYPKIIGDIETIESNWRCGRHNLQRIQCRSESSKGVYCLQYDDEKIVSGLRDNTIKV--KATIK-VKATTHHGHLIFFMFLLYVQLYVFTGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFTNGLMVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNVPAAQAEAA----RSP 562          

HSP 2 Score: 146.362 bits (368), Expect = 5.515e-37
Identity = 68/126 (53.97%), Postives = 90/126 (71.43%), Query Frame = 1
Query:  106 SESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKL 483
            S +++K+++     F ++++  Q+  V+ L+  M H+QHG I++YLKPMLQRDFIT LPA+GL  ++E ILSYLDA+SLCAA  V   W +VI +G LWKKLIE MV TD LWRGL ER GW   L
Sbjct:   94 SANYEKEREVCVKYFDQWSESDQVEFVEHLISRMCHFQHGHINSYLKPMLQRDFITALPARGLDHLAENILSYLDARSLCAAELVCKEWYRVISDGMLWKKLIERMVRTDSLWRGLSERRGWCLYL 219          

HSP 3 Score: 60.4622 bits (145), Expect = 1.207e-9
Identity = 49/172 (28.49%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  +VSG  DNTI++ +        T  GH      + +   Y+ +G+ D  ++VWD+    N     N     TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   +TS    F   LN H
Sbjct:  271 KGVYCLQYDDEKIVSGLRDNTIKV-KATIKVKATTHHGHLIFFMFLLYVQLYVFTGSSDSTVRVWDV----NTGEMVN-----TLIHHCEAVLHLRFTNGLMVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTS-TCEFVRTLNGH 431          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.312 bits (547), Expect = 1.370e-60
Identity = 129/354 (36.44%), Postives = 188/354 (53.11%), Query Frame = 1
Query:  655 EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG-----VVSQDSG 1692
            EE ++E   +   +   P +    +    +   RI  NW  G+    K+         + CLQ+   +IVSG  DN++KVW A T +C+R L GH G V   Q   N+I+SGS+D T++VW+  +  CV+T+Y H   V  +    + +V+ S+D ++ VWD+     +    VL GH AAV  V +D + +VS + D T+KVW+ +S   LHT+ GH   +  LQ+    +VSGS D +IR+W  ETGTCL TL GH+ L   +      +VSG  D  +K+WD+             CLQTL   N+H   V  LQF    +V+SS D T+ +WD L TG     +VS DSG
Sbjct:  180 EEGLDEPLYVKRKKSATPNFTYSPWKSAYMRQHRIDMNWRCGEIRAPKV-LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQCLH---VLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRDNILVSGNADSTVKIWDI---------KTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSSDDGTVKLWD-LRTGDFLRNLVSLDSG 519          

HSP 2 Score: 160.999 bits (406), Expect = 6.704e-42
Identity = 93/232 (40.09%), Postives = 124/232 (53.45%), Query Frame = 1
Query: 1078 LRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVV--------SQDSGMNMVRSPVVSLDNDDEPIK 1749
            L+F  + +V+ S D ++ VW        +  R LVGH   V         IVS S DRT+KVWN  + + +HT+ GH   + C+    N VVSGS D T+R+W IETG CL  L GH   VRC+++D + +VSGAYD  +KVWD         P +  CL TL  HT RV+ LQFD   IVS S D +I +WD  +TG          S  SGM + R  ++   N D  +K
Sbjct:  240 LQFCGNRIVSGSDDNTLKVWSAVTG---KCLRTLVGHTGGVWSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWD---------PESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWD-AETGTCLHTLVGHQSLTSGMEL-RDNILVSGNADSTVK 457          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 122.479 bits (306), Expect = 1.793e-30
Identity = 87/298 (29.19%), Postives = 144/298 (48.32%), Query Frame = 1
Query:  859 IVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYD--NNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSI--LVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKN--IVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNL----------------------VVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQ--IVSSSHDDTILIWD 1656
            IVS   D +IKVWD  T +  R L GH  SV  + +D    ++ S S+D TV++W   S+ C+ T++ H   V  + F  +   LV+ S+D+++ +W++     ++      GHR  V +V  +Q    I S S D+T++VW T + E    +  H   + C+ +  +                       ++SGS D TI++W I TG C+ TL GH+  VR + F    K+I+S A D  ++VWD           N  C ++L  H   V  L F +    +++ S D ++ +W+
Sbjct:   62 IVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVK---TFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDY---------KNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          

HSP 2 Score: 101.679 bits (252), Expect = 1.918e-23
Identity = 76/278 (27.34%), Postives = 131/278 (47.12%), Query Frame = 1
Query:  925 VLTGHVGSVLCLQYDN--NVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRF--AHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNN--LVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF----------------------DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQF---DEFQIVSSSHDDTILIWDF 1659
             L+GH   V  + +    +VI+S S D+T++VW   +     T+  H ++V  + F  +  +L +CS D ++ +WD          R + GH   V+ V F  +  ++VSAS D+T+K+W  Q+   + T  GHR  +  ++   +  L+ S S+D T+R+W   T  C   L  HE +V C+ +                         Y++SG+ D  IK+WD+         +  +C+ TL  H   V  + F    +F I+S + D T+ +WD+
Sbjct:   42 ALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDF---QSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDI---------STGICVITLVGHDNWVRGVLFHPGGKF-ILSCADDKTLRVWDY 306          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 102.834 bits (255), Expect = 4.566e-23
Identity = 74/282 (26.24%), Postives = 133/282 (47.16%), Query Frame = 1
Query:  859 IVSGLRDNSIKVWDARTLECVRVLTGHVGSV--LCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSI--LVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFD--QKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGI--ACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSK-YIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFD--EFQIVSSSHDDTILIWDFLDTG 1671
             V+G  D +IK+W+  T +    LTGH+ +V  + +   +  + S   D  ++ W L     +   + H  A   L    +I  LVTC +D +  VWD+   +++     L GH   V  V     +  I++ S D T+++W+  + +   T+  H++ +    L  R     S S DN I+ W+   G   + L GH  ++ C+  +S   +VSGA +G + +WD     N Q    ++   +L+  +G +F   FD  E +++++  D TI ++   DT 
Sbjct:  228 FVTGSADRTIKIWELATGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYHGHLSAAYALDLHPTIDVLVTCGRDATARVWDIRTKANV---HTLTGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGKSRVTLTNHKKSVRSVVLHPRQYTFASASPDN-IKQWKFPDGVFFQNLSGHNAIINCLALNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESG-IFACAFDHSESRLITAEADKTIKLYKEDDTA 504          

HSP 2 Score: 88.5817 bits (218), Expect = 1.935e-18
Identity = 65/256 (25.39%), Postives = 121/256 (47.27%), Query Frame = 1
Query:  922 RVLTGHVGSV--LCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAH--SILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQK--NIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACL--QYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSK-YIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFD-EFQIVSSSHDDTILIWDF 1659
            RV++GH+G V  + ++  N   ++GS+D T+++W L++     ++  H   V  +  +     L +C +D+ I  WD+     IR      GH +A   +D       +V+   D T +VW+ ++   +HT+ GH   +A +  Q     +++GS D T+RLW +  G    TL  H++ VR +    + Y  + A    IK W            + +  Q L+ H   +  L  + +  +VS + + T+ +WD+
Sbjct:  207 RVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWELATGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYH---GHLSAAYALDLHPTIDVLVTCGRDATARVWDIRTKANVHTLTGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGKSRVTLTNHKKSVRSVVLHPRQYTFASASPDNIKQWKF---------PDGVFFQNLSGHNAIINCLALNSDGVLVSGADNGTMHLWDW 450          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 100.908 bits (250), Expect = 1.520e-22
Identity = 73/260 (28.08%), Postives = 127/260 (48.85%), Query Frame = 1
Query:  922 RVLTGHVGSVLCLQYDNNV--IISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHS--ILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQ--IVSSSHDDTILIWDFLD 1665
            R   GH  ++  + ++ N+  + SGS D+ + VW+    T       H +AV+ ++F+ S  ++V+ S+D+++ +W    PS      V   H A V  V F  D +++V+AS D++IKVW     +FL+++N H   +   ++     L+VSGS D T+R+W   +  C+ T   H   V  + F      I +   D  +KVWD+          N L LQ    H   V  L F      ++++S+D T+ + D ++
Sbjct:   12 RHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLW---VPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIR--------MNKL-LQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVE 259          

HSP 2 Score: 93.5893 bits (231), Expect = 2.943e-20
Identity = 73/279 (26.16%), Postives = 121/279 (43.37%), Query Frame = 1
Query:  853 KKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY--DNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAH--SILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFD--SKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQ--IVSSSHDDTILIW 1653
            K++ SG  D  + VW+ +         GH  +V+ +Q+    ++++S S D TVR+W  S          H   V  + F+     LVT S D+SI VW +      +    L  H   V    F  D + IVS S DRT++VW++ S E +HT   H   +  + +      + +  +DNT+++W I     L+  + H   V  + F     Y+++ + D  +KV DLV               TL+ H G    + F        S   D+ +++W
Sbjct:   31 KQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQ---KFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLV---------EGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 3 Score: 84.3445 bits (207), Expect = 2.912e-17
Identity = 59/208 (28.37%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  799 IECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY--DNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRF--AHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVG---HRAAVNVVDFDQKN--IVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQ 1389
             + H+ + + V     D + +V+   D SIKVW     + +  L  H   V   ++  D  +I+SGS D TVRVW  +S  CV+T Y H   V  + F  + + +     D ++ VW      DIR+ ++L     H AAVN + F      +++AS D T+KV +       +T++GH+     + +    +   SG SD  + +W+
Sbjct:   98 FKAHTATVRSV-SFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVW------DIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWK 298          

HSP 4 Score: 77.411 bits (189), Expect = 4.857e-15
Identity = 56/175 (32.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query: 1156 DIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQY--RNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQF--DEFQIVSSSHDDTILIWD 1656
            D  L R   GHR  +  VDF  + K + S S D  + VWN +     +   GH+  +  +Q+    +LVVS S D T+RLW           + H   VR + F  D + +V+ + D  IKVW +              L +LNQH+  V   +F  D   IVS S D T+ +WD
Sbjct:    7 DPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTV---------HRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWD 172          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 128.257 bits (321), Expect = 4.383e-31
Identity = 96/326 (29.45%), Postives = 154/326 (47.24%), Query Frame = 1
Query:  754 RIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNI--VSASGDRTIKVWN--TQSC-EFLHTMNGHRRGIACLQYRN--NLVVSGSSD--------------------------------------------NTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHT 1578
            +++ NW  G   +++ + H +   GV  LQ++ + + +G  D++I +WD  T + +R L+GH   V  L +D+  +I+GS D T+RVW+  +  C++T   H ++VL +     ++V+ S D+++ VW + + +   LR    GH   VN V    K+    S S D TI++W+  T SC +      G  + I  L  ++  NL    +SD                                            NTI+LW ++TG C+RT  GH E V  I  D+  I+SG++DG IKVWDL +        N   LQ   QHT
Sbjct:  283 KVESNWRKGHCRIQEFKGHMD---GVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR----GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSG-KCMHTFNGRRLQRETQHT 600          

HSP 2 Score: 111.309 bits (277), Expect = 1.102e-25
Identity = 77/256 (30.08%), Postives = 123/256 (48.05%), Query Frame = 1
Query: 1057 HCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYI--VSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYEL 1818
            H + VL L+F + +L T S D +I +WD+F     +L R L GH   V  + FD + +++ S D+TI+VWN  + E + T  GH   +  +     ++VSGS+D T+++W +E+ TC  TL GH E V C++   K     S + D  I++WD+           + CL+    H G+V ++      I  +  D   L  D    G   QD        P ++ D  DE   P  EQ ++      +N+P+   L
Sbjct:  301 HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTG---KLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI---------RTNSCLKVFRGHVGQVQKI------IPLTIKDVENLATDNTSDGSSPQD-------DPTMT-DGADESDTPSNEQETV----LDENIPYPTHL 525          

HSP 3 Score: 83.9593 bits (206), Expect = 4.644e-17
Identity = 51/161 (31.68%), Postives = 78/161 (48.45%), Query Frame = 1
Query: 1183 GHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRV--FRLQFDEFQIVSSSHDDTILIWDF 1659
            GH   V  + F+ + + + S D TI +W+  + + +  ++GH  G+  L + +  +++GS D TIR+W   TG C+ T  GH + V  +    K IVSG+ D  +KVW +           S    TL  HT  V   +L    F   S S D TI +WD 
Sbjct:  300 GHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV----------ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450          

HSP 4 Score: 75.485 bits (184), Expect = 1.847e-14
Identity = 39/130 (30.00%), Postives = 65/130 (50.00%), Query Frame = 1
Query: 1264 WNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIW 1653
            W    C  +    GH  G+  LQ+   L+ +GS D+TI +W + TG  +R L GH + V+ + FD + +++G+ D  I+VW+ +            C+ T   H+  V  +   +  IVS S D T+ +W
Sbjct:  288 WRKGHCR-IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITG---------ECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 124.79 bits (312), Expect = 9.778e-30
Identity = 86/298 (28.86%), Postives = 134/298 (44.97%), Query Frame = 1
Query:  757 IQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDN-NVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAH----SILVTCSKDRSIAVWDMFAPSDI--------------------RLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQY--RNNLVVSGSSDNTIRLWQIE----TGTC----------------LRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWD 1509
            I KNW + K+  ++       +  + CLQ++D  +++G  D  I+V+D+   + +  L+GH G V  L+Y +  +++SGS+D TVRVW +    C +    H   V  L          +VT S+D ++ VW +   S +                        VL GH A+V  V      +VS S D T+ VW+    + L+ ++GH   I    Y       +S S D TIR+W +E     G C                + TL+GH  LV  +R   K++VS A DG I+ WD
Sbjct:  361 ILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWD 658          

HSP 2 Score: 110.538 bits (275), Expect = 2.835e-25
Identity = 84/289 (29.07%), Postives = 133/289 (46.02%), Query Frame = 1
Query:  925 VLTGHVGSVL-CLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHS-ILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQ----KNIVSASGDRTIKVWN-----------------------TQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFD--SKYIVSGAYDGKIKVWDL---------VAALNPQSPANSL--CLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD 1665
             L GH+ SV+ CLQ+++N +I+G+ D  +RV+   +   +  +  H   V  L++AH  ILV+ S DR++ VWD+          V  GH + V  +D  +    K IV+ S D T+ VW                         ++  F+  + GH   +  +    N+VVSGS DNT+ +W +    CL  L GH + +    +D   K  +S + D  I++WDL           A N  SP   +   + TL  HT  V  L+  +  +VS++ D +I  WD  D
Sbjct:  376 TLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGC---CTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDAND 661          

HSP 3 Score: 47.7506 bits (112), Expect = 8.091e-6
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  178 NLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGY-LWKKLI 414
            NL+  L+ +M   +   +   +K  L+RD IT LP    F++S +I +YL  + +  +  VS +W ++IR+   LWKKL+
Sbjct:  245 NLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLP----FEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLL 320          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Match: MDV1 (Peripheral protein of cytosolic face of mitochondrial outer membrane; required for mitochondrial fission; interacts with Fis1p and with the self-assembled oligomeric form of the dynamin-related GTPase Dnm1p; contains WD repeats; MDV1 has a paralog, CAF4, that arose from the whole genome duplication [Source:SGD;Acc:S000003648])

HSP 1 Score: 110.153 bits (274), Expect = 3.520e-25
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 1
Query:  835 CLQYD---DKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY--DNNVIISGSSDSTVRVWSLS-------------------SWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAAL 1524
            CL +D        +G  D+++K+WD      +  L GH+ ++ C+Q   D   +++G  D+ +++W+L+                      CV+T   H + V  L    S LV+ S+DR+I  WD+ +                +  +D    N+++ S +  +      S   L T    R  I  LQ  +  + +G+ D  +RLW + +G  +RTL+GH + +  ++FDS  +V+G+YD  +++WDL   L
Sbjct:  403 CLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGK-------------CLQTIDLSFANVLTTSTNVDL------SKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTGL 637          

HSP 2 Score: 85.8853 bits (211), Expect = 1.365e-17
Identity = 64/273 (23.44%), Postives = 117/273 (42.86%), Query Frame = 1
Query:  829 VYCLQY--DDKKIVSGLRDNSIKVWDARTLE-------------------CVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVL------------------------HLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQ-YRNNLVVSGSSDNTIRLWQIETGTCLRTLE-GHEELVRCIRFDSKYIVSGAYDGKIKVW 1506
            + C+Q   D   +V+G RD ++K+W+    +                   CV     H   V  L  D + ++SGS D T+R W L S  C+ TI      VL                         L+   + L T +KD  + +WD+ +   I   R L GH  A+  + FD   +V+ S DRT+++W+ ++   L+  + +   +  L  ++ N  V  + + +++++  E       +E G+E  V  +++   Y+V G  +G + +W
Sbjct:  444 INCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVI---RTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKYKENYMVEGRENGDVNIW 712          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 102.064 bits (253), Expect = 4.759e-23
Identity = 74/266 (27.82%), Postives = 126/266 (47.37%), Query Frame = 1
Query:  856 KIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDN-NVIISGSSDSTVRVWSLSSWT-CVNTIYHHCEAVLHLR-----------FAHS------------------------------ILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNN--LVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVW 1506
            ++ S  +D +IK+WD  +  C   ++GH  SV C+++    ++ SGS D TVRVW ++S   C+N +  H   V HL            F H+                              ++VT S D ++ +W+    +    R  + GH+  VN V F  D + IVSAS D +IK+W+ +  +F+ T  GH   +  + + ++  L+VS S D T+++W + T      L GH++ V  + +  D K + SG  D  +++W
Sbjct:  250 RLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIAR--MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          

HSP 2 Score: 93.9745 bits (232), Expect = 2.091e-20
Identity = 83/327 (25.38%), Postives = 148/327 (45.26%), Query Frame = 1
Query:  856 KIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY--DNNVIISGSSDSTVRVWSLSSWTCV-NTIYHHCEAVLHLRF---------AHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIV-SASGDRTIKVWNTQS---C-------------------------EFLHT-------MNGHRRGIA-----CLQYRNN--LVVSGSSDNTIRLWQ-IETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQF--DEFQIVSSSHDDTILIWD 1656
            ++V+G  DN+ ++WD  T   +  L GH   VLC+ +  D  VI +GS D+T+R+W   S  C+ + +  H + +  L +         +   L + SKD +I +WD  +      +  + GH  +V+ V +  + ++ S S DRT++VW+  S   C                          F HT           ++ +      C +  N+  ++V+ S D T+ LW  +++   +  + GH++LV  + F  D +YIVS ++D  IK+WD           +   + T   H   V+++ +  D   +VS S D T+ +WD
Sbjct:  158 RMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRV---CQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD---------GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472          

HSP 3 Score: 63.929 bits (154), Expect = 6.463e-11
Identity = 42/135 (31.11%), Postives = 66/135 (48.89%), Query Frame = 1
Query: 1297 MNGHRRGIACLQYR---NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCL-QTLNQHTGRVFRLQFDEFQIV---------SSSHDDTILIWD 1656
            + GH   I C  +    ++ +V+G+ DNT R+W  +T T + TL+GH   V C+ +  D + I +G+ D  I++WD         P +  CL   L  H+  +  L ++   +V         SSS D TI IWD
Sbjct:  139 IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWD---------PKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWD 264          

HSP 4 Score: 47.7506 bits (112), Expect = 5.808e-6
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  847 DDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY--DNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCS--KDRSIAVW 1137
            D + IVS   DNSIK+WD R  + +    GHV SV  + +  D  +++S S D+T++VW + +      +  H + V  + ++      CS  KD+ + +W
Sbjct:  413 DGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Match: CAF4 (WD40 repeat-containing protein associated with the CCR4-NOT complex; interacts in a Ccr4p-dependent manner with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p and plays a role in mitochondrial fission; CAF4 has a paralog, MDV1, that arose from the whole genome duplication [Source:SGD;Acc:S000001744])

HSP 1 Score: 98.9821 bits (245), Expect = 9.853e-22
Identity = 79/332 (23.80%), Postives = 152/332 (45.78%), Query Frame = 1
Query:  808 HSESSKGVYCLQYD---DKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDN---NVIISGSSDSTVRVWSLS-------------------SWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDM------------FAP--SDIRL-------RRVLVGHRA-AVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAA---LNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIW 1653
            H E    +  L +D        S  +D  +KVWD      V  L GH+ +V C+Q D    N++I+GS D+T+++W L+                      C++    H + +  L F    LV+ S+D+ I  WD+            F P  SDI++          L+G  A  +  +      + + + D  +++W+ +  + +  + GH  GI  L++ +  +V+GS DN++R+W + T + L  +  ++  V  + FD K I  GA +G + V+++      + P+ P +SL    L++   R+  +++ +  +++  +D  I +W
Sbjct:  315 HGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWMTPE-PPHSLDGDELSR---RIAIVKYKDGFLINGHNDGDINVW 641          

HSP 2 Score: 81.2629 bits (199), Expect = 3.202e-16
Identity = 76/296 (25.68%), Postives = 126/296 (42.57%), Query Frame = 1
Query: 1045 TIYH--HCEAVLHLRFAHSILVTCS---KDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKN---IVSASGDRTIKVWNTQ-SCEF------------------LHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLE------------------------GHEE-LVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSIN 1776
            TI H  H  ++  L F       CS   +DR + VWD+     +     L GH A VN +  D+KN   +++ S D T+K+W+   S E                   +H    H+  I  L + +  +VSGS D  I  W + TG C++ L+                        G E  ++  ++  +  + +G  DG +++WDL        P     ++ L  HT  +  L+FD  ++V+ S D+++ IWD   + ++     +     PV SLD D + I  GA +G +N
Sbjct:  312 TIPHGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVG---ELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVG----KP-----VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILD----VIAYDLPVSSLDFDGKLITVGANEGGVN 591          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Match: EDO48720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIJ5])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 312/505 (61.78%), Postives = 366/505 (72.48%), Query Frame = 1
Query:  148 FLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFL 1662
            F K+T+ +Q+  V+ LL  M H+QHG ++A+LKPMLQRDFIT LPAKGL  ++E ILS+LDAKSLCAA  V   W +VI +G LWKKLIE  V TDPLW GL ER                                                    G   YL  + VP+   N+             ++R+LYP II +++ I+ NW  G + L KI C SE+SKGVYCLQYDD KIVSGLRDN+IKVWD ++L CV+VLTGH GSVLCLQYD NVI++GSSDSTVRVW++ +   +NT+ HHCEAVLHLRF   ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGHRRGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA +LCL+TL +HTGRVFRLQFD+FQIVSSSHDDTILIWDFL
Sbjct:    4 FEKWTESEQVQFVEYLLSRMCHFQHGHVNAFLKPMLQRDFITALPAKGLDHIAENILSFLDAKSLCAAEVVCKEWHRVIADGMLWKKLIERKVRTDPLWHGLSER---------------------------------------------------RGWGQYLFKSKVPDPPNND-------------FFRKLYPKIIQDLETIETNWRCGNHALHKIPCRSENSKGVYCLQYDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPAGTLCLRTLVEHTGRVFRLQFDDFQIVSSSHDDTILIWDFL 444          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 206.838 bits (525), Expect = 6.334e-57
Identity = 120/337 (35.61%), Postives = 183/337 (54.30%), Query Frame = 1
Query:  706 PEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG-----VVSQDSG 1692
            P  Y++L+    +  ++I  NW  G     KI         + CLQ+   ++VSG  D ++KVW A + +C+R LTGH G V   Q   ++I+SGS+D T++VW+  +  C++T+Y H   V  +     ++V+ S+D ++ VWD    + +    VLVGH AAV  V +D   +VS + D  +KVW+ ++ + +HT+ GH   +  LQ+    +VSGS D +IR+W  ETG CL TL GH+ L   +   +  +VSG  D  +K+WD+             CLQTL   N+H   V  LQF    +++SS D T+ IWD L TG     +V  DSG
Sbjct:  258 PSPYKKLF----MVKQKIYWNWRRGPLRPSKI-LKGHDDHVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLH---VLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTG---------QCLQTLAGPNKHQSAVTCLQFSSKFVITSSDDGTVKIWD-LQTGEFIRDLVKLDSG 576          

HSP 2 Score: 156.762 bits (395), Expect = 6.562e-40
Identity = 91/295 (30.85%), Postives = 148/295 (50.17%), Query Frame = 1
Query:  895 WDARTLECVRVLTGHVGSVL-CLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSIN 1776
            W    L   ++L GH   V+ CLQ+  + ++SGS D T++VWS  S  C+ T+  H   V   + +  I+V+ S DR++ VW+      +     L GH + V  +D  ++ +VS S D T++VW+T +   LH + GH   + C++Y  + VVSG+ D  +++W  ET  C+ TL+GH   V  ++FD  YIVSG+ D  I+VW               CL TL  H      ++     +VS + D T+ IWD      +   +G N  +S V  L    + +   ++ G++ 
Sbjct:  275 WRRGPLRPSKILKGHDDHVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCMH---TLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWH---------AETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCLQFSSKFVITSSDDGTVK 557          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Match: EDO39072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB92])

HSP 1 Score: 197.208 bits (500), Expect = 4.367e-55
Identity = 124/339 (36.58%), Postives = 185/339 (54.57%), Query Frame = 1
Query:  709 EYYRRLYPDIIVNIKR-------IQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLT--GHVGSVLCLQYDNNVIISGSSDSTVRVWSL---SSW---TCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQIETGTCLRTL-----EGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            ++ R   P  I+  K+       ++KNWL+G+ +++  E H++   G+ C+Q+DD +IVSG  D +IKVWD    +   VLT  GH G+V CL  + N ++SGS D +++VW L   S W   +C  T+  H   V  L+     +V+ S D+++ VWD+   +    +  L GH AAV  V FD+  IVS S D TIKVW+      L T+ GH   + CL        V+SGS D+ ++ W + TG C+ TL     EGH  ++RC++ DS  IVS   D  +K+W L +            L TL  HT  V  LQF++++IVS S+D T+ +WDF
Sbjct:  113 QFQRHTLPSGIIQWKKMFAERFLLRKNWLNGRCDVRTFEGHTQ---GISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAGHSGTVRCLNLNGNRLVSGSVDRSIKVWDLSFESYWSGASCKVTMVGHMHTVRCLQVDDEKVVSGSYDKTLKVWDIKTGN---CKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGKCIGTLDWIRSEGHTGVIRCLQSDSWRIVSAGDDKTLKMWSLESGQR---------LLTLRCHTDGVTCLQFNDYRIVSGSYDKTVKVWDF 436          

HSP 2 Score: 159.458 bits (402), Expect = 5.376e-42
Identity = 96/263 (36.50%), Postives = 145/263 (55.13%), Query Frame = 1
Query:  919 VRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLS--SWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPS---DIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIR--FDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLN-----QHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG 1671
            VR   GH   + C+Q+D+  I+SGSSD T++VW LS    + V T+  H   V  L    + LV+ S DRSI VWD+   S       +  +VGH   V  +  D + +VS S D+T+KVW+ ++     T+ GH   + C+Q+  + +VSGS DNTI++W +  G+CL TL GH + V C+    D + ++SG+ D  +K WDL         A   C+ TL+      HTG +  LQ D ++IVS+  D T+ +W  L++G
Sbjct:  147 VRTFEGHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAGHSGTVRCLNLNGNRLVSGSVDRSIKVWDLSFESYWSGASCKVTMVGHMHTVRCLQVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDL---------ATGKCIGTLDWIRSEGHTGVIRCLQSDSWRIVSAGDDKTLKMWS-LESG 399          

HSP 3 Score: 54.299 bits (129), Expect = 1.624e-7
Identity = 30/73 (41.10%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  811 SESSKGVY-CLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLS 1026
            SE   GV  CLQ D  +IVS   D ++K+W   + + +  L  H   V CLQ+++  I+SGS D TV+VW  S
Sbjct:  365 SEGHTGVIRCLQSDSWRIVSAGDDKTLKMWSLESGQRLLTLRCHTDGVTCLQFNDYRIVSGSYDKTVKVWDFS 437          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 184.111 bits (466), Expect = 8.730e-51
Identity = 98/277 (35.38%), Postives = 153/277 (55.23%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            V CLQ+D +++V+G  D +I++WD R+   +R + GH G V CLQ+DN  IISGS D T+ VW +  +T ++ +Y H   V  LRF  + LV+ S D +I VWDM     +    VL GH  AV+ ++FD   ++S S D+TIK+WN +S + L+T+ GH   +  ++    L++SGS+D  I  W +++G C   ++ HE  V  + + + +  S   D  IK WD+             CL+TL  H G V  +      I+   +D ++ IWD 
Sbjct:  152 VLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECV---LVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAHEGPVHSLSYANDHFFSAGGDNMIKEWDV---------GTCTCLRTLQGHRGPVQDVMVGHHYILVEHYDGSVRIWDL 416          

HSP 2 Score: 154.451 bits (389), Expect = 1.816e-40
Identity = 86/242 (35.54%), Postives = 131/242 (54.13%), Query Frame = 1
Query:  787 NLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDL 1512
            +++K++ H     GV CLQ+D+++I+SG  D +I VW       + VL GH G V CL++D N ++SGS DST+RVW + +W CV  +  H  AV  L F    +++ S D++I +W++ +   +   R   GH  AV  V    + I+S S D  I  W+  S      +  H   +  L Y N+   S   DN I+ W + T TCLRTL+GH   V+ +     YI+   YDG +++WDL
Sbjct:  181 SIRKMKGHK---GGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLR---GHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAHEGPVHSLSYANDHFFSAGGDNMIKEWDVGTCTCLRTLQGHRGPVQDVMVGHHYILVEHYDGSVRIWDL 416          

HSP 3 Score: 139.813 bits (351), Expect = 1.695e-35
Identity = 82/229 (35.81%), Postives = 125/229 (54.59%), Query Frame = 1
Query: 1039 VNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSL 1725
             N +  H + VL L+F    +VT S DR+I +WD+ +   IR  +   GH+  V  + FD + I+S S D TI VW+      LH + GH+  ++CL++  N +VSGS D+TIR+W + T  C+  L+GHE  V C+ FD+ +++SG+ D  IK+W++          +  CL TL  H   V  ++     I+S S D  IL WD LD+G    ++ +     PV SL
Sbjct:  142 ANVLKGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMK---GHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNV---------ESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWD-LDSG--HCEAAIQAHEGPVHSL 355          

HSP 4 Score: 125.561 bits (314), Expect = 8.431e-31
Identity = 74/211 (35.07%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 1150 PSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRS---PVVSLDNDDEPIKPGAEQGSI 1773
            P+ ++   VL GH   V  + FD++ +V+ S DRTI++W+ +S   +  M GH+ G+ CLQ+ N  ++SGS D TI +W I   T L  L GH+  V C+RFD   +VSG++D  I+VWD+             C+  L  H G V  L+FD   ++S S D TI +W+      V     +N +R     V S+    E I  G+  G I
Sbjct:  136 PALVQAANVLKGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDM---------RTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWN------VESGDCLNTLRGHADAVTSVKVIGELILSGSADGMI 331          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Match: EDO32198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR9])

HSP 1 Score: 137.502 bits (345), Expect = 1.644e-33
Identity = 91/327 (27.83%), Postives = 157/327 (48.01%), Query Frame = 1
Query:  724 LYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSS-DSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFD--QKNIVSASGDRTIKVWNTQS---CEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF---------DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            ++ DI      +++NW  G+  + +I  H++S   V+ +     KI SG  D ++KVWDA T   ++ L GH   + CL++ ++ I+   S D ++RVW+L +  C   +  H   +  +     IL++ S D++  +W++      +L   L GH  +V  VD D   K   + S DRT+++W+  S      ++    +   I  + Y  + +   +  N + LW +  GTC    +GH+  +  +R          +S  IVS   D  IK WD+             C+QTL  H   V  + FD+ +I+S+S+D+ I IWDF
Sbjct:  376 IWKDIFKRNINLKRNWAEGRCKVMEISGHTKS---VFSVCECMNKIASGSLDRTVKVWDATTGNLLQSLHGHTRGIWCLRFLSSSILISGSYDKSIRVWNLRTGICARILLSHEAPIWAIERKKDILISGSGDKTAKLWNI---RQCKLLCTLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASGACVGIVYAGLSNASAITSVSYDQDYIAVAAG-NLVSLWNLANGTCSHEFKGHKARIESVRLRFMMVNGRKESGVIVSAGKDSMIKYWDI---------ERGTCIQTLRSHKDAVNCIHFDDTRIISASYDNRIRIWDF 686          

HSP 2 Score: 88.5817 bits (218), Expect = 5.099e-18
Identity = 52/208 (25.00%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNV--IISGSSDSTVRVWSLSSWTCVNTIY---HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPS-------------DIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIET 1398
            ++ ++     ++SG  D + K+W+ R  + +  L GH GSV C+  D+      +GS+D TVR+W ++S  CV  +Y    +  A+  + +    +   + +  +++W++   +              +RLR ++V  R    V       IVSA  D  IK W+ +    + T+  H+  + C+ + +  ++S S DN IR+W   T
Sbjct:  489 IWAIERKKDILISGSGDKTAKLWNIRQCKLLCTLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASGACVGIVYAGLSNASAITSVSYDQDYIAVAAGNL-VSLWNLANGTCSHEFKGHKARIESVRLRFMMVNGRKESGV-------IVSAGKDSMIKYWDIERGTCIQTLRSHKDAVNCIHFDDTRIISASYDNRIRIWDFNT 688          

HSP 3 Score: 87.4261 bits (215), Expect = 1.008e-17
Identity = 66/223 (29.60%), Postives = 101/223 (45.29%), Query Frame = 1
Query: 1129 AVWDMFAPSDIRLRR----------VLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSS-DNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEF--QIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGA 1758
            A+W      +I L+R           + GH  +V  V      I S S DRT+KVW+  +   L +++GH RGI CL++ ++ ++   S D +IR+W + TG C R L  HE  +  I      ++SG+ D   K+W++            LC  TL  HTG VF +  D+   +  + S D T+ IWD      V          S + S+  D + I   A
Sbjct:  375 AIWKDIFKRNINLKRNWAEGRCKVMEISGHTKSVFSVCECMNKIASGSLDRTVKVWDATTGNLLQSLHGHTRGIWCLRFLSSSILISGSYDKSIRVWNLRTGICARILLSHEAPIWAIERKKDILISGSGDKTAKLWNI-------RQCKLLC--TLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASGACVGIVYAGLSNASAITSVSYDQDYIAVAA 588          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 379/537 (70.58%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++++  + F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YY  LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRFA+ ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   88 NYEKEKEHCIALFDQWSEADQVEFVERLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTA---EIPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSANGQSEG----RSP 553          

HSP 2 Score: 88.9669 bits (219), Expect = 8.461e-18
Identity = 54/172 (31.40%), Postives = 86/172 (50.00%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VW++              L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  261 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGE---------VLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 422          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 302/537 (56.24%), Postives = 379/537 (70.58%), Query Frame = 1
Query:  112 SFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVP---EEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSP 1713
            +++K++++  + F ++++  Q+  V+ L+  M HYQHG I++YLKPMLQRDFIT LPA+GL  ++E ILS+LDA+SLCAA  V             W+++I   +    LW+ L E                      RM +                            TD    G S     E+Y+ +N      E+    YY  LYP II +I+ I+ NW  G++NL++I+C SE+SKGVYCLQYDD+KI+SGLRDNSIK+WD +TLEC+++LTGH GSVLCLQYD  VI++GSSDSTVRVW +++   +NT+ HH EAVLHLRFA+ ++VTCSKDRSIAVWDM +P+DI LRRVLVGHRAAVNVVDFD K IVSASGDRTIKVW+T +CEF+ T+NGH+RGIACLQYR+ LVVSGSSDNTIRLW IE G CLR LEGHEELVRCIRFD+K IVSGAYDGKIKVWDL AAL+P++PA++LCL+TL +H+GRVFRLQFDEFQI+SSSHDDTILIWDFL+     Q  G    RSP
Sbjct:   53 NYEKEKEHCIALFDQWSEADQVEFVERLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCAAELVCKE----------WQRVISEGM----LWKKLIE----------------------RMVR----------------------------TDPLWKGLSERHQWEKYLFKNRTA---EIPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSANGQSEG----RSP 518          

HSP 2 Score: 88.5817 bits (218), Expect = 7.877e-18
Identity = 54/172 (31.40%), Postives = 86/172 (50.00%), Query Frame = 1
Query: 1312 RGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVH 1827
            +G+ CLQY +  ++SG  DN+I++W  +T  CL+ L GH   V C+++D + IV+G+ D  ++VW++              L TL  H   V  L+F    +V+ S D +I +WD      +S    +   R+ V  +D DD+ I   +   +I   STS    F   LN H
Sbjct:  226 KGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGE---------VLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTS-TCEFVRTLNGH 387          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 205.297 bits (521), Expect = 1.833e-56
Identity = 115/309 (37.22%), Postives = 171/309 (55.34%), Query Frame = 1
Query:  754 RIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG 1671
            RI  NW  G     K+         + CLQ+   +IVSG  DN++KVW A T +C+R L GH G V   Q   N+IISGS+D T++VW+  +  C++T+Y H   V  +      +V+ S+D ++ VWD+     +    VL+GH AAV  V +D + +VS + D  +KVW+ ++   LHT+ GH   +  LQ+    VVSGS D +IR+W +ETG C+ TL GH+ L   +      +VSG  D  +K+WD+             CLQTL   ++H   V  LQF++  +++SS D T+ +WD L TG
Sbjct:  206 RIDTNWRRGDLKSPKV-LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLH---VLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDI---------KTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWD-LKTG 500          

HSP 2 Score: 161.77 bits (408), Expect = 1.538e-41
Identity = 93/239 (38.91%), Postives = 126/239 (52.72%), Query Frame = 1
Query: 1054 HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD-------TGVVSQDSGMNMVRSPVVSLDNDDEPIK 1749
            H    +  L+F  + +V+ S D ++ VW        +  R LVGH   V      +  I+S S DRT+KVWN ++ E +HT+ GH   + C+      VVSGS D T+R+W IETG CL  L GH   VRC+++D + +VSGAYD  +KVWD         P    CL TL  HT RV+ LQFD   +VS S D +I +WD          TG  S  SGM +  + +VS  N D  +K
Sbjct:  225 HDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTG---KCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWD---------PETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVS-GNADSTVK 450          

HSP 3 Score: 147.902 bits (372), Expect = 6.561e-37
Identity = 72/200 (36.00%), Postives = 120/200 (60.00%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNG---HRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTL 1419
            V C+   +K++VSG RD +++VWD  T +C+ VL GHV +V C+QYD   ++SG+ D  V+VW   + TC++T+  H   V  L+F    +V+ S D SI VWD+   + I     L GH++  + ++     +VS + D T+K+W+ ++ + L T+ G   H+  + CLQ+  N V++ S D T++LW ++TG  +R L
Sbjct:  310 VRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIH---TLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 506          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 207.994 bits (528), Expect = 8.705e-56
Identity = 115/309 (37.22%), Postives = 171/309 (55.34%), Query Frame = 1
Query:  754 RIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG 1671
            RI  NW  G     K+         + CLQ+   +IVSG  DN++KVW A T +C+R L GH G V   Q   N+IISGS+D T++VW+  +  C++T+Y H   V  +      +V+ S+D ++ VWD+     +    VL+GH AAV  V +D + +VS + D  +KVW+ ++   LHT+ GH   +  LQ+    VVSGS D +IR+W +ETG C+ TL GH+ L   +      +VSG  D  +K+WD+             CLQTL   ++H   V  LQF++  +++SS D T+ +WD L TG
Sbjct:  431 RIDTNWRRGDLKSPKV-LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLH---VLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDI---------KTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWD-LKTG 725          

HSP 2 Score: 161.77 bits (408), Expect = 1.243e-40
Identity = 91/234 (38.89%), Postives = 124/234 (52.99%), Query Frame = 1
Query: 1054 HHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLD-------TGVVSQDSGMNMVRSPVVSLDND 1734
            H    +  L+F  + +V+ S D ++ VW        +  R LVGH   V      +  I+S S DRT+KVWN ++ E +HT+ GH   + C+      VVSGS D T+R+W IETG CL  L GH   VRC+++D + +VSGAYD  +KVWD         P    CL TL  HT RV+ LQFD   +VS S D +I +WD          TG  S  SGM +  + +VS + D
Sbjct:  450 HDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTG---KCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWD---------PETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD 671          

HSP 3 Score: 149.828 bits (377), Expect = 8.642e-37
Identity = 72/200 (36.00%), Postives = 120/200 (60.00%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNG---HRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTL 1419
            V C+   +K++VSG RD +++VWD  T +C+ VL GHV +V C+QYD   ++SG+ D  V+VW   + TC++T+  H   V  L+F    +V+ S D SI VWD+   + I     L GH++  + ++     +VS + D T+K+W+ ++ + L T+ G   H+  + CLQ+  N V++ S D T++LW ++TG  +R L
Sbjct:  535 VRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIH---TLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 731          
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Match: ENSORLT00000003546.2 (F-box/WD repeat-containing protein 7 [Source:NCBI gene;Acc:101171440])

HSP 1 Score: 202.986 bits (515), Expect = 1.558e-55
Identity = 135/404 (33.42%), Postives = 195/404 (48.27%), Query Frame = 1
Query:  637 NGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTL---NQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTG------VVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELN 1821
             G S    Y    S+      + P      +    +   RI+ NW  G    + +         + CLQ+    IVSG  DN++KVW A T +C++ LTGH G V C Q     +ISGS+D T+RVW   S  CV+T+Y H   V  +    + +V+ S+D ++ VW++   +  +   VL GH AAV  V +D + +VS   D  +KVW+ ++   LHT+ GH   +  LQ+    VVSGS D +IR+W  ETG C+ TL GH+ L   +      +VSG  D  ++VWD+            LCL TL   N+H   V  LQF    ++SSS D T+ +WD L TG      V  Q  G   V   V  +   D  +   A  GS N    ++ L  D++L 
Sbjct:  172 EGISESASYRRRESVRPSAAAVSP------WKSAYIRQHRIETNWRKGDTG-EPMVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAVTGKCLQTLTGHTGGVWCSQMAVATVISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHLHGNRVVSGSRDTTLRVWNV---TTGQCEHVLTGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELRDNILVSGNADSTVRVWDI---------RTGLCLHTLQGPNKHQSAVTCLQFCRGLVLSSSDDGTVKLWD-LRTGAWLRDVVALQSRGSGGV---VWRIKASDTRLVCAA--GSRNGTEETKLLIMDFDLE 550          
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Match: SMESG000052999.1 (SMESG000052999.1)

HSP 1 Score: 1310.82 bits (3391), Expect = 0.000e+0
Identity = 685/686 (99.85%), Postives = 685/686 (99.85%), Query Frame = 1
Query:   43 MFSSVNSSGDALECDNQDLIFSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKXXXXXXXXXXXXXXXXXXXXXXXXXXXGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVHDNYSMMTSNTSITIDPIGLSMHGNRTPXXXXXXXXXXXXXXXXXXXXXXXXYRRPRQTPPSKLPSADPRVRQSNDSLNESRLRPTFDNFLY 2100
            MFSSVNSSGDALECDNQDLIFSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKSGSDSSGIYVSSNLLSGLLVSPGSPNSGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVHDNYSMMTSNTSITIDPIGLSMHGNRTPN NSSASASNHNANRSSNNFNINSYRRPRQTPPSKLPSADPRVRQSNDSLNESRLRPTFDNFLY
Sbjct:    1 MFSSVNSSGDALECDNQDLIFSESFKKDQQNIESNFLKFTKDQQINLVQGLLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSLCAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIPGRHIHPKNPCSRMFKSGSDSSGIYVSSNLLSGLLVSPGSPNSGTDSYLNGTSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVHDNYSMMTSNTSITIDPIGLSMHGNRTPNTNSSASASNHNANRSSNNFNINSYRRPRQTPPSKLPSADPRVRQSNDSLNESRLRPTFDNFLY 686          
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Match: SMESG000011456.1 (SMESG000011456.1)

HSP 1 Score: 172.94 bits (437), Expect = 7.349e-46
Identity = 122/361 (33.80%), Postives = 184/361 (50.97%), Query Frame = 1
Query:  709 EYYRRLYPDIIVNIKRIQKNWLSGKYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLE--CVRVLTGHVGSVLCLQY----DNNV-------------------------IISGSSDSTVRVWSL------SSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQ--YRNNLVVSGSSDNTIRLWQIETGTCLRTL-----EGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            E Y++ Y        +I KNWL G+Y  +    H+     V+C+ + +++I+SG  D++IKVW+  T     V+ L GH  +V CLQ     D+ V                         ++SGS+D T+++W+L      SS  C  T+  H  +V  L+  H  +V+ S D S+ VW M       L R L GH+ A+  V +D   IVS S D+TIK+W     E L T++GH   +ACL   Y++N ++SGS DNT++ W I    C+RT+     EGH+ +VRC++ D    +SG+ D  IKVWD+          N   L T   H   V  LQF+   +VS S+D ++++WDF
Sbjct:  161 EEYKKQY--------QINKNWLKGRYKQRIFTGHTSV---VHCVVFSEQRIISGSADSTIKVWNLHTNAQWSVQTLPGHSEAVRCLQLLHCPDSPVNSTRSKLSNANEDLYFGLKCPRDVYLVSGSNDKTIKIWALAARNDWSSIICRATLTGHLNSVRCLQADHDKIVSGSYDGSLKVWCMATG---ELIRTLRGHQDAILCVQYDDSVIVSGSLDKTIKIWLFNG-ECLFTLHGHVDPVACLHLDYKHNRIISGSHDNTLKFWDIRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDI---------ENGTRLHTYQGHKDGVSCLQFNNEMLVSGSYDHSVILWDF 497          

HSP 2 Score: 148.288 bits (373), Expect = 1.630e-37
Identity = 83/237 (35.02%), Postives = 139/237 (58.65%), Query Frame = 1
Query:  850 DKKIVSGLRDNSIKVW------DARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKN--IVSASGDRTIKVWNTQSCEFLHTMN-----GHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAA 1521
            D  +VSG  D +IK+W      D  ++ C   LTGH+ SV CLQ D++ I+SGS D +++VW +++   + T+  H +A+L +++  S++V+ S D++I +W         L     GH   V  +  D K+  I+S S D T+K W+ ++ + + T++     GH+R + CLQ      +SGS D TI++W IE GT L T +GH++ V C++F+++ +VSG+YD  + +WD  A 
Sbjct:  268 DVYLVSGSNDKTIKIWALAARNDWSSIICRATLTGHLNSVRCLQADHDKIVSGSYDGSLKVWCMATGELIRTLRGHQDAILCVQYDDSVIVSGSLDKTIKIWLFNGECLFTLH----GHVDPVACLHLDYKHNRIISGSHDNTLKFWDIRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDIENGTRLHTYQGHKDGVSCLQFNNEMLVSGSYDHSVILWDFSAC 500          

HSP 3 Score: 95.5153 bits (236), Expect = 3.527e-20
Identity = 61/195 (31.28%), Postives = 98/195 (50.26%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCE--AVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRL---------RRVL---------------------------------VGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSC 1281
            V CLQ D  KIVSG  D S+KVW   T E +R L GH  ++LC+QYD++VI+SGS D T+++W L +  C+ T++ H +  A LHL + H+ +++ S D ++  WD+     IR          +RV+                                  GH+  V+ + F+ + +VS S D ++ +W+  +C
Sbjct:  307 VRCLQADHDKIVSGSYDGSLKVWCMATGELIRTLRGHQDAILCVQYDDSVIVSGSLDKTIKIW-LFNGECLFTLHGHVDPVACLHLDYKHNRIISGSHDNTLKFWDIRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDIENGTRLHTYQGHKDGVSCLQFNNEMLVSGSYDHSVILWDFSAC 500          
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Match: SMESG000001039.1 (SMESG000001039.1)

HSP 1 Score: 119.783 bits (299), Expect = 1.440e-28
Identity = 80/298 (26.85%), Postives = 131/298 (43.96%), Query Frame = 1
Query:  829 VYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRF------------------AHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQ--KNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDL-VAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDF 1659
            + C+   D  IVSG  D +I++WD  + E V +L GH   V  L   +  I S S D T+R+WS  + + +     H   V  + F                  + S+L++ S D +  +W +      R      GH+ A+  +  D   K +V+ S D T++ W+  + E LH   GH+  + C+   N ++ SGSSD+T+R W I+ G   R   GH+  V  +R     + +   DG  + +D    AL           +    H   +   Q  + ++ + SHD T+ IWD 
Sbjct:   70 INCVAMQDNYIVSGSADKTIRIWDVTSFEEVALLKGHSSLVNRLILSDEYIFSSSYDRTIRLWSFINGSFIKEFRGHSRGVYPMIFISSDTKSSNSYDRSTTYASRSLLLSGSADFTAKLWSLDTG---RCLFTFKGHQGAITCMGTDAVAKYLVTGSTDFTVRSWSIATGESLHIFEGHKGAVICMNISNKIIYSGSSDHTVRAWVIDGGNSTRVYRGHQHTVSSVRAVKGLLFTSCGDGVARCFDAKTGALK----------RIFKGHCSNINAFQIIDNRLYTVSHDTTLRIWDL 354          

HSP 2 Score: 115.931 bits (289), Expect = 2.750e-27
Identity = 82/292 (28.08%), Postives = 138/292 (47.26%), Query Frame = 1
Query:  841 QYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWT-CVNTIYHHCEAVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQY------------------RNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFD--SKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIW 1653
            + DDK ++S      IK   A  + C+           C   D++VI++GS D T+RVWS   +  C+     H + +  +    + +V+ S D++I +WD+ +  ++ L   L GH + VN +    + I S+S DRTI++W+  +  F+    GH RG+  + +                    +L++SGS+D T +LW ++TG CL T +GH+  + C+  D  +KY+V+G+ D  ++ W         S A    L     H G V  +      I S S D T+  W
Sbjct:   10 EEDDKYVIS------IKYDHASGINCI-----------CTSADHSVIVTGSEDRTIRVWSTVDYCECLGICIGHEDYINCVAMQDNYIVSGSADKTIRIWDVTSFEEVAL---LKGHSSLVNRLILSDEYIFSSSYDRTIRLWSFINGSFIKEFRGHSRGVYPMIFISSDTKSSNSYDRSTTYASRSLLLSGSADFTAKLWSLDTGRCLFTFKGHQGAITCMGTDAVAKYLVTGSTDFTVRSW---------SIATGESLHIFEGHKGAVICMNISNKIIYSGSSDHTVRAW 272          
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 112.464 bits (280), Expect = 5.047e-27
Identity = 82/296 (27.70%), Postives = 143/296 (48.31%), Query Frame = 1
Query:  829 VYCLQYD---DKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYD--NNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHS----ILVTCSKDRSIAVWDMFAPSDIRLRRV--LVGHRAAVN--VVDFDQKNIVSASGDRTIKVWNTQ-SCEFLHTMNGHRRGIACLQYRN--NLVVSGSSDNTIRLWQIETGTCLR-TLEGHEELVRCIRFDSK--YIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQF--DEFQIVSSSHDDTILIW 1653
            VY + Y+     KIV+G  D + K+W A          GH   V+C+Q++  + ++ +G  D+   +W + S  CV+ +  H   V+ L+F  +     L+T S D ++ +WD+        RRV  L+GH A ++  V +FD   + +AS D++IK+W+ +     L T+ GH   +  + + N    V S  +DNT+RLW ++  +      +GHE  V  + F+ +   ++S + D   + W+               +Q L  HT  +F   F  D  +I++ S D+T  IW
Sbjct:   15 VYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNG-----RRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN---------TTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 296          

HSP 2 Score: 81.2629 bits (199), Expect = 1.910e-16
Identity = 55/199 (27.64%), Postives = 92/199 (46.23%), Query Frame = 1
Query: 1099 LVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASG--DRTIKVWNTQSCEFLHTMNGHRRGIACLQY----RNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRC--IRFDSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEF--QIVSSSHDDTILIWDFLD 1665
            +VT S D++  +W   + +D  L     GH A V  V F+  + +  +G  D    +W+ +S + +  + GH   +  LQ+        +++GS D+T+ LW +  G  +  L GH+  +      FD  Y+ + + D  IK+WDL              L TL  HT  V  + FD    Q+ S+  D+T+ +WD  D
Sbjct:   28 IVTGSFDKTAKMW---SANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARD--------LFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKD 215          

HSP 3 Score: 78.5666 bits (192), Expect = 1.530e-15
Identity = 47/172 (27.33%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 1177 LVGHRAAVNVVDFD---QKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF----DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFR--LQFDEFQIVSSSHDDTILIWDF 1659
            L GH+  V  + ++      IV+ S D+T K+W+       HT  GH   + C+Q+   + LV +G  D    LW +E+G C+  L+GH   V  ++F    + K++++G++D  + +WD+          N   +  L  H   +      FD   + ++S D +I IWD 
Sbjct:    8 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDV---------HNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDL 170          

HSP 4 Score: 78.5666 bits (192), Expect = 1.530e-15
Identity = 61/240 (25.42%), Postives = 103/240 (42.92%), Query Frame = 1
Query:  829 VYCLQYDDKKIV--SGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQY----DNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLH--LRFAHSILVTCSKDRSIAVWDM--------------------------------FAPSDIRL---------RRVLVGHRAAVNVVDFDQKNIV--SASGDRTIKVWNTQSCEFLHTMNGHRRGI--ACLQYRNNLVVSGSSDNTIRLWQ 1389
            V C+Q++    +  +G  D    +WD  + +CV  L GH   V+ LQ+    +   +I+GS D TV +W + +   V+ +  H   +      F  + + T S D+SI +WD+                                 A + +RL           +  GH A V+ V F+ +  V  SAS D++ + WNT + + +  + GH   I      Y  + +++GS DNT R+WQ
Sbjct:   58 VVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 297          

HSP 5 Score: 66.2402 bits (160), Expect = 2.434e-11
Identity = 42/153 (27.45%), Postives = 72/153 (47.06%), Query Frame = 1
Query: 1288 LHTMNGHRRGIACLQYR---NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFD--SKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQ----IVSSSHDDTILIWDFLDTGVVSQDSGMNMVRSPVV 1719
            L T+ GH+  +  + Y    ++ +V+GS D T ++W    G+   T +GH   V C++F+  S  + +G  D    +WD+          +  C+  L  HT  V  LQF +      +++ S D T+++WD  +   VSQ  G +   S  V
Sbjct:    5 LFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDV---------ESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV 148          
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.520e-24
Identity = 74/258 (28.68%), Postives = 125/258 (48.45%), Query Frame = 1
Query:  928 LTGHVGSVLCLQYDNNV--IISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHS--ILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDF--DQKNIVSASGDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNN--LVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTGRVFRLQFDEFQ--IVSSSHDDTILIWDFLD 1665
              GH   V C+ ++ N   + SG  DS + +W+    T       H +A+L ++F+ +  ++ + S+D+++ +W    PS      V   H A V  VD   D   +V+ S D+TIKVW     +F +++N H+  + C+++ ++  L+ S S D TI+LW      C+ T + H   V  + F  +  YI SG  D  + +WD+          N L LQ    HT  V  + F      ++SSS D ++ I+D L+
Sbjct:   10 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW---VPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR--------MNKL-LQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLE 255          

HSP 2 Score: 62.7734 bits (151), Expect = 6.602e-10
Identity = 52/175 (29.71%), Postives = 74/175 (42.29%), Query Frame = 1
Query: 1156 DIRLRRVLVGHRAAVNVVDFDQKNIVSASG--DRTIKVWNTQSCEFLHTMNGHRRGIACLQYR--NNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQHTG--RVFRLQFDEFQIVSSSHDDTILIWD 1656
            D +L+    GH+  V  VDF+  +   ASG  D  + +WN +     +   GH   I  +++     LV S S D T+RLW             H   VR +    D+  +V+G+ D  IKVW +                +LN+H    R  R   D   I SSS D TI +WD
Sbjct:    3 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKM---------HRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 168          

HSP 3 Score: 56.9954 bits (136), Expect = 4.998e-8
Identity = 43/154 (27.92%), Postives = 68/154 (44.16%), Query Frame = 1
Query:  829 VYCLQY--DDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNN--VIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHS--ILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSASG--DRTIKVW 1266
            V C+++  D + I S   D +IK+WD    EC+     H G V  L +  N   I SG +DS V +W +     +     H   V  + F  S   L++ S D S+ ++D+    + RL   + GH   +    F     + ASG  D  + +W
Sbjct:  143 VRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLL---EGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          
The following BLAST results are available for this feature:
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTRC0.000e+060.65beta-transducin repeat containing E3 ubiquitin pro... [more]
BTRC0.000e+060.08beta-transducin repeat containing E3 ubiquitin pro... [more]
BTRC0.000e+060.08beta-transducin repeat containing E3 ubiquitin pro... [more]
FBXW110.000e+055.68F-box and WD repeat domain containing 11 [Source:H... [more]
FBXW113.425e-17372.46F-box and WD repeat domain containing 11 [Source:H... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-230.000e+053.07F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-230.000e+053.07F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-230.000e+053.07F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-230.000e+053.07F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-230.000e+055.42F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slmb7.879e-17274.84gene:FBgn0283468 transcript:FBtr0084032[more]
slmb7.879e-17274.84gene:FBgn0283468 transcript:FBtr0333931[more]
slmb9.962e-17174.84gene:FBgn0283468 transcript:FBtr0330049[more]
ago3.172e-5539.06gene:FBgn0041171 transcript:FBtr0073246[more]
ago3.172e-5539.06gene:FBgn0041171 transcript:FBtr0073245[more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11b8.872e-1856.24F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b9.850e-1856.24F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b8.872e-1856.24F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b9.993e-1856.24F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b9.627e-1856.24F-box and WD repeat domain containing 11b [Source:... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btrc0.000e+058.29beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc0.000e+058.29beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc0.000e+058.29beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc0.000e+058.29beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc0.000e+058.29beta-transducin repeat containing E3 ubiquitin pro... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btrc0.000e+060.84beta-transducin repeat containing protein [Source:... [more]
Btrc0.000e+060.84beta-transducin repeat containing protein [Source:... [more]
Btrc0.000e+060.84beta-transducin repeat containing protein [Source:... [more]
Fbxw110.000e+055.68F-box and WD-40 domain protein 11 [Source:MGI Symb... [more]
Fbxw110.000e+055.68F-box and WD-40 domain protein 11 [Source:MGI Symb... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ULA2|FBW1A_MOUSE0.000e+060.84F-box/WD repeat-containing protein 1A OS=Mus muscu... [more]
sp|Q9Y297|FBW1A_HUMAN0.000e+060.08F-box/WD repeat-containing protein 1A OS=Homo sapi... [more]
sp|Q91854|TRCB_XENLA0.000e+059.50Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 ... [more]
sp|Q9UKB1|FBW1B_HUMAN0.000e+055.68F-box/WD repeat-containing protein 11 OS=Homo sapi... [more]
sp|Q5SRY7|FBW1B_MOUSE0.000e+055.68F-box/WD repeat-containing protein 11 OS=Mus muscu... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D5PQA90.000e+059.78Beta-transducin repeat containing E3 ubiquitin pro... [more]
A0A1D5PSH90.000e+059.78Beta-transducin repeat containing E3 ubiquitin pro... [more]
A0A1D5NTM30.000e+059.78Beta-transducin repeat containing E3 ubiquitin pro... [more]
F1NYG10.000e+059.78Beta-transducin repeat containing E3 ubiquitin pro... [more]
A0A3Q2TWQ20.000e+059.78Beta-transducin repeat containing E3 ubiquitin pro... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11a1.071e-1756.61F-box/WD repeat-containing protein 11 [Source:NCBI... [more]
fbxw11a9.451e-1856.61F-box/WD repeat-containing protein 11 [Source:NCBI... [more]
fbxw11b1.821e-1756.16F-box/WD repeat-containing protein 11-like [Source... [more]
fbxw11b8.248e-14348.55F-box/WD repeat-containing protein 11-like [Source... [more]
fbxw72.008e-5734.32F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTRC3.992e-15869.35beta-transducin repeat containing E3 ubiquitin pro... [more]
ENSPMAT00000008862.11.370e-6036.44pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
pafah1b1b1.793e-3029.19platelet-activating factor acetylhydrolase 1b, reg... [more]
plrg14.566e-2326.24pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
POC1A1.520e-2228.08POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MET304.383e-3129.45F-box protein containing five copies of the WD40 m... [more]
CDC49.778e-3028.86F-box protein required for both the G1/S and G2/M ... [more]
MDV13.520e-2525.59Peripheral protein of cytosolic face of mitochondr... [more]
RSA44.759e-2327.82WD-repeat protein involved in ribosome biogenesis;... [more]
CAF49.853e-2223.80WD40 repeat-containing protein associated with the... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO487200.000e+061.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423066.334e-5735.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390724.367e-5536.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440938.730e-5135.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321981.644e-3327.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11a8.461e-1856.24F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw11a7.877e-1856.24F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw71.833e-5637.22F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw78.705e-5637.22F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSORLT00000003546.21.558e-5533.42F-box/WD repeat-containing protein 7 [Source:NCBI ... [more]
back to top
BLAST of F-box/WD repeat-containing protein 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052999.10.000e+099.85SMESG000052999.1[more]
SMESG000011456.17.349e-4633.80SMESG000011456.1[more]
SMESG000001039.11.440e-2826.85SMESG000001039.1[more]
SMESG000008519.15.047e-2727.70SMESG000008519.1[more]
SMESG000024482.11.520e-2428.68SMESG000024482.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010327 ID=SMED30010327|Name=F-box/WD repeat-containing protein 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=2795bp
AAAAAAGTGGATGAGACAATGACTTTATAAACACAACAATTAATGTTTTC
ATCTGTAAATTCTAGTGGAGACGCTTTAGAATGTGATAATCAAGATTTAA
TTTTTTCCGAAAGCTTCAAAAAAGATCAGCAAAATATTGAGTCAAATTTT
CTCAAATTTACCAAGGATCAGCAAATAAACTTGGTCCAAGGATTATTAAA
ACATATGTCTCATTATCAACACGGGCAAATCGATGCCTACCTCAAACCTA
TGCTTCAAAGGGATTTCATCACAGATTTACCCGCTAAAGGTTTATTTCAA
GTATCTGAACAGATTTTGTCATATCTCGACGCAAAATCCCTTTGCGCTGC
AAACCAAGTCAGTCACAGCTGGAGACAAGTTATTAGAGAAGGTTATCTAT
GGAAAAAATTAATAGAACACATGGTAATCACTGATCCACTGTGGCGTGGT
CTTGGTGAACGTTGTGGTTGGATCACAAAGTTACGAATTCCCGGTCGACA
CATTCATCCGAAAAATCCCTGCAGTCGCATGTTTAAAAGCGGATCAGACT
CCAGTGGAATTTATGTTTCCAGCAATTTACTCAGTGGATTACTCGTGTCA
CCCGGATCACCGAATTCCGGCACAGATTCCTATTTAAATGGCACCAGTGT
TCCCGAGGAGTATATGAATGAAAATTCAATAATTTCCGGGTACGAATTGA
TGGATCCAGAATATTATCGCCGACTGTATCCAGATATTATAGTAAACATC
AAGAGAATTCAGAAAAACTGGCTAAGTGGTAAATATAATCTGAAAAAGAT
CGAATGCCACAGTGAATCCAGTAAAGGTGTTTATTGCCTCCAATACGATG
ACAAGAAAATCGTCAGTGGGCTCAGAGATAACAGTATCAAGGTCTGGGAT
GCAAGAACCTTGGAATGTGTGCGAGTATTGACAGGCCATGTTGGCAGTGT
CCTCTGTCTACAATACGATAATAATGTGATCATAAGTGGTTCTAGCGATT
CTACCGTGAGAGTTTGGAGTCTTTCTTCATGGACATGTGTAAATACAATC
TACCACCACTGTGAAGCTGTTCTGCATTTGCGATTCGCCCATAGTATTCT
TGTCACTTGTTCAAAAGATCGTAGCATTGCAGTTTGGGATATGTTTGCTC
CAAGTGATATTCGTCTACGAAGGGTTTTAGTTGGCCATCGAGCAGCTGTG
AATGTTGTAGATTTTGATCAAAAAAATATTGTTTCTGCTAGTGGGGATCG
AACCATAAAGGTTTGGAATACCCAATCTTGCGAATTCCTCCACACAATGA
ATGGCCATAGACGGGGTATAGCATGCCTACAATACCGGAACAATTTAGTT
GTATCCGGTAGCTCGGACAACACTATCAGACTGTGGCAAATTGAAACTGG
GACATGTTTGCGTACATTAGAAGGCCATGAAGAATTAGTGAGGTGTATTA
GATTCGATTCAAAATATATTGTTTCCGGGGCCTATGACGGGAAAATTAAA
GTTTGGGATCTCGTCGCAGCTCTAAATCCCCAAAGTCCTGCAAATAGTCT
GTGTCTACAGACATTGAATCAGCATACCGGCCGAGTGTTTCGATTGCAAT
TCGATGAGTTCCAGATAGTGTCAAGTTCACACGACGATACGATTCTTATT
TGGGATTTTCTCGATACCGGTGTTGTCAGTCAGGACTCTGGCATGAATAT
GGTTCGAAGTCCCGTAGTTAGTCTTGATAATGATGATGAACCAATAAAAC
CCGGTGCAGAGCAAGGCTCAATCAATAATGCATCAACTAGTCAAAATTTA
CCTTTCGATTATGAATTGAATGTCCATGATAACTATTCAATGATGACGAG
TAACACAAGTATTACCATTGATCCAATCGGACTCAGTATGCATGGCAACC
GAACTCCAAACGCCAATAGCAGTGCTAGTGCTAGTAATCACAACGCTAAC
AGATCGTCCAATAACTTTAACATAAACAGTTACAGAAGACCCCGACAAAC
GCCGCCTTCCAAACTTCCTTCTGCAGATCCTCGAGTTCGACAAAGCAATG
ATTCACTCAACGAATCTCGACTCAGGCCAACTTTTGACAACTTTCTTTAC
GACAGCAGCCATACTAGTGTAACATCAGATCACGACGATATCCAAGGCCA
AGATCAGCAAGACAATAATGATCACGATCACATAAGATCTTCTCGCCGAT
TTTCGTAACGAATTCTAAAACATAAAAAAAATAAAAAATAAAAATCGTCT
TTGAAAGTTTTCCTGGAGAAATAAAATAATCAATTTTTCAAGTCTTGCAA
AAATATCGATAATAAAAATAAATCGTCTGTTTTTTCTTTTTATTTTTAAC
TTTCGGATGATGATGATGATGATGCTGGTGATGCTGATGTTACTGTTGGC
GATGATAATGCAAATATTAATATATATTATCAGAGGTTGCACCCTATTTT
TATTGATTTCTCGAACTTCGCTATTGATTTTTTATTATTGATTTTCGTTG
TTTTTTGGCCGAACAATTTCAATGTTATAAATGTGTGTGTGTGTAAAAGT
TAACATTTTGCCCGTGTTTGTGATTATTGTATTCTGAGAAATTTGTAAAC
TTTTTTTGCTGATGAATTGTCAGTAGTAGAAATTGCGATGCCGGAATTTT
GGGAGACGTCAAATTGATACTTGTGAAAAACTAAATCAAAATAATACAAT
GCTAGTATTTGCAAATTGTTTTTATACAGGTTTCTTTTTCGATTTTATAA
CTTTGAAATTAAACTTGAAAACAATCAATTTTTTATTAAATAAAG
back to top

protein sequence of SMED30010327-orf-1

>SMED30010327-orf-1 ID=SMED30010327-orf-1|Name=SMED30010327-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=722bp
MFSSVNSSGDALECDNQDLIFSESFKKDQQNIESNFLKFTKDQQINLVQG
LLKHMSHYQHGQIDAYLKPMLQRDFITDLPAKGLFQVSEQILSYLDAKSL
CAANQVSHSWRQVIREGYLWKKLIEHMVITDPLWRGLGERCGWITKLRIP
GRHIHPKNPCSRMFKSGSDSSGIYVSSNLLSGLLVSPGSPNSGTDSYLNG
TSVPEEYMNENSIISGYELMDPEYYRRLYPDIIVNIKRIQKNWLSGKYNL
KKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHV
GSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAH
SILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVSAS
GDRTIKVWNTQSCEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQI
ETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDLVAALNPQSPA
NSLCLQTLNQHTGRVFRLQFDEFQIVSSSHDDTILIWDFLDTGVVSQDSG
MNMVRSPVVSLDNDDEPIKPGAEQGSINNASTSQNLPFDYELNVHDNYSM
MTSNTSITIDPIGLSMHGNRTPNANSSASASNHNANRSSNNFNINSYRRP
RQTPPSKLPSADPRVRQSNDSLNESRLRPTFDNFLYDSSHTSVTSDHDDI
QGQDQQDNNDHDHIRSSRRFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036047F-box-like_dom_sf
IPR036322WD40_repeat_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR020472G-protein_beta_WD-40_rep
IPR021977Beta-TrCP_D
IPR001810F-box_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0005515protein binding
GO:0045309protein phosphorylated amino acid binding
GO:0061630ubiquitin protein ligase activity
GO:0004842ubiquitin-protein transferase activity
GO:0008013beta-catenin binding
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043433negative regulation of sequence-specific DNA binding transcription factor activity
GO:0045862positive regulation of proteolysis
GO:0045879negative regulation of smoothened signaling pathway
GO:0045892negative regulation of transcription, DNA-templated
GO:0045893positive regulation of transcription, DNA-templated
GO:0048511rhythmic process
GO:0050852T cell receptor signaling pathway
GO:0051403stress-activated MAPK cascade
GO:0051437positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051726regulation of cell cycle
GO:0060444branching involved in mammary gland duct morphogenesis
GO:0060828regulation of canonical Wnt signaling pathway
GO:0061136regulation of proteasomal protein catabolic process
GO:0071407cellular response to organic cyclic compound
GO:0000086G2/M transition of mitotic cell cycle
GO:0000209protein polyubiquitination
GO:0002223stimulatory C-type lectin receptor signaling pathway
GO:0006470protein dephosphorylation
GO:0006511ubiquitin-dependent protein catabolic process
GO:0007165signal transduction
GO:0016032viral process
GO:0016055Wnt signaling pathway
GO:0016567protein ubiquitination
GO:0030163protein catabolic process
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0031648protein destabilization
GO:0033598mammary gland epithelial cell proliferation
GO:0038061NIK/NF-kappaB signaling
GO:0038095Fc-epsilon receptor signaling pathway
GO:0042752regulation of circadian rhythm
GO:0042753positive regulation of circadian rhythm
GO:0043122regulation of I-kappaB kinase/NF-kappaB signaling
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0019005SCF ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 476..490
score: 39.13
coord: 313..327
score: 37.84
coord: 436..450
score: 40.06
IPR021977D domain of beta-TrCPSMARTSM01028Beta-TrCP_D_2coord: 33..72
e-value: 1.1E-11
score: 54.8
IPR021977D domain of beta-TrCPPFAMPF12125Beta-TrCP_Dcoord: 36..72
e-value: 2.0E-15
score: 56.4
IPR001810F-box domainSMARTSM00256fbox_2coord: 84..123
e-value: 2.4E-5
score: 33.7
IPR001810F-box domainPFAMPF12937F-box-likecoord: 87..123
e-value: 6.7E-8
score: 32.3
IPR001810F-box domainPROSITEPS50181FBOXcoord: 86..123
score: 8.703
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 246..286
e-value: 0.076
score: 22.1
coord: 412..449
e-value: 1.1E-5
score: 34.9
coord: 289..326
e-value: 2.6E-8
score: 43.6
coord: 329..366
e-value: 3.0E-5
score: 33.4
coord: 372..409
e-value: 8.2E-6
score: 35.3
coord: 501..538
e-value: 1.4E-4
score: 31.2
coord: 452..489
e-value: 4.6E-9
score: 46.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 415..448
e-value: 5.0E-4
score: 20.8
coord: 453..489
e-value: 4.4E-7
score: 30.5
coord: 291..326
e-value: 1.1E-6
score: 29.2
coord: 376..409
e-value: 0.003
score: 18.4
coord: 249..286
e-value: 0.012
score: 16.4
coord: 504..538
e-value: 0.067
score: 14.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 379..418
score: 12.781
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 296..335
score: 13.75
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 419..458
score: 14.452
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 336..367
score: 9.472
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 508..538
score: 10.107
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 269..295
score: 9.573
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 459..490
score: 13.516
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 73..164
e-value: 3.4E-26
score: 93.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 622..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 692..721
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 662..679
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 622..679
NoneNo IPR availablePANTHERPTHR44156FAMILY NOT NAMEDcoord: 223..547
coord: 16..145
NoneNo IPR availablePANTHERPTHR44156:SF2F-BOX/WD REPEAT-CONTAINING PROTEIN 1Acoord: 223..547
coord: 16..145
NoneNo IPR availableCDDcd00200WD40coord: 260..538
e-value: 3.15118E-74
score: 239.929
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 243..537
e-value: 2.5E-103
score: 346.8
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 273..287
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 476..490
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 353..367
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 396..410
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 525..539
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 256..547
score: 58.688
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 68..152
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 248..538