Radial spoke head 10-like protein B2

Overview
NameRadial spoke head 10-like protein B2
Smed IDSMED30010320
Length (bp)2721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Radial spoke head 10-like protein B2 (SMED30010320) t-SNE clustered cells

Violin plots show distribution of expression levels for Radial spoke head 10-like protein B2 (SMED30010320) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Radial spoke head 10-like protein B2 (SMED30010320) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Radial spoke head 10-like protein B2 (SMED30010320) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010320

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010320SMESG000039156.1 SMESG000039153.1 SmedASXL_012742SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010320SMESG000039156.1 SMESG000039153.1 dd_Smed_v4_12762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010320SMESG000039156.1 SMESG000039153.1 dd_Smed_v4_12762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010320SMESG000039156.1 SMESG000039153.1 dd_Smed_v4_12762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010320SMESG000039156.1 SMESG000039153.1 dd_Smed_v6_12762_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010320SMESG000039156.1 SMESG000039153.1 dd_Smed_v4_12762_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 435.261 bits (1118), Expect = 2.829e-138
Identity = 238/552 (43.12%), Postives = 343/552 (62.14%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P AC + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNACQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 435.261 bits (1118), Expect = 2.829e-138
Identity = 238/552 (43.12%), Postives = 343/552 (62.14%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P AC + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNACQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 435.261 bits (1118), Expect = 2.829e-138
Identity = 238/552 (43.12%), Postives = 343/552 (62.14%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P AC + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNACQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Match: RSPH10B (radial spoke head 10 homolog B [Source:HGNC Symbol;Acc:HGNC:27362])

HSP 1 Score: 430.254 bits (1105), Expect = 2.737e-136
Identity = 237/552 (42.93%), Postives = 342/552 (61.96%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P A  + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNAFQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Match: RSPH10B (radial spoke head 10 homolog B [Source:HGNC Symbol;Acc:HGNC:27362])

HSP 1 Score: 430.254 bits (1105), Expect = 2.737e-136
Identity = 237/552 (42.93%), Postives = 342/552 (61.96%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P A  + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNAFQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 63.1586 bits (152), Expect = 7.624e-10
Identity = 50/152 (32.89%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  320 GRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYN-EISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK 772
            GRF+      F +G  + G + EG  HG G          Y G + Y  E+SG   YTW  G++Y+G   +G RHG GI +     +Y G W  G + G   V    + ++ Y+G W+    +G+G   Y    +Y+G+W +G RHG+G+ K
Sbjct:    4 GRFD------FDDGGTYVGGWEEGKAHGHGVCTGPQAKGEYAGAWHYGFEVSGV--YTWPSGNTYQGQWQNGKRHGLGIEQR-GRWLYKGEWTQGYK-GRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYGIRK 145          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079861)

HSP 1 Score: 67.781 bits (164), Expect = 3.573e-11
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  305 GEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYN-EISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGV 766
            G  + GRF+      F +G  + G + EG  HG G         +Y G + Y  E+SG   Y W  GS YEG   +G RHG G+ +     +Y G W      G   V   T   + YEG WN+   +G G   Y  G  Y+G+W +GKRHG+G+
Sbjct:   45 GPINGGRFD------FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGV-EQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 2 Score: 52.373 bits (124), Expect = 2.481e-6
Identity = 41/142 (28.87%), Postives = 59/142 (41.55%), Query Frame = 2
Query:  704 YRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCF------------------------TYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +  G TY G W +GK HGHGV         Y G W  G +   G +IW     +GS Y      EG++ NG+RHG G                          +  S A YEG W    + G G   + +G  Y+G++++ +
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVS-GSYIW----PSGSHY------EGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGK 184          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079860)

HSP 1 Score: 67.781 bits (164), Expect = 3.573e-11
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  305 GEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYN-EISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGV 766
            G  + GRF+      F +G  + G + EG  HG G         +Y G + Y  E+SG   Y W  GS YEG   +G RHG G+ +     +Y G W      G   V   T   + YEG WN+   +G G   Y  G  Y+G+W +GKRHG+G+
Sbjct:   45 GPINGGRFD------FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGV-EQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 2 Score: 52.373 bits (124), Expect = 2.481e-6
Identity = 41/142 (28.87%), Postives = 59/142 (41.55%), Query Frame = 2
Query:  704 YRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCF------------------------TYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +  G TY G W +GK HGHGV         Y G W  G +   G +IW     +GS Y      EG++ NG+RHG G                          +  S A YEG W    + G G   + +G  Y+G++++ +
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVS-GSYIW----PSGSHY------EGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGK 184          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304056)

HSP 1 Score: 67.781 bits (164), Expect = 3.573e-11
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  305 GEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYN-EISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGV 766
            G  + GRF+      F +G  + G + EG  HG G         +Y G + Y  E+SG   Y W  GS YEG   +G RHG G+ +     +Y G W      G   V   T   + YEG WN+   +G G   Y  G  Y+G+W +GKRHG+G+
Sbjct:   45 GPINGGRFD------FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGV-EQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 2 Score: 52.373 bits (124), Expect = 2.481e-6
Identity = 41/142 (28.87%), Postives = 59/142 (41.55%), Query Frame = 2
Query:  704 YRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCF------------------------TYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +  G TY G W +GK HGHGV         Y G W  G +   G +IW     +GS Y      EG++ NG+RHG G                          +  S A YEG W    + G G   + +G  Y+G++++ +
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVS-GSYIW----PSGSHY------EGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGK 184          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304057)

HSP 1 Score: 67.781 bits (164), Expect = 3.573e-11
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  305 GEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYN-EISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGV 766
            G  + GRF+      F +G  + G + EG  HG G         +Y G + Y  E+SG   Y W  GS YEG   +G RHG G+ +     +Y G W      G   V   T   + YEG WN+   +G G   Y  G  Y+G+W +GKRHG+G+
Sbjct:   45 GPINGGRFD------FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGV-EQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 2 Score: 52.373 bits (124), Expect = 2.481e-6
Identity = 41/142 (28.87%), Postives = 59/142 (41.55%), Query Frame = 2
Query:  704 YRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCF------------------------TYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +  G TY G W +GK HGHGV         Y G W  G +   G +IW     +GS Y      EG++ NG+RHG G                          +  S A YEG W    + G G   + +G  Y+G++++ +
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVS-GSYIW----PSGSHY------EGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGK 184          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Match: CG14490 (gene:FBgn0034281 transcript:FBtr0086801)

HSP 1 Score: 60.4622 bits (145), Expect = 5.580e-10
Identity = 48/136 (35.29%), Postives = 65/136 (47.79%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVM--KWLD-RNEQ-YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFE 1048
            Y+G W      GFG +Q  SG  YEG W +G+RHG G +  K LD R E+ Y GQWR   ++G G+            Y   +VY G++   +R G G      G  Y G W+ ++   KG      G  Y G+FE
Sbjct:   22 YQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQF----------YPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFE 147          

HSP 2 Score: 50.447 bits (119), Expect = 1.412e-6
Identity = 48/164 (29.27%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  500 GSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVN---YDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAH--YEGFW 976
            G  Y+G  +    HG G+ +  SG++Y G W  G RHG G++     D      Y G W +N   G G + Y  G+ Y G+W   +R G G++ W      Y G+W   +++ M +                N Y G+F  G + G G F + S       GFW
Sbjct:   19 GGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGIL-WQADGGIYVGEW---LRDKMHEKGLLFTATG-------NRYVGQFEGGCKSGSGVFYHASNGQRIQHGFW 171          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 349.747 bits (896), Expect = 1.346e-107
Identity = 200/551 (36.30%), Postives = 306/551 (55.54%), Query Frame = 2
Query:  266 LPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGM-MYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFIS--LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQF 1909
            +P L  +I+ERY+GEK    F G G A+F  G++++G F  G MHG G + W S    Y+GDF  N   G G YTW +GS+YEG+V  G+RHG G+YK    + +Y G W  G R G G + Y+ +  S+Y+G+W  N  EG+G R Y SGN YEG+W    RHG G M+W+D ++QY+GQW NG Q G G H W+ +R   SQY   N Y G+F    RHG G F Y SGA Y G W  ++K G+G ++F+NGR+YEGEF  D + EFP  +  L+G  +P  + + + +       N S   S    N  T         +L     A+ ++E  Q+  AVL H+G++R+I+ FYS+LG   S+D    +T +QF RFL DCR+H +   T+A++ R++          + +P + I     I+Y+I +AY++  +    D   S  +L  CF   M +N++P A +V G L+        AL++ ++    Y+    +   F       +R  ++M+K+L L ++ LT +++++  S+D P + D  +
Sbjct:   75 VPVLHSIIVERYEGEKCGEMFHGEGVAYFQGGHVYKGSFSHGLMHGYGEYIW-SDGLKYQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSKDCMAEFPAFTPGLSGITTPFPDENDSSKGASQSSSNASPLGSDMVLNIQT---------LLNRVSEAHREQEFKQVEFAVLRHMGLLREIYSFYSSLGHEQSLDKIFPLTHLQFSRFLLDCRVHQHG-VTLAQIYRLIN---------VHSPFTAILPRECISYIIIIAYHICHK----DIECSNNILAACFSKLMKQNIIPNAKSVKGHLFCHPVHAAVALNYSDKCWEIYQALCEAHSVF------TVRQLVLMLKDLCLYDNELTVSKLIRTLSVDSPAIHDGTY 595          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 348.977 bits (894), Expect = 2.542e-107
Identity = 199/551 (36.12%), Postives = 307/551 (55.72%), Query Frame = 2
Query:  266 LPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGM-MYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFIS--LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQF 1909
            +P L  +I+ERY+GEK    F G G A+F  G++++G F  G MHG G + W S    Y+GDF  N   G G YTW +GS+YEG+V  G+RHG G+YK    + +Y G W  G R G G + Y+ +  S+Y+G+W  N  EG+G R Y SGN YEG+W    RHG G M+W+D ++QY+GQW NG Q G G H W+ +R   SQY   N Y G+F    RHG G F Y SGA Y G W  ++K G+G ++F+NGR+YEGEF  D + EFP  +  L+G  +P  + + + +       N S   S    N  T         +L     A+ ++E  Q+  AVL H+G++R+I+ FYS+LG   S+D    +T +QF RFL DCR+H +   T+A++  ++          + +P + I     I+Y+I +AY++  ++  +  N    +L  CF   M +N++P A +V G L+        AL++ ++    Y+    +   F       +R F++M+K+L L ++ LT +++++  S+D P + D  +
Sbjct:   75 VPVLHSIIVERYEGEKCGEMFHGEGVAYFQGGHVYKGSFSHGLMHGYGEYIW-SDGLKYQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSKDCMAEFPAFTPGLSGITTPFPDENDSSKGASQSSSNASPLGSDMVLNIQT---------LLNRVSEAHREQEFKQVEFAVLRHMGLLREIYSFYSSLGHEQSLDKIFPLTHLQFSRFLLDCRVHQHG-VTLAQIYCLIN---------VHSPFTAILPRECISYIIIIAYHICHKDIESSNN----ILAACFSKLMKQNIIPNAKSVKGHLFCHPVHAAVALNYSDKCWEIYQALCEAHSVF------TVRQFVLMLKDLCLYDNELTVSKLIRTLSVDSPAIHDGTY 595          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 84.7297 bits (208), Expect = 3.974e-16
Identity = 65/208 (31.25%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  467 ISGKGKYTWQDGS-----SYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNG---TVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQ----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            IS    YT+   S      Y+G  V G  HGRG+ K P G MY+G + NG   G G     N   +    Y+G W    + GFG  +Y SG  YEG +    RHGHG+++    N      + GQW+   ++G G    +     G +Y       G + + +R G G      G +YEG + +N+  G G  + ++   +EGEF +D
Sbjct: 1060 ISRTASYTFYKDSRLKDAKYDGRWVSGKPHGRGVVKWPDGRMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGV---FDDITRGEKYM------GMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLED 1258          

HSP 2 Score: 77.411 bits (189), Expect = 6.378e-14
Identity = 50/167 (29.94%), Postives = 84/167 (50.30%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG-----FRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFT-YPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y G WV+G  HG G V +  D R  Y G +     +GFG      +   S + Y+G+W  GK HG G  ++    E Y G +++ +++G G  +    ++N +  S   V+ G++   K+ G+G F     G  Y G W+ +++ G G  V + G  YEG F ++++
Sbjct: 1079 YDGRWVSGKPHGRGVVKW-PDGR-MYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYAS-GEVYEGSFQDNMRHGHG--MLRSGKLNSTSPS---VFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKM 1237          

HSP 3 Score: 60.4622 bits (145), Expect = 9.700e-9
Identity = 45/181 (24.86%), Postives = 78/181 (43.09%), Query Frame = 2
Query:  293 ERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQG-KRHGHGVMKWLDRNE---QYTGQWRNGIQ 823
            + Y G+  +G+  G GT  + +G ++EG F +   HG G       N++    F+     G+ +Y  + G     D+               G  Y G+W++  R GNG V   T    +YEG ++ N + G G        T+EGE+ +    +G GV+   + +     + G W  G++
Sbjct: 1128 DHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFI-----GQWQYDKKSGYGVFDDIT-------------RGEKYMGMWLDDQRQGNGVVV--TQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKGVLTMPNGDYIEGSFCGVWGTGLK 1288          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Match: als2a (alsin Rho guanine nucleotide exchange factor ALS2 a [Source:ZFIN;Acc:ZDB-GENE-070402-2])

HSP 1 Score: 83.5741 bits (205), Expect = 8.439e-16
Identity = 61/218 (27.98%), Postives = 93/218 (42.66%), Query Frame = 2
Query:  431 NTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSF-----YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK-----WLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            +  YEG +L  +  GKG   W                       P G MY G + +G   G G  ++ T   +F     Y+G W +  + GFG   Y SG  YEG + +  RHGHG+++         +  + GQW  G + G G             +S    Y G + + +RHG G      G +YEG + +NR  G G  +  +  ++EG+F+DD
Sbjct: 1055 DAKYEGRWLSGKPHGKGNLKW-----------------------PDGTMYCGTFKSGLEDGFG--DFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGV---------CDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRMMGNGTLLCDDDTVFEGDFQDD 1238          

HSP 2 Score: 74.3294 bits (181), Expect = 5.400e-13
Identity = 48/167 (28.74%), Postives = 80/167 (47.90%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG-----FRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWG-CFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y G W++G  HG G + +     + Y G +   + +GFG        +     Y+G W +GK HG G   W    E Y G +R  +++G G     ++    +  S  +V+ G++  GKR G+G C  +  G  Y G W  +++ G G  + + G  YEG F ++R+
Sbjct: 1058 YEGRWLSGKPHGKGNLKWPDG--TMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTF-WYASGEVYEGSFRENMRHGHG----MLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRM 1217          

HSP 3 Score: 51.6026 bits (122), Expect = 4.979e-6
Identity = 49/172 (28.49%), Postives = 81/172 (47.09%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHG-----TGRFNWKSTNTSYEGDFLYNEISGKGKY-TWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKN-VIEGFGFRQYRSGNT----YEGEWYQGKR 751
            P+ T    ERY G    G+  G GT ++ +G ++EG F E   HG     +G+    S+++ + G ++  + +G G    +  G  Y G      RHG G+     G+ Y G + N    GNGT+  D D  + +EGD+  +  + G G     +G++    ++G W  G R
Sbjct: 1099 PSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRMMGNGTLLCDDD--TVFEGDFQDDWTLCGKGILFMPNGDSFDGVFDGHWGSGLR 1268          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Match: BX571704.1 (alsin Rho guanine nucleotide exchange factor ALS2 a [Source:NCBI gene;Acc:557014])

HSP 1 Score: 83.5741 bits (205), Expect = 1.002e-15
Identity = 69/218 (31.65%), Postives = 98/218 (44.95%), Query Frame = 2
Query:  431 NTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-----YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQY------RSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKF-GKGEFVFKNGRIYEGEFE 1048
            +  YEG +L  +  GKG   W DG+ Y G    G+  G G +  PS        Y G W  G  HG GT  Y + +   YEG + +N+  G G  +        S + + G+W QGKR G+GV     R E+Y G W +  ++G G  I        +Q+ L   YEG FCN +  G G         +EG +  +    GKG     NG  ++G F+
Sbjct: 1016 DAKYEGRWLSGKPHGKGNLKWPDGTMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGE--VYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVI--------TQFGL--YYEGNFCNNRMMGNGTLLCDDDTVFEGDFQDDWTLCGKGILFMPNGDSFDGVFD 1221          

HSP 2 Score: 74.3294 bits (181), Expect = 5.280e-13
Identity = 60/239 (25.10%), Postives = 91/239 (38.08%), Query Frame = 2
Query:  368 FEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSF-----YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK-----WLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            +EG +  G  HG G   W                                               P G MY G + +G   G G  ++ T   +F     Y+G W +  + GFG   Y SG  YEG + +  RHGHG+++         +  + GQW  G + G G             +S    Y G + + +RHG G      G +YEG + +NR  G G  +  +  ++EG+F+DD
Sbjct: 1019 YEGRWLSGKPHGKGNLKW-----------------------------------------------PDGTMYCGTFKSGLEDGFG--DFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGV---------CDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRMMGNGTLLCDDDTVFEGDFQDD 1199          

HSP 3 Score: 74.3294 bits (181), Expect = 6.418e-13
Identity = 48/167 (28.74%), Postives = 80/167 (47.90%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG-----FRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWG-CFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y G W++G  HG G + +     + Y G +   + +GFG        +     Y+G W +GK HG G   W    E Y G +R  +++G G     ++    +  S  +V+ G++  GKR G+G C  +  G  Y G W  +++ G G  + + G  YEG F ++R+
Sbjct: 1019 YEGRWLSGKPHGKGNLKWPDG--TMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTF-WYASGEVYEGSFRENMRHGHG----MLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRM 1178          

HSP 4 Score: 51.9878 bits (123), Expect = 4.677e-6
Identity = 49/172 (28.49%), Postives = 81/172 (47.09%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHG-----TGRFNWKSTNTSYEGDFLYNEISGKGKY-TWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKN-VIEGFGFRQYRSGNT----YEGEWYQGKR 751
            P+ T    ERY G    G+  G GT ++ +G ++EG F E   HG     +G+    S+++ + G ++  + +G G    +  G  Y G      RHG G+     G+ Y G + N    GNGT+  D D  + +EGD+  +  + G G     +G++    ++G W  G R
Sbjct: 1060 PSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRMMGNGTLLCDDD--TVFEGDFQDDWTLCGKGILFMPNGDSFDGVFDGHWGSGLR 1229          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Match: ENSXETT00000041392.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 322.783 bits (826), Expect = 1.894e-99
Identity = 196/509 (38.51%), Postives = 281/509 (55.21%), Query Frame = 2
Query:  326 FEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSF-----QLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLI 1834
            +EG G A+F +GNI+ GMF EG MHG G++ WK    +YEGDF  N   G G Y W DGS YEG+V   +RHG GI+   +  + Y G W  G RHG G + Y+ +  S+YEGDW  N  EG+G + + SGN YEG+W     HG G M+WL  NE+Y GQW NGIQNG G H W+++RI G+QYSLRN Y G F NG R G                       +G+F + NG +Y+GE+++++      ++L G                      SA  S   +NT  PS      +L L  +L      +  EE  Q+  AVL +L ++RKI++ YS LG   S DNT +MT++QFWRFLKDC+ H+ S  T++E+DR+L  +E    E + +P S +    F+  +I +AY++   E   ++N S   L  CF   M +N+LP+A N+ G L+ D++K + A+S+  +    Y+ +       P   +MKMR FL++M NL  +
Sbjct:    1 YEGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKD-GLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQG-----------------------QGQFYYANGAMYDGEWKNNKKHGLVSLALFG-----------------TFVFFSAGSSTSRYNTGIPSLAGSYIELDLSALLYSFPEEDRQEELKQVEYAVLRNLTVLRKIYKLYSQLGSDGSPDNTLLMTKLQFWRFLKDCKFHHYS-ITLSEMDRIL--TENTDAEEVHSPHSTMLLRTFLTNIIYLAYHICQTEN-QEKNMS---LADCFTKVMVQNILPHATNIKGFLFPDAQKASYAISYIEKSWHIYRIYCMPNTFHPYEPTMKMRHFLLLM-NLTFL 460          

HSP 2 Score: 54.299 bits (129), Expect = 8.997e-7
Identity = 38/115 (33.04%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTW----QDGSSYE------GDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHG 613
            Y+G+  + + EG G   F++GNI+EG +     HG G+  W ++N  Y G +     +G G +TW      G+ Y       G+ V+G+R G+G + + +G MY G W N  +HG
Sbjct:  110 YEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHG 224          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Match: ENSXETT00000041404.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 310.842 bits (795), Expect = 2.604e-95
Identity = 187/504 (37.10%), Postives = 276/504 (54.76%), Query Frame = 2
Query:  326 FEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLI 1834
            +EG G A+F +GNI+ GMF EG MHG G++ WK    +YEGDF  N   G G Y W DGS YEG+V   +RHG GI+   +  + Y G W  G RHG G + Y+ +  S+YEGDW  N  EG+G + + SGN YEG+W     HG G M+WL  NE+Y GQW NGIQNG G H W+++RI G+QYSLRN Y G F NG R G                       +G+F + NG +Y+GE+++++                                   +  +G F  +  + Q+Y+   + D     P+ +  ++  AVL +L ++RKI++ YS LG   S DNT +MT++QFWRFLKDC+ H+ S  T++E+DR+L  +E    E + +P S +    F+  +I +AY++   E   ++N S   L  CF   M +N+LP+A N+ G L+ D++K + A+S+  +    Y+ +       P   +MKMR FL++M NL  +
Sbjct:    1 YEGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKD-GLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQG-----------------------QGQFYYANGAMYDGEWKNNK-----------------------------------KHGLGKF--VFKNGQIYVGEFVEDQIAEYPNFKYDRVEYAVLRNLTVLRKIYKLYSQLGSDGSPDNTLLMTKLQFWRFLKDCKFHHYS-ITLSEMDRIL--TENTDAEEVHSPHSTMLLRTFLTNIIYLAYHICQTE-NQEKNMS---LADCFTKVMVQNILPHATNIKGFLFPDAQKASYAISYIEKSWHIYRIYCMPNTFHPYEPTMKMRHFLLLM-NLTFL 435          

HSP 2 Score: 60.8474 bits (146), Expect = 7.432e-9
Identity = 43/151 (28.48%), Postives = 65/151 (43.05%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYS------GLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGE 733
            Y+G+  + + EG G   F++GNI+EG +     HG G+  W ++N  Y G +     +G G +TW                     +   G  YS      G +VNG R G G   Y     + Y+G+W  N   G G   +++G  Y GE
Sbjct:  110 YEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTW-------------------FLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANG--AMYDGEWKNNKKHGLGKFVFKNGQIYVGE 239          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Match: ENSXETT00000041411.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 281.952 bits (720), Expect = 1.268e-84
Identity = 173/425 (40.71%), Postives = 232/425 (54.59%), Query Frame = 2
Query:  326 FEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGK------GEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSF-----QLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVY 1564
            +EG G A+F +GNI+ GMF EG MHG G++ WK    +YEGDF  N   G G Y W DGS YEG+V   +RHG GI+   +  + Y G W  G RHG G + Y+ +  S+YEGDW  N  EG+G + + SGN YEG+W     HG G M+WL  NE+Y GQW NGIQNG G H W+++RI G+QYSLRN Y G F NG R G G F Y +GA Y+G W +N+K G       G FVF                                               SA  S   +NT  PS      +L L  +L      +  EE  Q+  AVL +L ++RKI++ YS LG   S DNT +MT++QFWRFLKDC+ H+ S  T++E+DR+L    T+  E + +P S +    F+  +I +AY+++
Sbjct:    1 YEGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKD-GLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLVSLALFGTFVF----------------------------------------------FSAGSSTSRYNTGIPSLAGSYIELDLSALLYSFPEEDRQEELKQVEYAVLRNLTVLRKIYKLYSQLGSDGSPDNTLLMTKLQFWRFLKDCKFHHYS-ITLSEMDRILTVENTDAEE-VHSPHSTMLLRTFLTNIIYLAYHIW 376          

HSP 2 Score: 53.1434 bits (126), Expect = 1.814e-6
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTW----------QDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHG 613
            Y+G+  + + EG G   F++GNI+EG +     HG G+  W ++N  Y G +     +G G +TW             + Y G+ V+G+R G+G + + +G MY G W N  +HG
Sbjct:  110 YEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHG 224          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 87.4261 bits (215), Expect = 6.781e-18
Identity = 58/180 (32.22%), Postives = 87/180 (48.33%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMG 835
            RY+G+  +G+  G G   F +G+ +EG F +G + G G   W S+   Y G+F   EI G G   ++DG  YEG+                       +V G + G+G +     Q   Y G ++ N   G G  ++ +G+ YEG+W   +R GHGV++  D    Y GQWRN + NG G
Sbjct:   38 RYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGE-----------------------FVFGIKEGHGLLMDKEGQT--YSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDVFNGQG 191          

HSP 2 Score: 85.8853 bits (211), Expect = 1.714e-17
Identity = 58/160 (36.25%), Postives = 88/160 (55.00%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRS-GNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            Y G W +G +HG+G + +     S+YEG++    I G G R + S GN Y GE+  G+ HGHGVM++ D   +Y G++  GI+ G G     +    G  YS      G F N K++G G   + +G HYEG W+ +++ G G     +G IYEG++ +D
Sbjct:   39 YEGQWKSGKKHGHGKLLFKDG--SYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGG-RYEGEFVFGIKEGHG----LLMDKEGQTYS------GAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRND 185          

HSP 3 Score: 73.559 bits (179), Expect = 2.478e-13
Identity = 62/193 (32.12%), Postives = 99/193 (51.30%), Query Frame = 2
Query:  407 GRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXI-YKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVS 982
            G + ++++   YEG +   +  G GK  ++DGS YEG+   G   G G+ Y   SG  YSG +  G  HG+G + Y    R  YEG++   + EG G    + G TY G ++  K++G G MK+++  + Y G W    + G G     +Q  +GS      +YEG++ N   +G G   + SG  Y+G W++
Sbjct:   28 GLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGR--YEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMN-GDHYEGDWILDQRQGHG----VLQCTDGS------IYEGQWRNDVFNGQGIMIHCSGVIYDGLWIN 207          

HSP 4 Score: 62.7734 bits (151), Expect = 8.571e-10
Identity = 41/112 (36.61%), Postives = 55/112 (49.11%), Query Frame = 2
Query:  722 YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            YEG+W  GK+HGHG + + D    Y G++ +G   G G   W          S  N Y GEF  G+ HG G   Y  G  YEG +V   K G G  + K G+ Y G F +++
Sbjct:   39 YEGQWKSGKKHGHGKLLFKD-GSYYEGEFADGEITGNGLRYWS---------SSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNK 140          

HSP 5 Score: 54.6842 bits (130), Expect = 3.770e-7
Identity = 38/103 (36.89%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGN 604
            RY+GE   G  EG G      G  + G F     +G G+  + + +  YEGD++ ++  G G     DGS YEG   + V +G+GI  H SG++Y GLW+NG+
Sbjct:  108 RYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGD-HYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGH 209          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 89.3521 bits (220), Expect = 8.173e-18
Identity = 58/180 (32.22%), Postives = 87/180 (48.33%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMG 835
            RY+G+  +G+  G G   F +G+ +EG F +G + G G   W S+   Y G+F   EI G G   ++DG  YEG+                       +V G + G+G +     Q   Y G ++ N   G G  ++ +G+ YEG+W   +R GHGV++  D    Y GQWRN + NG G
Sbjct:   37 RYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGE-----------------------FVFGIKEGHGLLMDKEGQT--YSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDVFNGQG 190          

HSP 2 Score: 88.9669 bits (219), Expect = 9.927e-18
Identity = 58/160 (36.25%), Postives = 88/160 (55.00%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRS-GNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            Y G W +G +HG+G + +     S+YEG++    I G G R + S GN Y GE+  G+ HGHGVM++ D   +Y G++  GI+ G G     +    G  YS      G F N K++G G   + +G HYEG W+ +++ G G     +G IYEG++ +D
Sbjct:   38 YEGQWKSGKKHGHGKLLFKDG--SYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGG-RYEGEFVFGIKEGHG----LLMDKEGQTYS------GAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRND 184          

HSP 3 Score: 76.6406 bits (187), Expect = 7.107e-14
Identity = 63/194 (32.47%), Postives = 99/194 (51.03%), Query Frame = 2
Query:  401 GTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXI-YKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWV 979
            G G + ++++   YEG +   +  G GK  ++DGS YEG+   G   G G+ Y   SG  YSG +  G  HG+G + Y    R  YEG++   + EG G    + G TY G ++  K++G G MK+++  + Y G W    + G G     +Q  +GS      +YEG++ N   +G G   + SG  Y+G W+
Sbjct:   25 GYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGR--YEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMN-GDHYEGDWILDQRQGHG----VLQCTDGS------IYEGQWRNDVFNGQGIMIHCSGVIYDGLWI 205          

HSP 4 Score: 70.4774 bits (171), Expect = 6.459e-12
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  635 TDQRSFYEGDWNKNVIEGFGFRQYR-SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            T    +Y G   K + +G+G   Y  S   YEG+W  GK+HGHG + + D    Y G++ +G   G G   W          S  N Y GEF  G+ HG G   Y  G  YEG +V   K G G  + K G+ Y G F +++
Sbjct:    8 TRNSRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKD-GSYYEGEFADGEITGNGLRYWS---------SSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNK 139          

HSP 5 Score: 54.6842 bits (130), Expect = 6.623e-7
Identity = 38/103 (36.89%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGN 604
            RY+GE   G  EG G      G  + G F     +G G+  + + +  YEGD++ ++  G G     DGS YEG   + V +G+GI  H SG++Y GLW+NG+
Sbjct:  107 RYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGD-HYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGH 208          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 427.557 bits (1098), Expect = 2.162e-135
Identity = 243/581 (41.82%), Postives = 350/581 (60.24%), Query Frame = 2
Query:  188 EFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSA-------RLSVG--SFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            E PL +    D+V +E   +   + + P LT+LI+E Y+GEK  G +EG G A F  GN + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS+YEG+V +G+R+G G++K  +  + Y G W +G RHG G++ Y+ +  S+YEGDW  N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA YEG W SN+K G+G   FKNG +YEG F +D I +F    +    S D     +Q+  Q    ++SA       R   G  S + +  S +L L  +L      + +EE  Q+  AVL ++  +R+I+ FYS LG   S+DNT +MT++ FWRFLKDCR H+++  T+A++DRVL+     P+E I +P   I    F+NYL+ +AYY++ +E+ N  + S +L   CF   M+ N+ P+AC V G L+S+ ++T  ++++ ++    Y  +    +  P   +MKMR FL M+K+  +IN  LTAT+ + + + D+P V D
Sbjct:   50 ETPLKQAPKRDSVQMEQSEEETQYEE-PILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFKNGHVYEGLFSNDHIAQFFETEMDYSQSLDRWSDASQRSRQPRGSSVSAVREPETLRKLDGSESRSVLGTSIELDLTLLLDMYPEESQEEEKKQVEYAVLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLHFWRFLKDCRFHHHN-ITLADMDRVLSVYNGIPIEEIHSPFRTILLRTFLNYLLQLAYYIHHKEFQN-RSPSLFL---CFTKLMSENIHPHACQVKGHLFSEQQRTLYSMNYIDKCWEIYTAYCRPNEAPPYELTMKMRYFLWMLKDFRMINKDLTATKFMTVIAEDNPFVYD 623          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 153.295 bits (386), Expect = 2.456e-39
Identity = 79/206 (38.35%), Postives = 130/206 (63.11%), Query Frame = 2
Query: 1283 VLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            VL ++  +R+I+ FYS LG   S+DNT +MT++ FWRFLKDCR H+++  T+A++DRVL+     P+E I +P   I    F+NYL+ +AYY++ +E+ N  + S +L   CF   M+ N+ P+AC V G L+S+ ++T  ++++ ++    Y  +    +  P   +MKMR FL M+K+  +IN  LTAT+ + + + D+P V D
Sbjct:    1 VLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLHFWRFLKDCRFHHHN-ITLADMDRVLSVYNGIPIEEIHSPFRTILLRTFLNYLLQLAYYIHHKEFQN-RSPSLFL---CFTKLMSENIHPHACQVKGHLFSEQQRTLYSMNYIDKCWEIYTAYCRPNEAPPYELTMKMRYFLWMLKDFRMINKDLTATKFMTVIAEDNPFVYD 201          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 102.449 bits (254), Expect = 6.351e-24
Identity = 63/143 (44.06%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  188 EFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHG 613
            E PL +    D+V +E   +   + + P LT+LI+E Y+GEK  G +EG G A F  GN + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS+YEG+V +G+R+G G++K  +  + Y G W +G RHG
Sbjct:   50 ETPLKQAPKRDSVQMEQSEEETQYEE-PILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHG 190          

HSP 2 Score: 49.6766 bits (117), Expect = 6.283e-6
Identity = 39/108 (36.11%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  506 SYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNG 829
            SYEG+ V G+  G G      G  Y G++  G  HG GT  +    +  YEGD+ KN+    G   +  G+TYEGE   G R+G G+ K   +   Y G W +G ++G
Sbjct:   85 SYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIWADGLK--YEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHG 190          

HSP 3 Score: 48.9062 bits (115), Expect = 9.579e-6
Identity = 36/115 (31.30%), Postives = 50/115 (43.48%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHG-----------------------HGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHG 928
            YEG+  + + EG GF  ++ GNTY G + +G  HG                       HGV  W D    Y G+  NG++NG G      Q ++         Y G +C+GKRHG
Sbjct:   86 YEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIWADGLKYEGDFVKNIPMNHGVYTWPD-GSTYEGEVTNGMRNGFGMFKCGTQPVS---------YIGHWCHGKRHG 190          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 75.8702 bits (185), Expect = 8.501e-14
Identity = 47/137 (34.31%), Postives = 75/137 (54.74%), Query Frame = 2
Query:  647 SFYEGDWNKNVIEGFGFRQYR-SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            S+YEG++    I G G + +  SGNTY G++  G+  GHGVMK+     +Y G+   G++ G G    +++  +G       VY+G F + KRHG G   + +G  YEG WV +++ G G     +G  Y+G++  D
Sbjct:   60 SYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKY-KAGGRYEGELSQGLREGQG----FLEDQDG------QVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCADGSTYKGQWHSD 185          

HSP 2 Score: 74.7146 bits (182), Expect = 2.351e-13
Identity = 54/183 (29.51%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHI 844
            RY+GE   G+  G G   F +G+ +EG F +G + G G  +W  +  +Y G F+  E  G G   ++ G  YEG++                         G R G G +  D D +  Y+G ++ N   G G   +++G+ YEG+W + +R GHGV+   D    Y GQW + + +G+G  +
Sbjct:   38 RYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYKAGGRYEGELS-----------------------QGLREGQGFLE-DQDGQ-VYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCAD-GSTYKGQWHSDVFSGLGSLV 194          

HSP 3 Score: 65.4698 bits (158), Expect = 1.715e-10
Identity = 44/135 (32.59%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            YEG+W      G G   ++ G+ YEGE+  G+  G G   W      Y+GQ+  G   G G            +Y     YEGE   G R G G      G  Y+G +  N++ G+G+ +FKNG  YEG++  D+
Sbjct:   39 YEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGV----------MKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQ 163          

HSP 4 Score: 63.929 bits (154), Expect = 6.158e-10
Identity = 65/216 (30.09%), Postives = 97/216 (44.91%), Query Frame = 2
Query:  401 GTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHP-SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEF 1045
            G G + + ++   YEG++   +  G GK  ++DGS YEG+ V G   G G      SG  YSG +V G   G+G + Y    R  YEG+ ++ + EG GF + + G  Y+G ++  KRHG G M            ++NG                       + YEG++   +R G G      G+ Y+G W S+   G G  V  +G  Y G F
Sbjct:   26 GYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYKAGGR--YEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMI-----------FKNG-----------------------DKYEGDWVRDQRQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMF 205          

HSP 5 Score: 56.9954 bits (136), Expect = 7.139e-8
Identity = 37/103 (35.92%), Postives = 58/103 (56.31%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGN 604
            RY+GE S G  EG G     +G +++G F +   HG G+  +K+ +  YEGD++ ++  G G     DGS+Y+G     V  G G   H SG+ Y G+++NG+
Sbjct:  108 RYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGD-KYEGDWVRDQRQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFINGH 209          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 72.4034 bits (176), Expect = 1.335e-13
Identity = 55/157 (35.03%), Postives = 77/157 (49.04%), Query Frame = 2
Query:  596 NGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYR-SGNTYEGEWYQGKRHGHGVMKWLDR-----NEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFE 1048
            NG RH    VN D      Y G+W  N+  G G + ++ SG  YEG+W  GKR G+G +   D         Y+G W+   ++G G             +  +  YEGE+CN +R GWG   Y +G  YEG W +++  G+G    KNG  YEG +E
Sbjct:   24 NGLRHQVFAVNGD-----HYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQF----------FGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWE 165          

HSP 2 Score: 64.6994 bits (156), Expect = 6.858e-11
Identity = 51/161 (31.68%), Postives = 72/161 (44.72%), Query Frame = 2
Query:  344 AFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSS------YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQW 808
             F VNG+ + G +     HG G   WK +   YEGD+ + +  G G  +  D  +      Y G      + G GI        Y G W N  R G G + Y+      YEG W  +  EG G  + ++GN YEG W +G ++GHG    LD  + + G W
Sbjct:   30 VFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNG--DIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYW 188          

HSP 3 Score: 62.003 bits (149), Expect = 4.303e-10
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  710 SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +G+ Y GEW    +HG G   W      Y G W+ G ++G G     +   +     LR VY G +   K+ G+G   +    +YEG W +N++ G G   + NG IYEG++++D+
Sbjct:   34 NGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGS----LSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDK 145          

HSP 4 Score: 59.6918 bits (143), Expect = 2.841e-9
Identity = 57/204 (27.94%), Postives = 90/204 (44.12%), Query Frame = 2
Query:  566 SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNT------YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFV-FKNGRIYEGEFEDDRIKEFPFISLTGRDSPD---LNIHKTQQLMQDDI 1147
            +G  Y G W    +HG GT  +     + YEGDW     +G+G   +    T      Y G W   K+ G+G+ ++    E Y G+W N  ++G G+            Y+  ++YEG++ N K  G G     +G  YEG W    K G G F    +G+++EG + D+  K    I     ++P+     I K + L  D +
Sbjct:   34 NGDHYVGEWKGNLKHGKGTQVWKKSG-AVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGI-QFFGPKEYYEGEWCNNQRSGWGRMY----------YNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNVAKCGTMIDFGRDEAPEPTQFPIPKVEILDPDGV 225          
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Match: sp|B2RC85|R10B2_HUMAN (Radial spoke head 10 homolog B2 OS=Homo sapiens OX=9606 GN=RSPH10B2 PE=2 SV=2)

HSP 1 Score: 435.261 bits (1118), Expect = 1.358e-137
Identity = 238/552 (43.12%), Postives = 343/552 (62.14%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P AC + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNACQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Match: sp|P0C881|R10B1_HUMAN (Radial spoke head 10 homolog B OS=Homo sapiens OX=9606 GN=RSPH10B PE=2 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 1.314e-135
Identity = 237/552 (42.93%), Postives = 342/552 (61.96%), Query Frame = 2
Query:  275 LTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFP-----FIS---LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHIL-MDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            LT+LI+E Y+GEK  G +EG G A F  G  + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS YEG+VV+G+R+G G++K  +  + Y G W NG RHG G++ Y+ +   +YEGDW +N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG+W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA Y+G WVSN+K G G   FKNGR+YEG F +D I  FP     FIS   L+   +P L+  ++ +L++  +D   +   +GS      S +L L  +L M P+   P EE  Q+  AVL ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H++ + T+A++DR+L+++   P+E I +P + I    F+NYL+ +AY++Y EE+    + S +L   CF   MT N+ P A  + G L+ + ++T  ++S+ N+    Y  +       P   +MKMR FL M+K+  +IN  LTA   +++ + D+  + D
Sbjct:   78 LTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLS--RSAELIR-KLDGSESHSVLGS------SIELDLNLLLDMYPETVQP-EEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHH-KLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHLAYHIYHEEF-QKRSPSLFL---CFTKLMTENIRPNAFQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATFMEVIAEDNRFIYD 613          
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Match: sp|E9PYQ0|RS10B_MOUSE (Radial spoke head 10 homolog B OS=Mus musculus OX=10090 GN=Rsph10b PE=1 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.512e-134
Identity = 243/581 (41.82%), Postives = 350/581 (60.24%), Query Frame = 2
Query:  188 EFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSG-MMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSA-------RLSVG--SFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            E PL +    D+V +E   +   + + P LT+LI+E Y+GEK  G +EG G A F  GN + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS+YEG+V +G+R+G G++K  +  + Y G W +G RHG G++ Y+ +  S+YEGDW  N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG W  GIQNG G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA YEG W SN+K G+G   FKNG +YEG F +D I +F    +    S D     +Q+  Q    ++SA       R   G  S + +  S +L L  +L      + +EE  Q+  AVL ++  +R+I+ FYS LG   S+DNT +MT++ FWRFLKDCR H+++  T+A++DRVL+     P+E I +P   I    F+NYL+ +AYY++ +E+ N  + S +L   CF   M+ N+ P+AC V G L+S+ ++T  ++++ ++    Y  +    +  P   +MKMR FL M+K+  +IN  LTAT+ + + + D+P V D
Sbjct:   50 ETPLKQAPKRDSVQMEQSEEETQYEE-PILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFKNGHVYEGLFSNDHIAQFFETEMDYSQSLDRWSDASQRSRQPRGSSVSAVREPETLRKLDGSESRSVLGTSIELDLTLLLDMYPEESQEEEKKQVEYAVLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLHFWRFLKDCRFHHHN-ITLADMDRVLSVYNGIPIEEIHSPFRTILLRTFLNYLLQLAYYIHHKEFQN-RSPSLFL---CFTKLMSENIHPHACQVKGHLFSEQQRTLYSMNYIDKCWEIYTAYCRPNEAPPYELTMKMRYFLWMLKDFRMINKDLTATKFMTVIAEDNPFVYD 623          
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Match: sp|Q66HB5|RS10B_RAT (Radial spoke head 10 homolog B OS=Rattus norvegicus OX=10116 GN=Rsph10b PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.792e-132
Identity = 238/554 (42.96%), Postives = 340/554 (61.37%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSA-------RLSVG--SFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            P LT+LI+E Y+GEK  G +EG G A F  GN + GMF EG MHG G + W +    YEGDF+ N     G YTW DGS+YEG+VV+G+R+G G++K  +  + Y G W +G RHG G++ Y+ +  S+YEGDW  N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTG W  GIQNG G H W+++RI  SQY LRN Y G F NG RHG G F Y SGA YEG WVSN+K G+G   FKNGR+YEG F +D I +F    +    S D     +Q+  Q    ++SA       R   G  S + +  S +L L  +L      + +EE  Q+  AVL ++  +R+I+ FYS LG   S+DNT +MT++ FWRFLKDCR H+++  T+A++DRVL+     P+E I +P   I    F+NYL+ +AYY++ +E+ N  + S +L   CF   M  N+ P+AC V G L+++ ++T  ++++ ++    Y  +    +  P   +MKMR FL M+K+  +IN  LTAT+ +++ + D+P V D
Sbjct:   76 PILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVVNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGAFVNGFRHGQGKFYYASGAMYEGEWVSNKKQGRGRITFKNGRVYEGLFSNDHIAQFFEAEMDYSYSLDRRSDISQRSRQARGSSVSADREPETLRKLDGSESRSVLGSSIELDLNLLLDMYPEESQEEEKKQVEYAVLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLHFWRFLKDCRFHHHN-ITLADMDRVLSVYNGIPIEEIHSPFRTILLRTFLNYLLQLAYYIHHKEFQN-RSPSLFL---CFTKLMAENIHPHACQVKGHLFNEQQRTLYSMNYIDKCWEIYTAYCRPNEAPPYELTMKMRYFLWMLKDFRMINKELTATKFMRVIAEDNPFVYD 623          
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Match: sp|Q1JPG1|RS10B_BOVIN (Radial spoke head 10 homolog B OS=Bos taurus OX=9913 GN=RSPH10B PE=2 SV=2)

HSP 1 Score: 419.853 bits (1078), Expect = 5.577e-132
Identity = 225/557 (40.39%), Postives = 338/557 (60.68%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPD-----------LNIHKTQQLMQD-DIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            P LT+LI+E Y+GEK  G +EG G A F  G  ++GMF EG MHG G + W +    YEGDF+ N     G +TW DGS+YEG+VV G+RHG G++K  +  + Y G W +G RHG G++ Y+ +  S+YEGDW  N+ +G+G R Y+SGN YEG+W    RHG G M+WL  NE+YTGQW++G+QNG+G H W+++RI  SQY LRN Y GEF NG RHG G F Y SGA YEG WVSN+K G G   FKNGR+Y+G F  D +  FP +       PD                + ++M+  D +  ++ L       ++   ++Y       P+  +  EE  Q+  A+L ++  +R+I+ FYS+LG   S+DNT +MT++ FWRFLKDC+ H+++  T+A++DRVL ++   P+E I +P + +    F+NYL+ +AY+++ +EY  D + S +L   CF   M  N+ P AC V G L+ ++++T  ++++ ++    Y          P   +M  R FL M+++  +IN  LTAT+ V++ + D+P++ D
Sbjct:   77 PVLTKLIVESYEGEKVRGLYEGEGFAIFQGGCTYQGMFSEGLMHGQGTYIW-ADGLKYEGDFVKNIPMNHGIFTWPDGSTYEGEVVGGMRHGFGMFKCSTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWIHNIRKGWGIRCYKSGNIYEGQWENNVRHGEGRMRWLTTNEEYTGQWKHGVQNGLGTHTWFLKRIPYSQYPLRNEYVGEFVNGYRHGHGKFYYASGAMYEGEWVSNKKHGMGRLTFKNGRVYDGPFSKDHMVAFPNLEGEVMSYPDSTSECAFGCQWCRPSASAEIMRKLDGNESNSLLGSSLELDLSLLLKMY-------PE-RDQSEEKKQVEYAILRNITELRRIYNFYSSLGCDRSLDNTFLMTKLHFWRFLKDCKFHHHN-ITLADMDRVLGANNDIPVEEIHSPFTTLLLRTFLNYLLQLAYHIHHKEY-QDRSPSLFL---CFKKLMNENIRPNACRVKGRLFCEAQRTLYSMTYVDKCWEIYTAHCRPNAAPPHELTMSTRHFLWMLRSFKIINKELTATKFVEVIAEDNPSMYD 619          
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Match: A0A3S1A0I0 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_012637 PE=4 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 1.529e-163
Identity = 317/840 (37.74%), Postives = 475/840 (56.55%), Query Frame = 2
Query:  146 DIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSG--YLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQ-FICLXXXXXXXXXXXXXXNCATKYITKDII--------------DIYLKNEDKKTHQTNISENLEDSE-----TEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRKLSVDKELANP---IKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEE---------RQFNFWTHQLHMFFCNFLFPSATKY 2560
            + P +++V   S  E  L  +VI+ T A+ T   ++   D P L+ELI+ER++GEK  G ++G G ++F  G+ ++GMF EG MHG GR+ W +    YEGDF+ N+++GKG YTW+DGSSY GDV+ G RHG G ++  +G++ Y+G W  G RHG G +++D + +S++EGDW   +  G+G RQY SGN Y G W+   RHG G MKWLDR++ Y GQW NGIQ+GMGQHIW ++R++ SQY LRN+Y+GE  NG RHG G F Y +GA YEG W  N K GKG+F FKNGRIYEG FE D I E+P  ++ G  SPD+   +T+  +    DNMS   S  S NT +PSFQL +  +L      + + E  Q+  ++  H+  +R+I+ FYSTLG   S DNT +M ++QFWRFLKD RLH++ R T+ ++DRV+  +       + NP  KI   +F+NY++ + + +Y E++   +   G   LL+ CF   MT  VL +AC V   +Y ++R+   AL H ++    Y+  S  ++  P+  ++KMRDFL ++K+LNLIN  LTA+  + + S D+P V D +    LE+E+TF EFFE ++ CA  ++T+ ++              D  + +      +     N+E++E     T P ++ +   TG +      E + S+V    K  +G ++ + A +       + P       S   S +   P     +  S      NP     QP+   S  ++  P+  L D E   D+         E+   + +EE         R+FNFWTHQ+H+FF    FP A K+
Sbjct:   27 ETPMTDSVDTPS--EEVLCAEVIDKTPAIPTPEPTY---DEPALSELIVERFEGEKVKGLYDGEGESYFTGGHHYKGMFSEGCMHGRGRYTW-ADGLIYEGDFVRNQVTGKGTYTWKDGSSYIGDVLLGKRHGFGTFRTGNGIISYTGDWYMGKRHGKGRMDFDPEGKSYFEGDWVNGIKHGWGTRQYPSGNIYHGMWFNNVRHGEGTMKWLDRDQVYAGQWENGIQHGMGQHIWLLRRVHHSQYPLRNMYDGELVNGLRHGQGVFYYANGAKYEGLWKDNMKHGKGKFTFKNGRIYEGLFEKDHIVEYPDFTMDGTTSPDMTQIRTRTPLP--TDNMSVH-SNESKNTTSPSFQLEINTLLTTLSAYDIEHEVNQVLYSITRHVTALRRIYTFYSTLGYEESPDNTFIMNKLQFWRFLKDIRLHHD-RYTLTDMDRVIGQNYQKSKFELHNPYEKILQRQFVNYMVILGHLLYKEDH---KKLGGNTPLLEYCFSRLMTEKVLRHACLVKSPIYVETRRATNALVHMDQAYEIYQGISTPRKRLPKEPTLKMRDFLFLLKDLNLINQDLTASAAIGVMSSDNPAVADGEGAFNLELEMTFLEFFEALVGCAEVFVTESVVKDPNTPRPSTVLTHDQSMYSVPASPSRMTSQGNVEEAEGSVRQTTPYVSGAGSPTGRATP----ERNMSSVAMTNK--TGGDESNKALAEAPSGNVEGP--MAVKSSHHGSARHDLPGGEMHKSASFVSGRTNPNSDENQPLMRSSVSLIG-PDGQLMDTEEALDA---------EMAGGQGDEEDLDLIDEATRKFNFWTHQIHIFFVGKFFPGAEKH 835          
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Match: K1QT60 (Radial spoke head 10-like protein B2 OS=Crassostrea gigas OX=29159 GN=CGI_10025206 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 5.879e-160
Identity = 271/580 (46.72%), Postives = 383/580 (66.03%), Query Frame = 2
Query:  263 DLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFIC-LXXXXXXXXXXXXXXNCATKYITKDII 1996
            D P L+ELIIE ++G+K+ G +EG G A F  G+ ++G FCEG MHG G++ W S    Y+G+F  N+++GKG Y W DGS+Y+G+V++G RHG G +K  +  + YSG W  G RHG G ++YD++ RS+Y+GDW  NV  G+G RQY SGN Y+G W+   RHG G MKWLDRN+ YTG W NGIQ+G+GQH+W ++R++GSQY LRN+Y+G+F NG RHG+G F Y +GA YEG W  N K GKG+FVFKNGRIYEG F +D I E+P  ++ G  +PD++  +T+  +    DN+S   S  S NTI+PSFQL + H+L +    + +EES Q+   V+ H+  +RKI+ FYS+LG   S DNT VM +MQFWRFL DC  H+ S  T+ E+DR L  ++      + NP  KI   +F+N LI +AY++Y EE   +E   G +L  C    ++  +L +ACNV G  Y++ R+   A+ H+++    Y+  S  ++  P   ++KMR+FL +MK+L LIN+ LT   I+ I S DDPNV D +  C LE+E+TF EFFE +I CA  + T+ +I
Sbjct:  191 DEPVLSELIIETFEGDKTRGMYEGEGYALFTGGHTYKGQFCEGLMHGHGQYTW-SDGVVYQGEFFQNQVTGKGVYRWPDGSAYDGEVLNGKRHGIGTFKCKNNKLSYSGEWSLGKRHGKGKMDYDSEGRSYYDGDWINNVKHGWGTRQYPSGNIYQGMWFNNIRHGEGTMKWLDRNQMYTGNWENGIQHGVGQHLWMLRRVSGSQYPLRNMYDGDFVNGLRHGFGTFYYANGAKYEGGWKDNMKHGKGKFVFKNGRIYEGMFANDHIVEYPDFTMDGTTTPDISQIRTRTPLP--YDNLSVH-SNESRNTISPSFQLNIEHLLAEFTDTDREEESSQVLYVVMRHISALRKIYNFYSSLGYDESADNTFVMNKMQFWRFLVDCEFHH-SETTLMEMDRQLGHNKEK--YELHNPYEKILLRQFVNNLIVLAYHMYKEE--AEEECKGPILHWCMSKLISEKILRHACNVKGHFYTEPRRAVNAVVHWDQGYEIYQSLSTPRKKKPYDPAIKMREFLYLMKDLKLINNDLTPKAIIDILSKDDPNVADGEGCCNLELEMTFLEFFEALIGCAEVFGTEAVI 761          
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Match: R7UYD4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_180366 PE=4 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.091e-158
Identity = 309/850 (36.35%), Postives = 473/850 (55.65%), Query Frame = 2
Query:  101 SNSSNLLDDKK--SILGDIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVL---ASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQ-FICLXXXXXXXXXXXXXXNCATKYITKDIIDI--YLKNEDKKTHQ----------TNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRK----LSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKII 2581
            ++ S+L ++K+  S+L  I  S    +   +E P   +   + V  E           P LT+L++E YDGEK  G + G G A++V G+ ++G + +G MHG G ++WK  N  YEG+F +N+++GKG Y W DGSS+EG+++ G+RHG G ++   G M Y+G W  G +HG G ++YD +  SFYEGDW  N   G+G R Y SGN Y+G W+   RHG G M+WL+R++ YTGQW N  Q+G GQHIW+++RI GSQY LRN+Y+GEF  G R G G F Y +GA YEG W  N K GKG+F+FKNGR+YEG F+ D I EFP   +   D+  L      +   D      +  S  S NT +PSFQL + H+L +   ++ +EE+ Q+   ++ H+  +RKI+ +YS+LG   S DNT VM +MQFWRFLKDC+LH+    ++ E+DRVL   AS   +P     NP  KI F  F NY++S+AY+++ +++       G +L  C    M  NVL  AC+V G +Y ++R+   AL H ++    YK+F  +++   +  SMKMR+ L M+K++ LINS LT   IV I + DDP V+DD+  I +E EITF EFFE ++ CA  ++T+ ++      +     TH+          + ++  +E+   E T   S PV G            +   +HG  ++    +++++++      + PD                   N G+K    +S    + +   +P+   S   ++  E ++    S+ D   +T     + E ++      FNFWTHQ+H+FF    FPSA K  +++++I
Sbjct:   22 TDESSLAEEKREESLLSSIQGSPVEEESHIEEPPAPREPTPEPVYEE-----------PPLTKLVVENYDGEKERGLYHGHGEAWYVGGHHYKGQWKQGMMHGKGCYSWKD-NLIYEGEFSWNKVTGKGTYKWADGSSFEGELLDGLRHGFGTFRCADGKMSYTGDWHKGKKHGKGRIDYDPEGASFYEGDWVGNAKHGWGARCYPSGNIYQGMWFNNIRHGDGTMRWLNRDQMYTGQWENATQHGQGQHIWFLRRIPGSQYPLRNMYDGEFDKGMRSGTGTFYYANGARYEGLWKDNMKHGKGKFIFKNGRVYEGTFDRDHIVEFPNFEM---DAVSLLASSDHRPFLDSSPESLSIQSNSSRNTYSPSFQLEVDHLLQELPESDREEEATQVIFVMMRHITALRKIYSYYSSLGYEESPDNTFVMNRMQFWRFLKDCKLHHYDT-SLMEIDRVLGVAASLSDDP----HNPYGKILFREFTNYMVSLAYHIFHKQHEG----VGCILHWCLSKLMADNVLSNACSVNGFIYRETRRAVNALVHMDQAYEIYKQFCMARKTECKELSMKMRELLFMIKDVKLINSDLTPKAIVDILASDDPKVLDDEGAINMEPEITFLEFFETLVGCAEVFVTESVVKDPNTPRLSPSVTHEPSVISMPQSPSRVASQMEEGAEEGTFGASSPVEG-GGATPRSSSQMTTKTDHGSLKAQTIVITTSEAA------ELPDSAKKSEITL----------NDGKKSASFMSSHSGMTDGGNEPLVH-SVVCMAHSEASMNHQGSINDEDDETYDEELDEETRQ------FNFWTHQVHIFFVRKFFPSAQKLILLNQLI 823          
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Match: A0A210Q4K1 (Radial spoke head 10-like B2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08347 PE=4 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 3.329e-158
Identity = 273/612 (44.61%), Postives = 377/612 (61.60%), Query Frame = 2
Query:   92 TASSNSSNLLDDKK---SILGDIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFIC 1915
            +A  +  +++DD+K   SI+G   ++ T   +   E P  E   E               D PTLTELIIE ++GEK  G +EG   A F  G++++GMF EG MHG G + W S   +YEG+F  N+++GKG Y W DGS+YEGDVV+G RHG G + +    + YSG W  G R+G G + YD++ +SFY+GDW  NV  G+G RQY SGN Y+G W+   RHG G MKWLD+N+ Y G W NGIQ+GMGQH W ++R  GSQY LRN+Y+GEF NG RHG+G F Y +GA YEG W +N K GKG+F FKNGRIYEG FE D I E+P  ++ G  +PD+   +T+  +    DN+S   S  S NTI+PSFQL + H+L +    + +EE+ Q    V+ ++ ++RKI+ FYS LG   S DNT VM +MQFWRF+KDC+LH + + T+ ++DR+L  S+ +    I NP  +I   +F+N LI +AYY+Y EE+   E     +L  C    +   +L  ACNV G  Y +SR++  AL H ++    Y+     ++  P+  SMKMR FL MMK+L LIN+ LT   ++ I S DDP V D +  C
Sbjct:   18 SAKKSEGSIIDDEKKDGSIIGGTESTPTEDNVQ--ESPRKEPSPEPEY------------DEPTLTELIIESFEGEKLRGLYEGESVAHFTGGHLYKGMFMEGHMHGKGCYTW-SDGVTYEGEFYQNKVTGKGSYRWPDGSTYEGDVVNGKRHGDGAFHYKGNKVSYSGEWCEGKRNGKGKMEYDSEGKSFYDGDWVNNVKHGWGTRQYPSGNVYQGMWFNNVRHGEGTMKWLDKNQIYNGNWENGIQHGMGQHNWLLRRKTGSQYPLRNMYDGEFVNGLRHGFGTFLYANGAKYEGGWKNNMKHGKGKFTFKNGRIYEGMFERDHIVEYPDFTMDGATTPDITQIRTRTPLPG--DNLSVH-SNESRNTISPSFQLDIEHLLNEFTEYDREEEARQALCVVMRNISVLRKIYNFYSCLGYEESTDNTFVMNKMQFWRFMKDCKLH-DGQLTLMDMDRMLGHSKAS--YEIHNPYERILIRQFVNSLIILAYYLYHEEHEGTEP----VLASCMSKLIQDKILRNACNVQGHFYHESRRSVNALVHLDQSYEVYQAVCSPRKLVPKDSSMKMRQFLYMMKDLKLINNDLTPKALLDILSSDDPRVSDGEGCC 604          
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Match: A0A1S3J1Z2 (radial spoke head 10 homolog B OS=Lingula unguis OX=7574 GN=LOC106169379 PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 3.303e-151
Identity = 270/661 (40.85%), Postives = 391/661 (59.15%), Query Frame = 2
Query:  263 DLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFIC-LXXXXXXXXXXXXXXNCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGK---PQSGKNKVSS-ADSSNSKTRK 2227
            D PTLTELI+E Y+GEK  G +EG G   F  G+ ++G F  G MHG G + W +    YEG+F  N+++GKG Y W + SSYEGDVV+G+RHG GI++  SG M Y+G W  G RHG G + YD   +S+Y+GDW  N+  G+G RQY SG+ Y+G W+   RHG G MKW+D+++ Y GQW +G+Q+GMGQHIW+++R+ GSQY LRN Y+GEFC G RHG+G F Y +GA YEG W  N K G+G+F FKNGRIYEG FE D I EFP  SL G  +PDL   +T+  +    DN+S   S  S NT+ PS  L + H+L +    + +EE  Q+   ++ H+  +R I+  Y++LG   S DNT +M +MQFWR +KDC+ H++   T+ ++DR L     +    + NP  KI    ++N+L+++ Y +Y EE+    +  G +L  C    +  N+LP AC+VGG  Y + R+   AL H +     Y      ++  P   SMKMR FL M+K+  L+N+ LT    + + + DDP V D +    LE+E+ F EFFE +I CA  Y+T+ ++      +D  T + +     E S     L+  R  + +  ++D  E+++     H K   P++    V+  A SS+  T K
Sbjct:   65 DEPTLTELIVESYEGEKVRGLYEGEGECSFTGGHHYKGNFSSGLMHGRGIYTW-ADGVQYEGEFTNNQVTGKGTYRWPNKSSYEGDVVNGMRHGYGIFRVKSGTMNYAGDWCMGKRHGKGRMEYDPQGQSYYDGDWVNNIKHGWGIRQYPSGSVYQGMWFSNVRHGEGTMKWVDKDQMYLGQWEDGVQHGMGQHIWFLRRVGGSQYPLRNTYDGEFCKGLRHGYGTFYYANGAKYEGMWKDNMKHGQGKFTFKNGRIYEGRFEKDHIAEFPSFSLDGTCTPDLGQIRTRTPL--PADNVSVH-SNESKNTLGPSMALEIDHLLTEFTEFDREEEVNQVMYVIMRHMSSLRMIYNNYASLGYEESPDNTYIMNRMQFWRMMKDCKFHHHDI-TLMDMDRALVPDPRS--SDLHNPYGKILIREYLNHLVTLGYLIYGEEH----DGKGPVLAWCLSKLIADNILPNACSVGGNFYYEQRRAVNALVHMDRAYQVYNSICSPRKHTPHEPSMKMRQFLFMLKDYKLVNADLTPQNAINVLAADDPKVADPEGAYNLELEMCFLEFFEALIGCAQVYVTEAVV------KDPSTPRPSTQLTQEQSMLSIPLSPGRAGSREQTEIDDGEEEEGEGSQHHKSPSPETAATPVAPRAVSSSGGTHK 708          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 406.371 bits (1043), Expect = 3.005e-128
Identity = 214/545 (39.27%), Postives = 316/545 (57.98%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYK-HPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPL-EIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQY-YSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNV 1894
            P L+ LI++RY+GE+    F G G A F+ G++++G F  G MHG G + W +    YEG+F+ N   G G YTW DGS YEG+V +G+RHG G Y    +  +Y G W  G RHG G + Y+ ++ S+YEGDW  N  EG+G R Y SGN Y+G+W    RHG G M+W+  N+QY+GQW  G+Q+G G H W ++R  GSQY   N Y+GEF  G RHG G F Y SGA Y G W  N+K G+G+  FKNGRI+EGEF +DR+ EFP  S+ G  +PDL+  +T     D+I    AR S G+   ++    L +  +L     A   +E  Q+  A++ H+ ++R I++FY +LG  +S DNT ++T +QFWRFLKDC +H +   T+A++DR+    E + L E + +P S +  ++F++ ++  AY+++ ++     N    +L +CF   M  N+ P A NV G L+    K      +       Y+ F  +         +M  R F+ M KNL L +S LT   +++I SL +P +
Sbjct:   59 PVLSHLIVDRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTW-ADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEFIEDRMAEFPEFSIDGTKTPDLSGIRTNSPPPDEILPRRARKSGGTAAVLSTDIVLNIETLLKRIPEAQRYQELRQVEFAIIRHIALLRAIYRFYGSLGHDVSPDNTFLLTHLQFWRFLKDCGVHLHGL-TLAQIDRL---REDDVLSEDVDSPFSTVLLIKFLSDIVVAAYHIFYKDIGTSRN----VLAECFSKLMRENIFPNAKNVKGPLFCHPLKAVAGRKYIGRCWEIYQAFCTTANSAALSDQTMTARHFIWMFKNLGLFDSELTTARVLEILSLGNPAI 594          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 407.142 bits (1045), Expect = 4.602e-128
Identity = 214/545 (39.27%), Postives = 317/545 (58.17%), Query Frame = 2
Query:  269 PTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYK-HPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPL-EIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEF-SYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNV 1894
            P L+ LI++RY+GE+    F G G A F+ G++++G F  G MHG G + W +    YEG+F+ N   G G YTW DGS YEG+V +G+RHG G Y    +  +Y G W  G RHG G + Y+ ++ S+YEGDW  N  EG+G R Y SGN Y+G+W    RHG G M+W+  N+QY+GQW  G+Q+G G H W ++R  GSQY   N Y+GEF  G RHG G F Y SGA Y G W  N+K G+G+  FKNGRI+EGEF +DR+ EFP  S+ G  +PDL+  +T     D+I    AR S G+   ++    L +  +L     A   +E  Q+  A++ H+ ++R I++FY +LG  +S DNT ++T +QFWRFLKDC +H +   T+A++DR+    E + L E + +P S +  ++F++ ++  AY+++ ++     N    +L +CF   M  N+ P A NV G L+    K      +       Y+ F + +        +M  R F+ M KNL L +S LT   +++I SL +P +
Sbjct:   59 PVLSHLIVDRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTW-ADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEFIEDRMAEFPEFSIDGTKTPDLSGIRTNSPPPDEILPRRARKSGGTAAVLSTDIVLNIETLLKRIPEAQRYQELRQVEFAIIRHIALLRAIYRFYGSLGHDVSPDNTFLLTHLQFWRFLKDCGVHLHGL-TLAQIDRL---REDDVLSEDVDSPFSTVLLIKFLSDIVVAAYHIFYKDIGTSRN----VLAECFSKLMRENIFPNAKNVKGPLFCHPLKAVAGRKYIGRCWEIYQAFCTTANSAALSDQTMTARHFIWMFKNLGLFDSELTTARVLEILSLGNPAI 594          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 88.5817 bits (218), Expect = 2.117e-17
Identity = 67/215 (31.16%), Postives = 95/215 (44.19%), Query Frame = 2
Query:  440 YEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-----YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSG-------NTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKF-GKGEFVFKNGRIYEGEF 1045
            YEG +L  + +G+G   W DG  Y G   +G+  G G Y  P+  +     Y G W +G  HG G   Y T +   YEG +  N+  G G    RSG       + + G+W   K+ G+GV   + R E+Y G W+  ++ G G  +        +Q+ L   YEG F N K  G G         +EG +  +    GKG     NG   EG F
Sbjct: 1081 YEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGE--LYEGSFQDNMRHGHGM--LRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIV--------TQFGL--YYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSF 1281          

HSP 2 Score: 84.7297 bits (208), Expect = 3.437e-16
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  467 ISGKGKYTWQDGSS-----YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTV---NYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQ----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            IS    YT+   S      YEG  + G  +GRG+ K P G MY+G + NG   G G     N + ++   Y+G W    + GFG  +Y +G  YEG +    RHGHG+++    N      + GQW +  + G G    +     G +Y       G +    R G G      G +YEG + +N+  G G  + ++   +EG+F DD
Sbjct: 1062 ISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGV---FDDITRGEKYM------GLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDD 1260          

HSP 3 Score: 70.8626 bits (172), Expect = 6.168e-12
Identity = 54/206 (26.21%), Postives = 94/206 (45.63%), Query Frame = 2
Query:  467 ISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHP--SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG-----FRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFT-YPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            +SG G  T   G++   D           YK      +MY G W+ G  +G G + +  D R  Y G +   + +G+G      +     + Y+G W  GK HG G  ++    E Y G +++ +++G G  +    ++N +  S   V+ G++ + K+ G+G F     G  Y G W  + + G G  V + G  YEG F ++++
Sbjct: 1044 LSGTGMDT--SGAAMRADPPISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKW-PDGR-MYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYAT-GELYEGSFQDNMRHGHG--MLRSGKLNSTSPS---VFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKM 1239          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 88.5817 bits (218), Expect = 2.138e-17
Identity = 67/215 (31.16%), Postives = 95/215 (44.19%), Query Frame = 2
Query:  440 YEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM-----YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSG-------NTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKF-GKGEFVFKNGRIYEGEF 1045
            YEG +L  + +G+G   W DG  Y G   +G+  G G Y  P+  +     Y G W +G  HG G   Y T +   YEG +  N+  G G    RSG       + + G+W   K+ G+GV   + R E+Y G W+  ++ G G  +        +Q+ L   YEG F N K  G G         +EG +  +    GKG     NG   EG F
Sbjct: 1090 YEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGE--LYEGSFQDNMRHGHGM--LRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIV--------TQFGL--YYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSF 1290          

HSP 2 Score: 84.7297 bits (208), Expect = 3.471e-16
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  467 ISGKGKYTWQDGSS-----YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTV---NYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQ----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            IS    YT+   S      YEG  + G  +GRG+ K P G MY+G + NG   G G     N + ++   Y+G W    + GFG  +Y +G  YEG +    RHGHG+++    N      + GQW +  + G G    +     G +Y       G +    R G G      G +YEG + +N+  G G  + ++   +EG+F DD
Sbjct: 1071 ISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGV---FDDITRGEKYM------GLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDD 1269          

HSP 3 Score: 70.8626 bits (172), Expect = 6.174e-12
Identity = 54/206 (26.21%), Postives = 94/206 (45.63%), Query Frame = 2
Query:  467 ISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHP--SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG-----FRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFT-YPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            +SG G  T   G++   D           YK      +MY G W+ G  +G G + +  D R  Y G +   + +G+G      +     + Y+G W  GK HG G  ++    E Y G +++ +++G G  +    ++N +  S   V+ G++ + K+ G+G F     G  Y G W  + + G G  V + G  YEG F ++++
Sbjct: 1053 LSGTGMDT--SGAAMRADPPISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKW-PDGR-MYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYAT-GELYEGSFQDNMRHGHG--MLRSGKLNSTSPS---VFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKM 1248          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Match: morn3 (MORN repeat-containing protein 3 [Source:NCBI gene;Acc:103031534])

HSP 1 Score: 75.8702 bits (185), Expect = 1.098e-14
Identity = 59/191 (30.89%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  428 TNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYE----GDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTY-PSGAHYEGFWVSN 985
            T   Y G++L N   GKG   W+                       +G++Y G W  G R G GT++  +   + YE    G+W  +  EGFG   Y   + YEG+W + +R G G M +    + Y G+W     +G G     +   NG      N YEG + +G+++G GCF Y   G  YEGFWV +
Sbjct:   24 TGDQYTGEWLQNRKHGKGTQVWKR----------------------AGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRM-FYPNGDVYEGEWLKDKPHGQG----VLTLANG------NRYEGSWKDGRKNGPGCFFYLDKGQLYEGFWVDD 181          

HSP 2 Score: 75.0998 bits (183), Expect = 2.258e-14
Identity = 47/141 (33.33%), Postives = 71/141 (50.35%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQY-RSGNTYEGEWYQGKRHGHGVMKWLDRNEQ-----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            Y G+W +N   G G + + R+G  Y+GEW  GKR G G +             Y+G+W+N  + G G  +          YS  ++YEG++   +R G G   YP+G  YEG W+ ++  G+G     NG  YEG ++D R
Sbjct:   28 YTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEV----------YSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKPHGQGVLTLANGNRYEGSWKDGR 158          

HSP 3 Score: 74.3294 bits (181), Expect = 3.408e-14
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  710 SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +G+ Y GEW Q ++HG G   W      Y G+WR G ++G G     + + +    +   +Y GE+ N K+ G+G   Y   + YEG WV + + G G   + NG +YEGE+  D+
Sbjct:   24 TGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGT----LSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDK 135          

HSP 4 Score: 71.633 bits (174), Expect = 2.788e-13
Identity = 50/168 (29.76%), Postives = 79/168 (47.02%), Query Frame = 2
Query:  335 LGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSS------YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGI 820
            L T F V G+ + G + +   HG G   WK     Y+G++ + +  G G  + Q   S      Y G+  +  + G G+  +    +Y G WV   R G+G + Y       YEG+W K+   G G     +GN YEG W  G+++G G   +LD+ + Y G W + +
Sbjct:   17 LRTVFSVTGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGD--VYEGEWLKDKPHGQGVLTLANGNRYEGSWKDGRKNGPGCFFYLDKGQLYEGFWVDDV 182          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 318.161 bits (814), Expect = 5.538e-99
Identity = 177/528 (33.52%), Postives = 277/528 (52.46%), Query Frame = 2
Query:  347 FFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM--------YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPF--ISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            F+  GN++ G FC   MHG G++ W +    +EGDF  N + G G Y W DGS Y G+V +GV       +H  G +        YSG W    RHG G V YD  + S+Y G+W+ N+  G+G R+Y SGN YEG+W   +RHG G M+W+   ++Y GQW++G  +G G H W V+R+  SQY + N Y GE+  G RHG G F Y SGA Y+G W  +RK G G F  K+G+IYEG F +D +       +   G  SP  +   T +               G     +    L L  +L        + E  Q+   VL H+  +R+ +  YS LG   S DNT ++++MQ+WR LKDC++H    P++A++DR+L++        I  P  ++   +F++ L  + Y++Y  +Y          L  C    M   +LP+AC++ G ++ ++ +   AL + ++    Y+    +    P   ++  R+FL M+++  LI+ SL+A ++++I SLD+P + D
Sbjct:    1 FYEGGNVYSGSFCNNMMHGKGKYVW-ADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGV-------RHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFVEDVMVGCSQNNVGENGLSSPFKDKESTAE---------------GGKMLQSSHVDLDLARLLQKFPADKREAEYKQVQFVVLQHIAALRRAYSKYSGLGVTHSPDNTFILSRMQWWRLLKDCQVHVEG-PSLAQVDRLLSNQ-------IHYPNKRLLMRQFLSNLTVLGYHMYHTDYAGKSG----ELAWCLSQLMNNAILPHACSIRGSVFGEAWRAQTALEYASKSWDIYRSLCKTNLYSPHEPTLTARNFLWMLQDFKLISKSLSAAKVMEILSLDNPAISD 493          

HSP 2 Score: 59.6918 bits (143), Expect = 1.747e-9
Identity = 40/144 (27.78%), Postives = 62/144 (43.06%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEG 730
            Y GE  +    G G   + +GNI+EG +     HG G   W +    Y G + + +  G+G + W             +    G  ++P    Y G W  G+RHG G   Y +  +  Y+G+W ++   G G    +SG  YEG
Sbjct:  103 YCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKW-------------LVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQ--YKGEWRQDRKHGSGTFTCKSGQIYEG 231          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 294.664 bits (753), Expect = 2.915e-90
Identity = 163/494 (33.00%), Postives = 263/494 (53.24%), Query Frame = 2
Query:  467 ISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMM--------YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSV--------GSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVID 1900
            + G G Y W DGS Y G+V +GV       +H  G +        YSG W    RHG G V YD  + S+Y G+W+ N+  G+G R+Y SGN YEG+W   +RHG G M+W+   ++Y GQW++G  +G G H W V+R+  SQY + N Y GE+  G RHG G F Y SGA Y+G W  +RK G G F  K+G+IYEG F +D         + G    ++    T    ++   +++A+  +        G     +    L L  +L        + E  Q+   VL H+  +R+ +  YS LG   S DNT ++++MQ+WR LKDC++H    P++A++DR+L++ E  PL+ I  P  ++   +F++ L  + Y++Y  +Y          L  C    M   +LP+AC++ G ++ ++ +   AL + ++    Y+    +    P   ++  R+FL M+++  LI+ SL+A ++++I SLD+P + D
Sbjct:    1 MVGHGTYQWPDGSKYTGNVENGV-------RHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFVED--------VMVGCSQNNIENLATSPFKENISSDLTAKRHLEDKESTAEGGKMLQSSHVDLDLARLLQKFPADKREAEYKQVQFVVLQHIAALRRAYSKYSGLGVTHSPDNTFILSRMQWWRLLKDCQVHVEG-PSLAQVDRLLSTFE-EPLDQIHYPNKRLLMRQFLSNLTVLGYHMYHTDYAGKSG----ELAWCLSQLMNNAILPHACSIRGSVFGEAWRAQTALEYASKSWDIYRSLCKTNLYSPHEPTLTARNFLWMLQDFKLISKSLSAAKVMEILSLDNPAISD 473          

HSP 2 Score: 62.003 bits (149), Expect = 3.495e-10
Identity = 40/144 (27.78%), Postives = 62/144 (43.06%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEG 730
            Y GE  +    G G   + +GNI+EG +     HG G   W +    Y G + + +  G+G + W             +    G  ++P    Y G W  G+RHG G   Y +  +  Y+G+W ++   G G    +SG  YEG
Sbjct:   64 YCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKW-------------LVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQ--YKGEWRQDRKHGSGTFTCKSGQIYEG 192          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002910.1 (pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 gene:ENSPMAG00000002661.1 transcript:ENSPMAT00000002910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.387e-11
Identity = 45/138 (32.61%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQ----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            Y G W    + G G  +Y +G+ YEG +  G RHGHGV++           Y GQW N  + G G              +    Y G + N  RHG G      G +YE  + SNR  G+G  + ++   YEGEF  D
Sbjct:   27 YCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVF---------DDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTAD 155          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.759e-10
Identity = 42/125 (33.60%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  704 YRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGR----IYEGEFEDDRIKE 1066
            Y +G  Y+GEW +G+RHG G +++ D    Y GQ+ NG+ +G G     +   +GS+      +EGEF  GK HG G F+   G  +EG + +    G G   F +G       EG FE++++ +
Sbjct:   10 YATGEEYQGEWKEGRRHGLGQLRFTD-GTHYLGQFENGLFSGCG----VLAFPDGSR------FEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGSHGLPRNEGIFENNKLSK 123          

HSP 2 Score: 52.7582 bits (125), Expect = 2.539e-8
Identity = 41/136 (30.15%), Postives = 58/136 (42.65%), Query Frame = 2
Query:  554 YKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAH 961
            + + +G  Y G W  G RHG G + + TD  + Y G +   +  G G   +  G+ +EGE+ QGK HG GV    D               GM                   ++EGEF NG   G+G  T+P G+H
Sbjct:    8 FTYATGEEYQGEWKEGRRHGLGQLRF-TDG-THYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSD---------------GM-------------------MFEGEFKNGHVEGYGLLTFPDGSH 107          

HSP 3 Score: 49.6766 bits (117), Expect = 2.934e-7
Identity = 28/100 (28.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  785 NEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISL 1084
             E+Y G+W+ G ++G+GQ    ++  +G+ Y       G+F NG   G G   +P G+ +EG +   +  G G F   +G ++EGEF++  ++ +  ++ 
Sbjct:   13 GEEYQGEWKEGRRHGLGQ----LRFTDGTHYL------GQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTF 102          

HSP 4 Score: 46.9802 bits (110), Expect = 2.031e-6
Identity = 28/69 (40.58%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGS 505
            Y G+  NG F G G   F +G+ FEG F +G  HG G F+ +S    +EG+F    + G G  T+ DGS
Sbjct:   39 YLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFS-RSDGMMFEGEFKNGHVEGYGLLTFPDGS 106          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001977.1 (pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-1 gene:ENSPMAG00000001779.1 transcript:ENSPMAT00000001977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 6.382e-10
Identity = 47/149 (31.54%), Postives = 66/149 (44.30%), Query Frame = 2
Query:  353 VNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSS-----YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDR 784
            + G  + G +C+G  HG GR  W    T Y G+F +    G GKYT  + S+     Y G+   G  +G G+YKH  G +Y G  V G RHG+G +                        +   +G  Y G W  GKR G+GV + + R
Sbjct: 1040 LRGAHYYGQWCDGKPHGWGRMTWPDGRT-YIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGML---------------------LSSKGEHAGGVYVGHWASGKRAGYGVYENVSR 1166          

HSP 2 Score: 55.0694 bits (131), Expect = 7.054e-8
Identity = 41/133 (30.83%), Postives = 58/133 (43.61%), Query Frame = 2
Query:  647 SFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLD----RNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAH----YEGFWVSNRKFGKGEFVFKN 1021
            + Y G W      G+G   +  G TY G +  G  HG+G     +    + E+Y G+WR G  NG G +          +++   VYEG    G RHG G      G H    Y G W S ++ G G  V++N
Sbjct: 1043 AHYYGQWCDGKPHGWGRMTWPDGRTYIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLY----------KHADGEVYEGYLVGGVRHGHGMLLSSKGEHAGGVYVGHWASGKRAGYG--VYEN 1163          

HSP 3 Score: 54.299 bits (129), Expect = 1.225e-7
Identity = 33/97 (34.02%), Postives = 46/97 (47.42%), Query Frame = 2
Query:  563 PSGMMYSGLWVNGNRHGNG---TVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVM---KWLDRNEQYTGQWRNGIQNGMG 835
            P G  Y G +  G+ HG G     N  T ++  Y G+W +  I G+G  ++  G  YEG    G RHGHG++   K       Y G W +G + G G
Sbjct: 1063 PDGRTYIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGMLLSSKGEHAGGVYVGHWASGKRAGYG 1159          

HSP 4 Score: 53.9138 bits (128), Expect = 1.954e-7
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  686 GFGFRQYRS--GNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNG 1024
            G+ FR+     G  Y G+W  GK HG G M W D    Y G ++ G ++G G++      +  +    +  Y GE+  GK +G+G + +  G  YEG+ V   + G G  +   G
Sbjct: 1031 GYTFRKLPQLRGAHYYGQWCDGKPHGWGRMTWPD-GRTYIGNFKFGSEHGYGKYT-----VANASTGKKEKYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGMLLSSKG 1139          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Match: EDO30644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T074])

HSP 1 Score: 385.956 bits (990), Expect = 3.049e-123
Identity = 215/554 (38.81%), Postives = 321/554 (57.94%), Query Frame = 2
Query:  269 PTLTELIIERYDGEK-SNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPS-GMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITP-SFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEP-ISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICL 1918
            P LT LI+E Y+G+K   G F G GTA F  G+++ G F  G M G+G++ W +    YEGDF  N I GKG YTW DGS+YEG+V  G+RHG+G Y   +   +YSG W +G RHG G + YD +  S+Y+G W  N+  G+  R Y+ GN YEG+W    RHG G M W DR+++Y GQW  G+Q+G G+H W+++RI GSQY LRN Y+G + NG RHG+G FTY SGA Y G W SN K GKG+++FKNG+++EG FE D + +FP    +G  +PD+            +   +  L  GS  +  P S ++  +   +D ++ + + E   +   +L H+  ++ I+ +YS LGE   S DNT VMT++Q WRFLKDC++H++   T+AE+DR +     N    I  P +K+    F+N +I++A+ V+  E     +  G ++ +C    +  N+L  AC V G L++D  K + A  +  +    Y          P   ++K R FL M+ +  LIN  LT  E+++I + D+P++  + F  L
Sbjct:   55 PILTPLIVESYEGDKDERGFFHGTGTASFQGGHVYSGSFVNGKMEGSGKYVWVN-GIIYEGDFKNNVIDGKGLYTWTDGSTYEGEVESGLRHGQGDYSCSNLPAVYSGEWRHGKRHGRGVLKYDREGHSYYDGHWLNNMRHGYARRVYKGGNVYEGDWKDNLRHGDGSMHWYDRDQRYQGQWEYGVQHGHGEHSWFLRRIAGSQYPLRNYYKGNWVNGLRHGYGVFTYASGAKYVGEWASNMKHGKGKYIFKNGQVFEGTFEQDHMLDFPDFYPSGMTTPDIASAGIPLRPSTPMRAATPFLPAGSVCSNNPLSIRIDPILEDLDLELEDQEAEVRNVTNVMLRHISKLKHIYTYYSGLGEEQTSPDNTFVMTRLQLWRFLKDCKIHHHGV-TLAEMDRFVDQEGRN--TDIHEPQAKVLMRDFVNAIIAIAFNVFHNE---GGHKGGCVIAECTSQLILNNILGNACQVNGSLFADPVKASIAKKYIPKTWDIYMGVCVPSAYTPYEPTLKARQFLYMLNDYKLINEVLTPKEVIQILAQDNPHLAQEDFCNL 601          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Match: EDO49962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER8])

HSP 1 Score: 93.2041 bits (230), Expect = 1.193e-20
Identity = 89/290 (30.69%), Postives = 140/290 (48.28%), Query Frame = 2
Query:  260 NDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGR--FN-------------------WKSTNT-SYEGDFLYNEISGKGKYTWQDGSSYEGD-XXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRIN-GSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            N +  LT    E+YDGE  + +  G+GT  + NG+ + G + EG MHG G   FN                    K TN  +Y G +  ++  GKG+    +G +Y G+ V   +     +    +G +Y G W N  RHG GT  Y+    + YEG+W+ + I+G G   Y + ++Y+G W++  R G G+  +      Y GQ+   +++G G     + R N GS+Y      +GE+ N +    G   Y  GA Y+G W  +R+ G G    K G +YEG +++DR
Sbjct:   26 NGIGVLTYNTGEKYDGEWLDDKQCGIGTLKYPNGDYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGEGEMLYAKNGALYKGQWENSQRHGVGT--YEAPDGTMYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNMRFGKGI--YCFHEGIYEGQFEYDLRHGHG-----LMRYNDGSEY------DGEWQNDQVKSLGSMDYLGGATYDGPWELDRRHGLGRETLKCGTVYEGRWKEDR 300          

HSP 2 Score: 86.2705 bits (212), Expect = 2.190e-18
Identity = 78/240 (32.50%), Postives = 113/240 (47.08%), Query Frame = 2
Query:  398 HGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTV---NYDTDQRSFYEGD------------------WNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            HG G   W++  T YEG F  NE +G G  T+  G  Y+G+ +   + G G  K+P+G  Y G W  G  HG G +   N D+ +  F +GD                  W+K+   G G     +G+TY G +   +  G G M +      Y GQW N  ++G+G +    +  +G+      +YEGE+      G G   YP+   Y+G W  N +FGKG + F  G IYEG+FE D
Sbjct:    3 HGHGVLAWQN-RTRYEGHFEDNERNGIGVLTYNTGEKYDGEWLDDKQCGIGTLKYPNGDYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGEGEMLYAKNGALYKGQWENSQRHGVGTY----EAPDGT------MYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNMRFGKGIYCFHEG-IYEGQFEYD 230          

HSP 3 Score: 66.6254 bits (161), Expect = 8.484e-12
Identity = 49/152 (32.24%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  605 RHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            RHG+G + +    R+ YEG +  N   G G   Y +G  Y+GEW   K+ G G +K+ +  + Y G+WR G  +G G  +          ++ ++  EG F  G     G     +G  Y G W  ++K GKG  V  NG  Y G F +DR+
Sbjct:    2 RHGHGVLAWQN--RTRYEGHFEDNERNGIGVLTYNTGEKYDGEWLDDKQCGIGTLKYPN-GDYYHGEWREGEMHGKGVIV----------FNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRM 140          

HSP 4 Score: 52.7582 bits (125), Expect = 3.034e-7
Identity = 37/114 (32.46%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  746 KRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLT 1087
            +RHGHGV+ W +R  +Y G + +  +NG+G             Y+    Y+GE+ + K+ G G   YP+G +Y G W      GKG  VF N    EG F    I+    +  T
Sbjct:    1 QRHGHGVLAWQNRT-RYEGHFEDNERNGIGVLT----------YNTGEKYDGEWLDDKQCGIGTLKYPNGDYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCT 103          

HSP 5 Score: 50.8322 bits (120), Expect = 1.167e-6
Identity = 47/155 (30.32%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHG 763
            Y G+  N +  G+GT    +G ++EG +    + G GR  + + + SY+G +  N   GKG Y + +G  YEG   + +RHG G+ ++  G  Y G W N      G+++Y     + Y+G W  +   G G    + G  YEG W + ++ G G
Sbjct:  155 YKGQWENSQRHGVGTYEAPDGTMYEGEWSADHIQGRGRMIYPNKD-SYDGSWFRNMRFGKGIYCFHEGI-YEGQFEYDLRHGHGLMRYNDGSEYDGEWQNDQVKSLGSMDYLGG--ATYDGPWELDRRHGLGRETLKCGTVYEGRWKEDRKCGEG 305          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Match: EDO34090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQC6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.806e-18
Identity = 70/231 (30.30%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  296 RYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNR 988
            RY+GE S G+  G G     +G+ +EG F +G + G G   W S+   Y G F+  E+ G G   + DGS YEG+                       W+N  R G+G +       S YEG ++++   G G   Y +G+ YEG+W +  R GHG++K  D    Y GQW            W      G ++               HG G   + SG  YEG WVS R
Sbjct:   13 RYEGEWSKGKKHGHGKLLMADGSFYEGQFMDGEIQGHGFRYWASSRNEYTGQFVKGELHGNGVMKYGDGSQYEGE-----------------------WMNNRREGSGKLM--EKDGSVYEGSFHEHKKHGEGKMIYINGDVYEGDWVKDLRQGHGIIKQED-GTLYAGQW------------W------GDEF---------------HGEGSMVHCSGMAYEGLWVSGR 184          

HSP 2 Score: 79.337 bits (194), Expect = 1.878e-16
Identity = 60/162 (37.04%), Postives = 86/162 (53.09%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSG-NTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y G W  G +HG+G +       SFYEG +    I+G GFR + S  N Y G++ +G+ HG+GVMK+ D   QY G+W N  + G G+    +   +GS      VYEG F   K+HG G   Y +G  YEG WV + + G G    ++G +Y G++  D  
Sbjct:   14 YEGEWSKGKKHGHGKLL--MADGSFYEGQFMDGEIQGHGFRYWASSRNEYTGQFVKGELHGNGVMKYGD-GSQYEGEWMNNRREGSGK----LMEKDGS------VYEGSFHEHKKHGEGKMIYINGDVYEGDWVKDLRQGHGIIKQEDGTLYAGQWWGDEF 162          

HSP 3 Score: 68.1662 bits (165), Expect = 1.137e-12
Identity = 51/148 (34.46%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  611 GNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            G G  NY+ ++   YEG+W+K    G G      G+ YEG++  G+  GHG   W     +YTGQ+  G  +G G     ++  +GSQ      YEGE+ N +R G G      G+ YEG +  ++K G+G+ ++ NG +YEG++  D
Sbjct:    1 GFGVFNYE-NKFFRYEGEWSKGKKHGHGKLLMADGSFYEGQFMDGEIQGHGFRYWASSRNEYTGQFVKGELHGNG----VMKYGDGSQ------YEGEWMNNRREGSGKLMEKDGSVYEGSFHEHKKHGEGKMIYINGDVYEGDWVKD 137          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Match: EDO45129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ4])

HSP 1 Score: 77.411 bits (189), Expect = 3.765e-16
Identity = 58/136 (42.65%), Postives = 77/136 (56.62%), Query Frame = 2
Query:  440 YEGDFLYNE-ISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHI 844
            YEGD   +E   GKGK T  +G  YEG+  HG RHG+G YK  +G  Y+G + NG +HG GT  Y    R  YEG W  +   GFG   Y +G+ YEGEW Q +R+G G+  + +   +Y G W  G  +G G+ I
Sbjct:    2 YEGDRNEDEERHGKGKATLPNGDVYEGEYSHGKRHGQGTYKFKTGGKYTGSYANGKKHGEGTFWYPDGSR--YEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQRNGQGMYTYAETGSKYKGSWVAGKMDGAGELI 135          

HSP 2 Score: 66.2402 bits (160), Expect = 3.208e-12
Identity = 45/137 (32.85%), Postives = 62/137 (45.26%), Query Frame = 2
Query:  650 FYEGDWNKNV-IEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
             YEGD N++    G G     +G+ YEGE+  GKRHG G  K                                  +     Y G + NGK+HG G F YP G+ YEGFW+++ K G G + + NG  YEGE+  ++
Sbjct:    1 MYEGDRNEDEERHGKGKATLPNGDVYEGEYSHGKRHGQGTYK----------------------------------FKTGGKYTGSYANGKKHGEGTFWYPDGSRYEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQ 103          

HSP 3 Score: 63.5438 bits (153), Expect = 2.175e-11
Identity = 50/171 (29.24%), Postives = 78/171 (45.61%), Query Frame = 2
Query:  332 GLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQY-RSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQH 841
            G G A   NG+++EG +  G  HG G + +K T   Y G +   +  G+G + + DGS YE                       G W+N  +HG GT  Y       YEG+W++N   G G   Y  +G+ Y+G W  GK  G G +  +  N +++G  +  +  G G++
Sbjct:   14 GKGKATLPNGDVYEGEYSHGKRHGQGTYKFK-TGGKYTGSYANGKKHGEGTFWYPDGSRYE-----------------------GFWINDEKHGFGTYYYPNG--DAYEGEWSQNQRNGQGMYTYAETGSKYKGSWVAGKMDGAGEL--IHSNHKFSGFMQQNLPKGKGKY 156          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Match: EDO42910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S069])

HSP 1 Score: 72.4034 bits (176), Expect = 3.150e-14
Identity = 57/146 (39.04%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  437 SYEGDF-LYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGS 871
            +YEGD     E  G GK T  +  +YEG   HG RHG G Y+  +G  Y G +  G +HG GT  Y    R  YEG W ++   G G   Y +G+TYEG WY+ +RHG G   + +   +Y G W +G ++G G+ I    R  GS
Sbjct:   19 TYEGDRNEAEERHGFGKTTLPNSDTYEGQYEHGKRHGNGTYRFKNGAKYVGEYSKGKKHGQGTFWYPDGSR--YEGGWVEDRRNGHGTYYYPNGDTYEGNWYEHQRHGQGTYTYANTRTKYQGTWMHGKRDGSGELIHANHRYVGS 162          

HSP 2 Score: 65.4698 bits (158), Expect = 6.444e-12
Identity = 45/130 (34.62%), Postives = 62/130 (47.69%), Query Frame = 2
Query:  653 YEGDWNK-NVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEG 1039
            YEGD N+     GFG     + +TYEG++  GKRHG+G  ++           +NG +                       Y GE+  GK+HG G F YP G+ YEG WV +R+ G G + + NG  YEG
Sbjct:   20 YEGDRNEAEERHGFGKTTLPNSDTYEGQYEHGKRHGNGTYRF-----------KNGAK-----------------------YVGEYSKGKKHGQGTFWYPDGSRYEGGWVEDRRNGHGTYYYPNGDTYEG 115          

HSP 3 Score: 61.2326 bits (147), Expect = 2.098e-10
Identity = 42/121 (34.71%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  332 GLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFG 694
            G G     N + +EG +  G  HG G + +K+    Y G++   +  G+G + + DGS YEG  V   R+G G Y +P+G  Y G W    RHG GT  Y  + R+ Y+G W     +G G
Sbjct:   32 GFGKTTLPNSDTYEGQYEHGKRHGNGTYRFKN-GAKYVGEYSKGKKHGQGTFWYPDGSRYEGGWVEDRRNGHGTYYYPNGDTYEGNWYEHQRHGQGTYTY-ANTRTKYQGTWMHGKRDGSG 150          

HSP 4 Score: 60.4622 bits (145), Expect = 4.155e-10
Identity = 48/165 (29.09%), Postives = 72/165 (43.64%), Query Frame = 2
Query:  563 PSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYP-SGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            P+   Y G + +G RHGNGT                          ++++G  Y GE+ +GK+HG G   W     +Y G W    +NG G +           Y   + YEG +   +RHG G +TY  +   Y+G W+  ++ G GE +  N R Y G F +D
Sbjct:   39 PNSDTYEGQYEHGKRHGNGTY-------------------------RFKNGAKYVGEYSKGKKHGQGTF-WYPDGSRYEGGWVEDRRNGHGTYY----------YPNGDTYEGNWYEHQRHGQGTYTYANTRTKYQGTWMHGKRDGSGELIHANHR-YVGSFAED 166          

HSP 5 Score: 55.0694 bits (131), Expect = 2.449e-8
Identity = 38/110 (34.55%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  299 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHP-SGMMYSGLWVNGNRHGNGTV 625
            Y+G+  +G+  G GT  F NG  + G + +G  HG G F W    + YEG ++ +  +G G Y + +G +YEG+     RHG+G Y +  +   Y G W++G R G+G +
Sbjct:   44 YEGQYEHGKRHGNGTYRFKNGAKYVGEYSKGKKHGQGTF-WYPDGSRYEGGWVEDRRNGHGTYYYPNGDTYEGNWYEHQRHGQGTYTYANTRTKYQGTWMHGKRDGSGEL 152          

HSP 6 Score: 47.3654 bits (111), Expect = 7.698e-6
Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  887 NVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            + YEG++ +GKRHG G + + +GA Y G +   +K G+G F + +G  YEG + +DR
Sbjct:   42 DTYEGQYEHGKRHGNGTYRFKNGAKYVGEYSKGKKHGQGTFWYPDGSRYEGGWVEDR 98          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:101169070])

HSP 1 Score: 284.648 bits (727), Expect = 6.951e-84
Identity = 178/484 (36.78%), Postives = 260/484 (53.72%), Query Frame = 2
Query:  245 DSFSFNDLPTLTELI--IERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIY-KHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSD 1687
            D   +N+ P L  ++  I+R   E     F G    +F  G++ +GMF +G M G G F       +YEG+F+ N  +G+GK+TW DGS+Y G VV GVRHG G +    +G+ Y+G W  G RHG GTV Y+  + S+Y+GDW  N  EG G R Y SGNTY GEW    RHG G MKWL   +QY G+W  G+Q+G G H+W  +R  G QY   N Y G+F +G+RHG G F Y  GA YEG W +N+K G+G+   KNG I++GEF+DD++       L+G  SP L+                            P   L +  +L        D E  Q+   VL     +R I+ FYS LG      NT +++++QFW  LKDC +H+    T+ +++R++  + T P   I +P + + F   ++ LI +A++++S++  +  N    LL  CF   +T ++LP A  V G L+ +
Sbjct:   15 DKAKWNEDPELIVVLLNIKRVREESCEDEFSGQREVYFEGGHVHKGMFSKGLMDGWGIFT-HLNGLTYEGEFVRNIPTGRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKREGGLQYFQNNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNNKKHGQGKLTSKNGHIFKGEFKDDKMMT---PDLSGIRSPSLS---------------------------GPDRILNIECLLRKIPQRKQDTECKQVEFVVLQRDSQLRSIYSFYSRLGHSDCPHNTFLLSRLQFWCLLKDCSIHHRG-ITLTQINRLIPGN-TGPE--IHSPFTSMLFHELLSSLIIIAFHIHSKDMKSQRN----LLASCFSKLVTDDILPNATKVKGFLFRE 459          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Match: ENSORLT00000030376.1 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 73.559 bits (179), Expect = 4.078e-14
Identity = 43/116 (37.07%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  710 SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +G+ Y GEW   ++HG G+  W +    Y G+WR G  +G G +  YV       Y  +  Y+GE+ NGK+HG+G + Y + A YEG W   ++ G+G+   +N  IYEGE+  D+
Sbjct:   34 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTY--YVLDPESKGYVWK--YDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDK 145          

HSP 2 Score: 70.4774 bits (171), Expect = 5.629e-13
Identity = 46/141 (32.62%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYR-SGNTYEGEWYQGKRHGHGVMKWLDRNEQ-----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            Y G+W  N   G G + ++ +G  Y GEW  GK  G+G    LD   +     Y G+W+NG ++G G +           Y+   VYEGE+  G+R G G   + +   YEG W+ +++ G+G+ ++ NG  YEG ++D +
Sbjct:   38 YTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYF----------YNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGK 168          

HSP 3 Score: 67.781 bits (164), Expect = 4.436e-12
Identity = 55/165 (33.33%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  341 TAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSS------YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNG 817
            T F +NG+ + G + +   HG G   WK+T   Y G++ + +  G G Y   D  S      Y+G+  +G +HG GIY + +  +Y G W  G R G G + ++   R  YEG+W  +   G G   Y +G+ YEG W  GKR+G G     ++   Y G W +G
Sbjct:   29 TVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHEN--RDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG 191          

HSP 4 Score: 63.1586 bits (152), Expect = 1.360e-10
Identity = 52/204 (25.49%), Postives = 92/204 (45.10%), Query Frame = 2
Query:  566 SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNT------YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGE-FVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNM 1156
            +G  Y+G W +  +HG G   +  +  + Y G+W     +G+G        +      Y+GEW  GK+HG+G+  + +    Y G+W  G ++G G+            +  R++YEGE+   K HG G   Y +G+ YEG W   ++ G G+ +  + G +Y G + D   K           +P+ +  K  ++     D +
Sbjct:   34 NGDKYTGEWQDNRKHGIGIQMW-KNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIY-FYNNTAVYEGEWSEGQRSGRGKMF----------HENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDKAPEPSKCKFPKVKHRKKDQV 225          

HSP 5 Score: 58.151 bits (139), Expect = 7.086e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 2
Query:  290 IERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGD-XXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQ 643
            + +YDGE  NG+  G G  F+ N  ++EG + EG   G G+  +      YEG+++ ++  G+GK  + +GS YEG             Y    G++Y G W++G         Y+ D+
Sbjct:   88 VWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKM-FHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDK 205          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Match: ENSORLT00000019355.2 (alsin-like [Source:NCBI gene;Acc:101160203])

HSP 1 Score: 77.411 bits (189), Expect = 6.309e-14
Identity = 54/173 (31.21%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  557 KHPSGMMYSGLWVNGNRHGNGTV---NYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK--WLDR--NEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            K P G +Y G + NG   G G     N ++++   Y+G W +  I GFG  +Y SG  YEG +++G+RHG+G++    L R  +  + G W +G + G G        I   Q      Y G + + +RHG        G ++EG +  N+  G G  V ++   + GEF DD
Sbjct: 1042 KWPDGRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYG----VFDDITRGQK-----YMGLWLDDQRHGNAIVISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDD 1205          

HSP 2 Score: 64.3142 bits (155), Expect = 5.717e-10
Identity = 47/136 (34.56%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  722 YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMG---------------QHIWYVQRING---SQYSLRNVYEGEFCNGKRHGWGC-----FTYPSGAHYEGFWVSNRKFGKGEF-VFKNGRIYEGEFEDDR 1057
            Y G W  G+ HG G +KW D    Y G ++NG+++G G               Q  W   RI+G    +Y+   VYEG F  G+RHG+G       T  S + + G WV  RK G G F     G+ Y G + DD+
Sbjct: 1026 YTGGWLAGRLHGSGTLKWPD-GRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQ 1160          

HSP 3 Score: 63.929 bits (154), Expect = 7.007e-10
Identity = 43/167 (25.75%), Postives = 89/167 (53.29%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGF-----RQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFT-YPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y+G W+ G  HG+GT+ +  D R  Y+G++   + +G+G      ++    ++Y+G+W +G+ HG G  K+    E Y G +  G ++G G  +    ++  +  S+   + G + +G++ G+G F     G  Y G W+ +++ G    + ++G  +EG F ++++
Sbjct: 1026 YTGGWLAGRLHGSGTLKWP-DGR-LYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYAS-GEVYEGCFWEGQRHGYG--MLSSGKLTRTSSSM---FIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQRHGNAIVISQHGVYFEGTFRENKM 1184          

HSP 4 Score: 53.1434 bits (126), Expect = 1.402e-6
Identity = 43/185 (23.24%), Postives = 81/185 (43.78%), Query Frame = 2
Query:  293 ERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFN----WKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQG-KRHGHGVMKWLDRNE---QYTGQWRNGIQ 823
            + Y G+   GR  G G   + +G ++EG F EG  HG G  +     +++++ + G +++   +G G +                     I +   G  Y GLW++  RHGN  V   +    ++EG + +N + G G        T+ GE+       G GV+   + +     ++G+W +G++
Sbjct: 1075 DSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVF-------------------DDITR---GQKYMGLWLDDQRHGNAIV--ISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDDWTVSGKGVLFLANGDSLDGMFSGEWSSGLK 1235          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Match: ENSORLT00000036843.1 (alsin-like [Source:NCBI gene;Acc:101160203])

HSP 1 Score: 77.411 bits (189), Expect = 6.317e-14
Identity = 54/173 (31.21%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  557 KHPSGMMYSGLWVNGNRHGNGTV---NYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK--WLDR--NEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDD 1054
            K P G +Y G + NG   G G     N ++++   Y+G W +  I GFG  +Y SG  YEG +++G+RHG+G++    L R  +  + G W +G + G G        I   Q      Y G + + +RHG        G ++EG +  N+  G G  V ++   + GEF DD
Sbjct: 1050 KWPDGRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYG----VFDDITRGQK-----YMGLWLDDQRHGNAIVISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDD 1213          

HSP 2 Score: 64.3142 bits (155), Expect = 5.579e-10
Identity = 47/136 (34.56%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  722 YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMG---------------QHIWYVQRING---SQYSLRNVYEGEFCNGKRHGWGC-----FTYPSGAHYEGFWVSNRKFGKGEF-VFKNGRIYEGEFEDDR 1057
            Y G W  G+ HG G +KW D    Y G ++NG+++G G               Q  W   RI+G    +Y+   VYEG F  G+RHG+G       T  S + + G WV  RK G G F     G+ Y G + DD+
Sbjct: 1034 YTGGWLAGRLHGSGTLKWPD-GRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQ 1168          

HSP 3 Score: 63.929 bits (154), Expect = 7.073e-10
Identity = 43/167 (25.75%), Postives = 89/167 (53.29%), Query Frame = 2
Query:  578 YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGF-----RQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFT-YPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRI 1060
            Y+G W+ G  HG+GT+ +  D R  Y+G++   + +G+G      ++    ++Y+G+W +G+ HG G  K+    E Y G +  G ++G G  +    ++  +  S+   + G + +G++ G+G F     G  Y G W+ +++ G    + ++G  +EG F ++++
Sbjct: 1034 YTGGWLAGRLHGSGTLKWP-DGR-LYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYAS-GEVYEGCFWEGQRHGYG--MLSSGKLTRTSSSM---FIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQRHGNAIVISQHGVYFEGTFRENKM 1192          

HSP 4 Score: 53.1434 bits (126), Expect = 1.391e-6
Identity = 43/185 (23.24%), Postives = 81/185 (43.78%), Query Frame = 2
Query:  293 ERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFN----WKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQG-KRHGHGVMKWLDRNE---QYTGQWRNGIQ 823
            + Y G+   GR  G G   + +G ++EG F EG  HG G  +     +++++ + G +++   +G G +                     I +   G  Y GLW++  RHGN  V   +    ++EG + +N + G G        T+ GE+       G GV+   + +     ++G+W +G++
Sbjct: 1083 DSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVF-------------------DDITR---GQKYMGLWLDDQRHGNAIV--ISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDDWTVSGKGVLFLANGDSLDGMFSGEWSSGLK 1243          
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Match: ENSORLT00000010654.2 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 72.7886 bits (177), Expect = 8.719e-14
Identity = 43/116 (37.07%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  710 SGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            +G+ Y GEW   ++HG G+  W +    Y G+WR G  +G G   +YV       Y  +  Y+GE+ NGK+HG+G + Y + A YEG W   ++ G+G+   +N  IYEGE+  D+
Sbjct:   28 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYG--TYYVLDPESKGYVWK--YDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDK 139          

HSP 2 Score: 69.3218 bits (168), Expect = 1.139e-12
Identity = 46/141 (32.62%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  653 YEGDWNKNVIEGFGFRQYR-SGNTYEGEWYQGKRHGHGVMKWLDRNEQ-----YTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDR 1057
            Y G+W  N   G G + ++ +G  Y GEW  GK  G+G    LD   +     Y G+W+NG ++G G +           Y+   VYEGE+  G+R G G   + +   YEG W+ +++ G+G+ ++ NG  YEG ++D +
Sbjct:   32 YTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYF----------YNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGK 162          

HSP 3 Score: 67.3958 bits (163), Expect = 4.930e-12
Identity = 55/165 (33.33%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  341 TAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSS------YEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNG 817
            T F +NG+ + G + +   HG G   WK+T   Y G++ + +  G G Y   D  S      Y+G+  +G +HG GIY + +  +Y G W  G R G G + ++   R  YEG+W  +   G G   Y +G+ YEG W  GKR+G G     ++   Y G W +G
Sbjct:   23 TVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHEN--RDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG 185          

HSP 4 Score: 62.7734 bits (151), Expect = 2.106e-10
Identity = 53/204 (25.98%), Postives = 93/204 (45.59%), Query Frame = 2
Query:  566 SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNT------YEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGE-FVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNM 1156
            +G  Y+G W +  +HG G   +  +  + Y G+W     +G+G        +      Y+GEW  GK+HG+G+  + +    Y G+W  G ++G G+            +  R++YEGE+   K HG G   Y +G+ YEG W   ++ G G+ +  + G +Y G + D   K           +P+ +  K  +L   D + +
Sbjct:   28 NGDKYTGEWQDNRKHGIGIQMW-KNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIY-FYNNTAVYEGEWSEGQRSGRGKMF----------HENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDKAPEPSKCKFPKLHLVDPEQV 219          

HSP 5 Score: 58.151 bits (139), Expect = 6.251e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 2
Query:  290 IERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGD-XXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQ 643
            + +YDGE  NG+  G G  F+ N  ++EG + EG   G G+  +      YEG+++ ++  G+GK  + +GS YEG             Y    G++Y G W++G         Y+ D+
Sbjct:   82 VWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKM-FHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDK 199          
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Match: SMESG000039153.1 (SMESG000039153.1)

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 558/559 (99.82%), Postives = 558/559 (99.82%), Query Frame = 2
Query:   89 HTASSNSSNLLDDKKSILGDIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDXXXXXXXXXXIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQ 1765
            HTASSNSSNLLDDKKSILGDIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRK GKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQ
Sbjct:   20 HTASSNSSNLLDDKKSILGDIPASETVSQMSHDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKSGKGEFVFKNGRIYEGEFEDDRIKEFPFISLTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILMDPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQMQFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFINYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLYSDSRKTNQALSHFNEMLITYKEFSYSKQ 578          
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Match: SMESG000039156.1 (SMESG000039156.1)

HSP 1 Score: 525.783 bits (1353), Expect = 0.000e+0
Identity = 293/295 (99.32%), Postives = 294/295 (99.66%), Query Frame = 2
Query: 1787 MKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLXXXXXXXXXXXXXXNCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 2671
            MKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTT+ RSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD
Sbjct:    1 MKMRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTTNTRSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 295          
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Match: SMESG000039156.1 (SMESG000039156.1)

HSP 1 Score: 521.546 bits (1342), Expect = 5.394e-180
Identity = 291/293 (99.32%), Postives = 292/293 (99.66%), Query Frame = 2
Query: 1793 MRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLXXXXXXXXXXXXXXNCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 2671
            MRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTT+ RSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD
Sbjct:    1 MRDFLIMMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTTNTRSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 293          
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Match: SMESG000039156.1 (SMESG000039156.1)

HSP 1 Score: 508.449 bits (1308), Expect = 5.486e-175
Identity = 285/287 (99.30%), Postives = 286/287 (99.65%), Query Frame = 2
Query: 1811 MMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLXXXXXXXXXXXXXXNCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 2671
            MMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTT+ RSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD
Sbjct:    1 MMKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTTNTRSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 287          
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Match: SMESG000039156.1 (SMESG000039156.1)

HSP 1 Score: 505.753 bits (1301), Expect = 4.700e-174
Identity = 284/286 (99.30%), Postives = 285/286 (99.65%), Query Frame = 2
Query: 1814 MKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLXXXXXXXXXXXXXXNCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDXXXXXXXXXXXXXXXXPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 2671
            MKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTT+ RSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD
Sbjct:    1 MKNLNLINSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYITKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQEDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTTNTRSKGKSIKSSKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSFSQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKIILDKDSVTDSTNQLKVLPVEQDQEIEEKSVD 286          
The following BLAST results are available for this feature:
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH10B22.829e-13843.12radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B22.829e-13843.12radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B22.829e-13843.12radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B2.737e-13642.93radial spoke head 10 homolog B [Source:HGNC Symbol... [more]
RSPH10B2.737e-13642.93radial spoke head 10 homolog B [Source:HGNC Symbol... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-17.624e-1032.89JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jp3.573e-1134.84gene:FBgn0032129 transcript:FBtr0079861[more]
jp3.573e-1134.84gene:FBgn0032129 transcript:FBtr0079860[more]
jp3.573e-1134.84gene:FBgn0032129 transcript:FBtr0304056[more]
jp3.573e-1134.84gene:FBgn0032129 transcript:FBtr0304057[more]
CG144905.580e-1035.29gene:FBgn0034281 transcript:FBtr0086801[more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b1.346e-10736.30radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b2.542e-10736.12radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
als2b3.974e-1631.25alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2a8.439e-1627.98alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
BX571704.11.002e-1531.65alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000041392.11.894e-9938.51radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041404.12.604e-9537.10radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041411.11.268e-8440.71radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
igf26.781e-1832.22insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf28.173e-1832.22insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rsph10b2.162e-13541.82radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
Rsph10b2.456e-3938.35radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
Rsph10b6.351e-2444.06radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
Morn18.501e-1434.31MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
Morn31.335e-1335.03MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RC85|R10B2_HUMAN1.358e-13743.12Radial spoke head 10 homolog B2 OS=Homo sapiens OX... [more]
sp|P0C881|R10B1_HUMAN1.314e-13542.93Radial spoke head 10 homolog B OS=Homo sapiens OX=... [more]
sp|E9PYQ0|RS10B_MOUSE1.512e-13441.82Radial spoke head 10 homolog B OS=Mus musculus OX=... [more]
sp|Q66HB5|RS10B_RAT1.792e-13242.96Radial spoke head 10 homolog B OS=Rattus norvegicu... [more]
sp|Q1JPG1|RS10B_BOVIN5.577e-13240.39Radial spoke head 10 homolog B OS=Bos taurus OX=99... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1A0I01.529e-16337.74Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1QT605.879e-16046.72Radial spoke head 10-like protein B2 OS=Crassostre... [more]
R7UYD41.091e-15836.35Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210Q4K13.329e-15844.61Radial spoke head 10-like B2 OS=Mizuhopecten yesso... [more]
A0A1S3J1Z23.303e-15140.85radial spoke head 10 homolog B OS=Lingula unguis O... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b3.005e-12839.27radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b4.602e-12839.27radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
als2b2.117e-1731.16alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2b2.138e-1731.16alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
morn31.098e-1430.89MORN repeat-containing protein 3 [Source:NCBI gene... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH10B25.538e-9933.52radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B22.915e-9033.00radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
ENSPMAT00000002910.12.387e-1132.61pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 g... [more]
ENSPMAT00000003398.11.759e-1033.60pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
ENSPMAT00000001977.16.382e-1031.54pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO306443.049e-12338.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499621.193e-2030.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340901.806e-1830.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451293.765e-1642.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429103.150e-1439.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b6.951e-8436.78radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
ENSORLT00000030376.14.078e-1437.07MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000019355.26.309e-1431.21alsin-like [Source:NCBI gene;Acc:101160203][more]
ENSORLT00000036843.16.317e-1431.21alsin-like [Source:NCBI gene;Acc:101160203][more]
ENSORLT00000010654.28.719e-1437.07MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Radial spoke head 10-like protein B2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039153.10.000e+099.82SMESG000039153.1[more]
SMESG000039156.10.000e+099.32SMESG000039156.1[more]
SMESG000039156.15.394e-18099.32SMESG000039156.1[more]
SMESG000039156.15.486e-17599.30SMESG000039156.1[more]
SMESG000039156.14.700e-17499.30SMESG000039156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010320 ID=SMED30010320|Name=Radial spoke head 10-like protein B2|organism=Schmidtea mediterranea sexual|type=transcript|length=2721bp
GATTTAATTGGTGTAATATTTTAAATTTCAAATGACTAGTAAAAAATCTA
AAACTTCTAAATCAGATTCTCGTTCTAAAAAACGCTCTCATACTGCTTCC
TCCAATAGTTCAAATTTGTTAGATGATAAAAAAAGTATTTTGGGAGATAT
TCCGGCTTCTGAAACAGTTTCCCAAATGTCTCATGACGAATTCCCATTGG
ATGAAAAAGTCATTGAAGACACAGTTGCTGTAGAAACAATTATTGATTCA
TTTTCTTTTAATGATTTACCGACACTTACTGAATTAATAATTGAAAGATA
TGATGGTGAAAAATCAAATGGTAGATTTGAAGGTCTCGGTACAGCTTTTT
TCGTTAATGGAAATATTTTTGAGGGAATGTTCTGTGAAGGAACAATGCAT
GGAACAGGTCGATTCAATTGGAAATCTACAAATACATCATATGAAGGAGA
TTTTCTTTACAATGAAATTTCAGGAAAAGGAAAATATACATGGCAAGATG
GGAGTTCTTATGAAGGAGATGTAGTTCACGGAGTTAGACATGGCCGAGGA
ATTTATAAACATCCCTCTGGTATGATGTATTCGGGATTATGGGTTAATGG
GAACAGGCACGGAAATGGAACTGTAAATTATGATACAGATCAGAGATCTT
TTTATGAAGGAGATTGGAATAAAAATGTAATTGAAGGGTTTGGTTTCAGA
CAATATAGAAGTGGAAACACATATGAAGGAGAATGGTATCAAGGGAAAAG
ACACGGGCATGGAGTAATGAAATGGTTAGACCGCAATGAGCAGTATACCG
GACAATGGCGAAACGGCATTCAGAATGGAATGGGTCAGCATATTTGGTAT
GTTCAGAGAATCAATGGATCTCAGTATTCACTTCGAAATGTTTATGAAGG
AGAATTCTGCAATGGAAAACGACATGGCTGGGGATGTTTTACTTACCCCA
GTGGTGCGCACTATGAAGGTTTTTGGGTTAGCAATAGAAAATTTGGAAAG
GGAGAATTTGTGTTTAAAAATGGTAGAATATATGAAGGAGAATTTGAAGA
TGACCGAATTAAAGAGTTTCCTTTTATTTCTTTAACAGGAAGAGATTCGC
CGGACTTAAATATTCACAAGACTCAACAACTAATGCAAGATGATATCGAT
AATATGAGTGCAAGATTGTCGGTCGGTAGTTTCAATACAATAACTCCAAG
TTTCCAGTTATACCTTGTGCACATATTAATGGATCCACAAATAGCCAATC
CGGATGAAGAATCTATACAAATACATAAAGCTGTTCTGGCTCACTTGGGT
ATGATAAGAAAAATCCATCAATTCTATAGTACTTTGGGTGAACCTATATC
AGTTGATAATACGTCGGTCATGACACAAATGCAATTTTGGAGATTCCTTA
AAGATTGTCGACTGCATTACAATTCAAGACCAACAATTGCTGAATTAGAT
AGAGTTTTAGCATCATCTGAAACTAATCCGTTGGAAATCATACAAAATCC
TTTGTCAAAAATTACATTCCTGCGTTTCATTAATTATTTGATATCAGTTG
CCTATTATGTTTACTCGGAAGAATACATTAACGACGAAAATTTCTCTGGT
TATTTATTGGACAAATGTTTTGACTCTTTTATGACTAGAAACGTTCTGCC
ATACGCATGCAATGTTGGTGGGGTTCTTTATTCAGATTCAAGAAAGACAA
ATCAAGCTTTATCTCATTTCAATGAAATGCTTATTACATATAAAGAATTT
TCCTATTCAAAACAAGGCTTCCCGCAATATTATTCAATGAAAATGAGAGA
TTTTTTAATCATGATGAAGAATCTCAACCTCATTAATTCCTCTCTTACGG
CAACTGAAATTGTAAAGATATTTTCGTTAGATGATCCGAACGTAATTGAT
GACCAATTTATCTGTTTAGAAATTGAGATAACATTCTATGAATTCTTTGA
AATTATGATCAATTGTGCAACGAAATACATCACAAAGGATATCATTGATA
TTTACTTGAAAAATGAAGATAAAAAAACACATCAAACGAATATATCGGAA
AACTTGGAGGACTCTGAAACGGAACCAACTTTAACAATTTCTCGACCGGT
TACTGGAGATTCAAATAAATTAGACTTCCAAGAAGATGATAAATCTAATG
TACGTAATCACGGAAAACCCCAATCAGGAAAAAATAAAGTTTCTTCTGCT
GATAGTAGTAATTCCAAAACTCGTAAACAAGATCCGGATAAAACTACAAG
TATACGAAGTAAAGGGAAAAGTATAAAGAGCTCAAAACCGGTTAATAATC
GGGGTAGAAAGTTATCTGTTGATAAGGAATTGGCAAATCCGATAAAGCAA
CCGGTAGCTTCCATTTCAGCGGAAATGCTAAGTATTCCAGAAGTAAATCT
GAAAGATGATGAATCACTGCCAGATAGTTTCAGTCAAACCAAAACTCTCC
TTCCAGAGTTGGAAAATCAAGAATCAAATGAAGAACGGCAATTTAACTTC
TGGACTCATCAGTTGCACATGTTCTTTTGCAATTTTTTATTTCCTTCTGC
TACAAAATATTCAATGATAAGCAAGATTATCCTAGATAAAGATTCTGTTA
CAGATTCCACAAACCAATTGAAAGTACTTCCAGTAGAACAAGACCAGGAA
ATAGAAGAAAAATCAGTCGATTGAAATGAAAACTAAAATAATATTCTAAA
TACATTTTAATTATGACGGAG
back to top

protein sequence of SMED30010320-orf-1

>SMED30010320-orf-1 ID=SMED30010320-orf-1|Name=SMED30010320-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=881bp
MTSKKSKTSKSDSRSKKRSHTASSNSSNLLDDKKSILGDIPASETVSQMS
HDEFPLDEKVIEDTVAVETIIDSFSFNDLPTLTELIIERYDGEKSNGRFE
GLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKG
KYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLWVNGNRHGNGTVNY
DTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLD
RNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGW
GCFTYPSGAHYEGFWVSNRKFGKGEFVFKNGRIYEGEFEDDRIKEFPFIS
LTGRDSPDLNIHKTQQLMQDDIDNMSARLSVGSFNTITPSFQLYLVHILM
DPQIANPDEESIQIHKAVLAHLGMIRKIHQFYSTLGEPISVDNTSVMTQM
QFWRFLKDCRLHYNSRPTIAELDRVLASSETNPLEIIQNPLSKITFLRFI
NYLISVAYYVYSEEYINDENFSGYLLDKCFDSFMTRNVLPYACNVGGVLY
SDSRKTNQALSHFNEMLITYKEFSYSKQGFPQYYSMKMRDFLIMMKNLNL
INSSLTATEIVKIFSLDDPNVIDDQFICLEIEITFYEFFEIMINCATKYI
TKDIIDIYLKNEDKKTHQTNISENLEDSETEPTLTISRPVTGDSNKLDFQ
EDDKSNVRNHGKPQSGKNKVSSADSSNSKTRKQDPDKTTSIRSKGKSIKS
SKPVNNRGRKLSVDKELANPIKQPVASISAEMLSIPEVNLKDDESLPDSF
SQTKTLLPELENQESNEERQFNFWTHQLHMFFCNFLFPSATKYSMISKII
LDKDSVTDSTNQLKVLPVEQDQEIEEKSVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003409MORN motifSMARTSM00698morncoord: 111..132
e-value: 6.0
score: 8.3
coord: 88..109
e-value: 2.7
score: 10.8
coord: 253..274
e-value: 1.7
score: 12.3
coord: 206..227
e-value: 1.3
score: 13.2
coord: 309..330
e-value: 0.0086
score: 25.3
coord: 181..202
e-value: 9.1
score: 6.9
coord: 158..179
e-value: 0.5
score: 16.3
coord: 286..307
e-value: 4.1E-4
score: 29.7
coord: 135..156
e-value: 0.11
score: 21.2
coord: 229..250
e-value: 5.6E-7
score: 39.2
IPR003409MORN motifPFAMPF02493MORNcoord: 311..331
e-value: 0.0058
score: 16.5
coord: 90..111
e-value: 0.098
score: 12.6
coord: 208..230
e-value: 0.0072
score: 16.2
coord: 137..158
e-value: 6.9E-5
score: 22.5
coord: 231..248
e-value: 1.2E-5
score: 24.9
coord: 288..308
e-value: 0.0027
score: 17.5
coord: 160..181
e-value: 0.0011
score: 18.7
coord: 183..197
e-value: 0.037
score: 13.9
coord: 255..272
e-value: 0.22
score: 11.5
NoneNo IPR availableGENE3DG3DSA:2.20.110.10coord: 271..354
e-value: 2.5E-11
score: 45.6
coord: 138..215
e-value: 1.5E-13
score: 52.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 711..728
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..35
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 729..743
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 695..710
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 675..694
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..767
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
NoneNo IPR availablePANTHERPTHR46613FAMILY NOT NAMEDcoord: 77..870
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 287..342
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 154..272