Echinoderm microtubule-associated protein-like 4

Overview
NameEchinoderm microtubule-associated protein-like 4
Smed IDSMED30010316
Length (bp)6541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Echinoderm microtubule-associated protein-like 4 (SMED30010316) t-SNE clustered cells

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30010316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Echinoderm microtubule-associated protein-like 4 (SMED30010316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30010316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010316SMESG000027261.1 SmedASXL_018420SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010316SMESG000027261.1 Contig49888newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010316SMESG000027261.1 Contig49888uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30010316SMESG000027261.1 dd_Smed_v6_10540_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010316SMESG000027261.1 dd_Smed_v4_10540_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 2050.02 bits (5310), Expect = 0.000e+0
Identity = 1037/2039 (50.86%), Postives = 1400/2039 (68.66%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T S+LKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+  NL R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L ++ P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   +GA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS LSD+   +S++E+EAQ NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N    +QR Y  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +PH+ ++LV VG+K I+FW Q GGGFT+KRGTFG+V KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  + H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGA+EQLFFEAPRG R II  +EIEKI W +W+CVLG +C GIWP   DITDVN+ SLT D  +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W   R+ V  ++S       +  S+ SDTD EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP    +  S    +  VSR      K+Q                  N  T  ++L           V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA GIV NL +G QSF+LEH DDILCLTVN+HPKYRNVVAT QIG  PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+ EFRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G I S  +   +M TMLSVAF  N+ T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + +     E +RS+ R KGKIL+GT+D +I+E+ EK      L+  H EG + GLA HP    + SAS DGT RIWDL  K L+  ++ G  A C  YSP+G  + IG+K+G F +L   S ++  +K+DR   I DI+ SP++  +AVGS+++ VD Y L            Q  N    L+R  YCKD+ S  +Q+DFS DG +I+     YK +++    G+ V E   IEKI W SW+SV+G+EV GIWP  +DKADVN A V+H     VTGDD+GLVKL+  FP           +  + GHS++VTN+RF  DD ++VSTGG+DC VFVW+C
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRMPSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGTFGSVGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDILLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-AQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--REFVGTQES------KLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKPHQQLKEVSVEE-RPPVSRAAPQPEKLQ-----------------KNNITKKKKL-----------VEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGS--LGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQLV-----ECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDL-----------TQGTN----LNRIGYCKDIPSFVIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAVVIEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 2050.02 bits (5310), Expect = 0.000e+0
Identity = 1037/2039 (50.86%), Postives = 1400/2039 (68.66%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T S+LKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+  NL R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L ++ P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   +GA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS LSD+   +S++E+EAQ NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N    +QR Y  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +PH+ ++LV VG+K I+FW Q GGGFT+KRGTFG+V KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  + H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGA+EQLFFEAPRG R II  +EIEKI W +W+CVLG +C GIWP   DITDVN+ SLT D  +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W   R+ V  ++S       +  S+ SDTD EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP    +  S    +  VSR      K+Q                  N  T  ++L           V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA GIV NL +G QSF+LEH DDILCLTVN+HPKYRNVVAT QIG  PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+ EFRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G I S  +   +M TMLSVAF  N+ T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + +     E +RS+ R KGKIL+GT+D +I+E+ EK      L+  H EG + GLA HP    + SAS DGT RIWDL  K L+  ++ G  A C  YSP+G  + IG+K+G F +L   S ++  +K+DR   I DI+ SP++  +AVGS+++ VD Y L            Q  N    L+R  YCKD+ S  +Q+DFS DG +I+     YK +++    G+ V E   IEKI W SW+SV+G+EV GIWP  +DKADVN A V+H     VTGDD+GLVKL+  FP           +  + GHS++VTN+RF  DD ++VSTGG+DC VFVW+C
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRMPSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGTFGSVGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDILLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-AQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--REFVGTQES------KLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKPHQQLKEVSVEE-RPPVSRAAPQPEKLQ-----------------KNNITKKKKL-----------VEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGS--LGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQLV-----ECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDL-----------TQGTN----LNRIGYCKDIPSFVIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAVVIEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML5 (EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197])

HSP 1 Score: 1942.55 bits (5031), Expect = 0.000e+0
Identity = 994/2047 (48.56%), Postives = 1378/2047 (67.32%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q +Y  H+DDIIS+AL  +  LVATGQVGK P+ICIW+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+GK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G  + L ++ PGG+ +T T+ +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G++KLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       DS +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++AP   ++L +VHGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IH+WDT+T+K +SILKG H+ GV AVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+  R  KDKIF++K +P+  ++L+  G+K ++FW + GGG   ++G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+F+DIY+ +S +R+ +CKG +SYITH+DW   GKLL VN+GAKEQLFFEAPRG +Q I   E+EKI WASW+ VLG  C GIWP   ++TDV +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GG D +LMVW +  +          ++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  Q   + + +  VSR      K+Q        +  +G++ R                P+ + V +L    + GYRG DCRNN+HYL+ +G  I+YH A+VGI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PSIH+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HTI +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VGVKHVKFWTLAG  L++K+G + +  +   RM TML++AF  N+ T+TG ++G V VWK  +L RIV +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      ++ + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D ++++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADVN A VSH   + VTGDD+G+VKL+  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGHSDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGIFSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGTYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRMPGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYGIIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDAVHIAPQ-ESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKQKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAVDFSADGKRLASVGIDDSHTVVLWDWKKGEKLSIARGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDIFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLLQVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASCLTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTDMSLMVWTNEME--------GYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMLGIKPHL-QQKEPSIDERPPVSRAPPQPEKLQ--------TNNVGKKKR----------------PIEDLVLEL----IFGYRGRDCRNNVHYLN-DGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLST--LEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QATDCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKC 1964          

HSP 2 Score: 410.994 bits (1055), Expect = 1.800e-115
Identity = 218/626 (34.82%), Postives = 366/626 (58.47%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+ ++GYRG  C NN+ Y N  + I+Y  A +GI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P I IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ G+KH+KFW+L G  L SKKG+    +   +QT+L +  +   N + ++GT++GDV +W+++ L R++A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS+Y++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+N A V+ +   + TGDDFG+VKLF++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1346 EKLQTNNVGKKKRPIEDLVLELIFGYRGRDCRNNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFR-PDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDARMQTMLAI--AFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQATDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1963          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML5 (EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197])

HSP 1 Score: 1941.39 bits (5028), Expect = 0.000e+0
Identity = 991/2047 (48.41%), Postives = 1372/2047 (67.02%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q +Y  H+DDIIS+AL  +  LVATGQVGK P+ICIW+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+GK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G  + L ++ PGG+ +T T+ +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G++KLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       DS +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++AP   ++L +VHGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IH+WDT+T+K +SILKG H+ GV AVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+  R  KDKIF++K +P+  ++L+  G+K ++FW + GGG   ++G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+F+DIY+ +S +R+ +CKG +SYITH+DW   GKLL VN+GAKEQLFFEAPRG +Q I   E+EKI WASW+ VLG  C GIWP   ++TDV +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GG D +LMVW +  +          ++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  +  S +  +  V                        R   S     P +L ++        +  L L+ + GYRG DCRNN+HYL+ +G  I+YH A+VGI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PSIH+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HTI +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VGVKHVKFWTLAG  L++K+G + +  +   RM TML++AF  N+ T+TG ++G V VWK  +L RIV +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      ++ + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D ++++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADVN A VSH   + VTGDD+G+VKL+  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGHSDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGIFSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGTYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRMPGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYGIIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDAVHIAPQ-ESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKQKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAVDFSADGKRLASVGIDDSHTVVLWDWKKGEKLSIARGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDIFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLLQVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASCLTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTDMSLMVWTNEME--------GYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMLGIKPHLQQKEPSIDERQGVVRGS---------------------RPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELIFGYRGRDCRNNVHYLN-DGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLST--LEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QATDCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKC 1972          

HSP 2 Score: 410.609 bits (1054), Expect = 2.222e-115
Identity = 218/626 (34.82%), Postives = 366/626 (58.47%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+ ++GYRG  C NN+ Y N  + I+Y  A +GI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P I IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ G+KH+KFW+L G  L SKKG+    +   +QT+L +  +   N + ++GT++GDV +W+++ L R++A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS+Y++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+N A V+ +   + TGDDFG+VKLF++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1354 EKLQTNNVGKKKRPIEDLVLELIFGYRGRDCRNNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFR-PDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDARMQTMLAI--AFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQATDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1971          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 1467.21 bits (3797), Expect = 0.000e+0
Identity = 704/1338 (52.62%), Postives = 959/1338 (71.67%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKP 4148
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T S+LKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+  NL R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L ++ P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   +GA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS LSD+   +S++E+EAQ NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N    +QR Y  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +PH+ ++LV VG+K I+FW Q GGGFT+KRGTFG+V KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  + H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGA+EQLFFEAPRG R II  +EIEKI W +W+CVLG +C GIWP   DITDVN+ SLT D  +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W          + +  ++  +  S+ SDTD EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRMPSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGTFGSVGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDILLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-AQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--------REFVGTQESKLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKP 1323          

HSP 2 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 538/1379 (39.01%), Postives = 779/1379 (56.49%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL---STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS-AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFC-TNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK---MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQI-VNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP   L+LEWV+GYRG+ CRNN++Y    E+V+ VA VG+V N    +Q+F+  HNDDI+ L LHP K L+ATG+VG+EP I +WD+  +++VS+LK  H  GV  + F SDG++LASVGLD  + + +WDWRKG+ LAS   H D+IF I WDP+  N++V+ G+K I+FWT  G   T KRG FG    L T LC A    K  + Y+G+ +G +Y+WK  N++++    H  G +++ A ++GF TGG+DG I+L D  F  + K      E  Q  + LS     IRSV     ++LA T   EI E+     D  + IL QGH EGELW LA+HP K +  T SDD  + +W +  ++H LI    ++   R    S DGS +A+G KDGSF+VL +  + E+     RKE I ++KFSP  G YLAVGS+D  VD+Y+ A  ++++  C    S+ITH+DWS D K L  N GA E+LF+  P G + + +K EI+ I WASW+CV G    GIWP   ++TD+NSV    +  VL +GDDFG VKLF++P   + AKF++Y+GHSAHVTNVRW H+ +++LS GGAD ++  W+     +P E   N      PQ   +D+ SEE +         DSD+E+E  ++Y  + Y E L         P L  Q+   N+    + RE              +DS                                L+L+ +HGYRG+DCRNNL Y  A    +VYH AAV +V+N Q   Q  +L H+DDIL LT+  HP  ++ VATGQ+G   +IHVW++     LS LKG H  G+C+LDFS+ G  L+SVG+D+ H+I  W W+ G  +A   GH  +IF+ +  P      V VG+KH+KFW  AG    +KRG     F +  ++ TM+ V++    D  ++GA  G +++WK  +L + V KAH GPVF ++   +D   V+GGK+     G ++LWD    R    Y    I     S ++K L  +    IR+I+   G IL+GT++ +ILEI +K G +  L+Q H EG + GLA HP LP  ++ S+D T+RIW+L  +   + ++ L  G   C  +SP+G  L +GL  G+F V++A +   ++    R + I+DIKFS ++   +AV S+DN VDIY                  +V+T  R   CK   S    ID+ + G  ++      +   +    G+  +  P +IEKI W +W+ V+G    GIWP  SD  DVN A ++   +   TGDD+G VKL+ S+PV      A     V  GHS++VTNVR++++DS L++ GG D  + +W
Sbjct:    4 RTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTILCLA--CAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETE--QGYKGLS-----IRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLIL-QGHCEGELWALALHPKKPLAVTGSDDRSVRLWSL--ADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSP-DGSYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRMPSG-KPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRF----IP-EGVSNGMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDL---------PQLKQQSKEKNHAVPFLKREKAP-----------EDS--------------------------------LKLQFIHGYRGYDCRNNLFYTQA--GEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTI--HP-VKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGT----FGSVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDILLLKTV-KAHDGPVFAMYA--LDKGFVTGGKD-----GIVELWDDMFERCLKTYA---IKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEI-DKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVRKLKKG-GRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIY------------------NVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFVKLF-SYPVK--GQHARFKKYV--GHSAHVTNVRWLHNDSVLLTVGGADTALMIW 1266          

HSP 3 Score: 374.015 bits (959), Expect = 6.632e-106
Identity = 237/633 (37.44%), Postives = 347/633 (54.82%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            QL L+ V+GYRG  CRNNL+Y    G  +VY  A VG+V+N +   Q FFL HNDDI+ L +  HP  + +VATGQ+G  P I +W+S +   +S LK VH +G+  L F S G  L SVG+D  +T+ +W W  G LLA A GH+ RIF   + P   +  V+ GVKH+KFWTL G+ L AKRG     F     + T+L +A    D TY+GA+NG ++VWK   L R ++ AHS  +F ++    +    +GG++     G I+LWD +    KP      I++R   +  K L       IRS+     ++L GTQD++I E++ ++     L +Q H EG L  LA+HP  P   + S+D +VR+W L    LI       A   V +SP+G+ L +G+K G+F VL  +    ++  KDR + I ++KFSP+ S +AVGSND  VD+Y +           C    S +T                ID+S D  +++      +   Y   +G+ +   E+I+ I W SW+ V G EV+GIWP  ++  D+N+   ++ S+  V+GDD+GLVKL   F  P +   A     V  GHS++VTNVR+ +D   ++STGG D  VF W+
Sbjct:   10 QLRLEWVYGYRGHQCRNNLYY--TAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLAL--HPD-KTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNALTAKRGI----FGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYA--CEEGFATGGRD-----GCIRLWDTDF---KPI---TKIDLRETEQGYKGLS------IRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQR--YKKIGECSKSLSFIT---------------HIDWSLDSKYLQTNDGAGERLFYRMPSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKL---FKFPCLKRGAKFRKYV--GHSAHVTNVRWSHDFQWVLSTGGADHSVFQWR 592          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 164.851 bits (416), Expect = 1.036e-40
Identity = 163/649 (25.12%), Postives = 271/649 (41.76%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIAS--KTQRFYASHNDDILCLGLHPLKDLIATGEVG------------------------------REPTIHVWDTQTMKSVSILKGEHERGVCAVDFSS--DGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWT--QVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQS---AVMMHEGGCYAIDALDKG-FVTGGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNH---KLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKG---CSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D    +  P+  + L+ V+ YRG D R+NI  L +GE+VF  A + ++MNI    ++QR Y  H  D+ C+ LHP K L+A+G+                                 E  + +WDT  + ++ +L G  E+G+C V FS    G  LA V     HL+ VW+W+KG++    +A  D +F  KW P   N +V  G     F+      G       TF    K  T L   +  N   V  TG  +G + IW     ++   A  +H GG Y++     G  ++GGKD  +   D +   +  +  +L  E   P           R ++    +++  TSS  ++  + + + N+     G+       +  S N   T S    L IW     NH   K+   KK      C D+    + + +GF  G ++V+++T    I         I+ +KF+P+ G   AV + D  + IY   + + L V        + I  LD+S+D + L   S     LF+       +I   T ++ + W S    +G     +         V +V+   D  + A G + G +++++ P  +  A F + LGH   + +V +  N   L S    D ++  W
Sbjct:  265 DPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNG-FEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFP-----------RVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLITSSQCGTLRIW-----NHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPS-GATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTK---AGEICDGTSVKDVKWGSSRVKIGFETALV--AHSSNGQVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          

HSP 2 Score: 147.132 bits (370), Expect = 3.417e-35
Identity = 165/695 (23.74%), Postives = 298/695 (42.88%), Query Frame = 3
Query: 4317 DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNL--QSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQ--------------IGAIPS----------------IHVWNSLDCTKLSTLKGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWD-QEMIRNK-PFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDN--DILEILE-KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGI-WPDKSDKADVNTAVVSHQSNAFVT-----------GDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            DPP        ++ LKHV+ YRG D R+N+  L      +V+ +A + ++ N+  +   Q  +  H  D+ C+T+  HP  + +VA+GQ                 I S                + +W+++  T L  L G    GIC + FS T  G+LL  V     H ++VW W+ G    +       +F  ++ P   ++ V  G  H  F+    +  +  +     +  ++P+  T+LS+ F  ND   TG  NG++ +W  ++   T+     H G V+ L T    G I+SGGK++      +  WD Q+++R + P  L ++   +GF      L++ S  +I + S     +L G  +N  ++  ++E   G + +L+                  Q  ++S+ GT+RIW+ ++ K+           CVD      ++++G  +G + V++    + +  KK+    IT +KF+P+ +  AV + D  + IY++D++             +++ ++R      + +P V +DFS+D  ++R G       ++ T  G+I +                 G  V  + W     K    TA+V+H SN  VT           G + G +++Y + PV  +    +       GH   + +V F N    L S    D  VF W
Sbjct:  271 DPP------TMKVTLKHVYSYRGKDVRSNIEMLPT--GELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITL--HPN-KILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFE-KGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPK--TVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSL-TLAKSGKILSGGKDR-----MVSEWDLQDLVRTRRPIELPDE---KGFPRVI--LQNGSELIIGTSSNT---LLFGNIENSTNLTSLIEGDPGNLTFLLTCSSN-------------QLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDAS------------KNLLVIAR---IHHIPAPIVALDFSSDSQYLR-GQSIGAHLLFWTKAGEICD-----------------GTSVKDVKWGSSRVKIGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKN-PVTSVTAGFV----ELLGHGRIIKSVAFSN-KIQLFSCSPTDNSVFEW 885          

HSP 3 Score: 139.428 bits (350), Expect = 9.091e-33
Identity = 154/632 (24.37%), Postives = 271/632 (42.88%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDI--KQRKQFYYFEHNDDIISIALASDGELVATGQVG------------KSPF------------------ICIWNSNSLETKSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNT--LSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYV-TGGKDSCVVLHDPEFQPMTRIDLKLTN-IGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY--DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            P  ++TL  VY YRG    +N+    + ++V+F A + ++ +I  + R Q  Y  H  D+  I L  +  LVA+GQ               SP                   + IW++  L T  +L +    GI  VAFSKT  G  L  V       ++VW+W+KGK     +A +D VF+ ++  +   +  V  G  H  F++    T  L      +  + + +T+L++C   +D  V  +G  NG + IW  R     +   +VH G +YS+    SG + +GGKD  V   D +    TR  ++L +  G+P +I+++     +  ++GT  + ++   +       SL+ G      + L     + I  T S   +LRIW   +++   + +    +     +   + I +G   G + V+       +   ++    +  +KF+P G   AV + D  + IY  DA+ +           + I  LD+S DS Y+R  S  A LL +   G   I     +  +KW      +G +     A    +++     V    ++ A G + G ++++  P  +  A F +  GH   + +V +S +K  L S    D S+F+W L
Sbjct:  273 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVL-NGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNL-IVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQN----GSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLI--TSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFET----ALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAFS-NKIQLFSCSPTDNSVFEWCL 887          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 164.851 bits (416), Expect = 1.036e-40
Identity = 163/649 (25.12%), Postives = 271/649 (41.76%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIAS--KTQRFYASHNDDILCLGLHPLKDLIATGEVG------------------------------REPTIHVWDTQTMKSVSILKGEHERGVCAVDFSS--DGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWT--QVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQS---AVMMHEGGCYAIDALDKG-FVTGGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNH---KLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKG---CSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D    +  P+  + L+ V+ YRG D R+NI  L +GE+VF  A + ++MNI    ++QR Y  H  D+ C+ LHP K L+A+G+                                 E  + +WDT  + ++ +L G  E+G+C V FS    G  LA V     HL+ VW+W+KG++    +A  D +F  KW P   N +V  G     F+      G       TF    K  T L   +  N   V  TG  +G + IW     ++   A  +H GG Y++     G  ++GGKD  +   D +   +  +  +L  E   P           R ++    +++  TSS  ++  + + + N+     G+       +  S N   T S    L IW     NH   K+   KK      C D+    + + +GF  G ++V+++T    I         I+ +KF+P+ G   AV + D  + IY   + + L V        + I  LD+S+D + L   S     LF+       +I   T ++ + W S    +G     +         V +V+   D  + A G + G +++++ P  +  A F + LGH   + +V +  N   L S    D ++  W
Sbjct:  265 DPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNG-FEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFP-----------RVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLITSSQCGTLRIW-----NHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPS-GATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTK---AGEICDGTSVKDVKWGSSRVKIGFETALV--AHSSNGQVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          

HSP 2 Score: 147.132 bits (370), Expect = 3.417e-35
Identity = 165/695 (23.74%), Postives = 298/695 (42.88%), Query Frame = 3
Query: 4317 DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNL--QSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQ--------------IGAIPS----------------IHVWNSLDCTKLSTLKGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWD-QEMIRNK-PFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDN--DILEILE-KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGI-WPDKSDKADVNTAVVSHQSNAFVT-----------GDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            DPP        ++ LKHV+ YRG D R+N+  L      +V+ +A + ++ N+  +   Q  +  H  D+ C+T+  HP  + +VA+GQ                 I S                + +W+++  T L  L G    GIC + FS T  G+LL  V     H ++VW W+ G    +       +F  ++ P   ++ V  G  H  F+    +  +  +     +  ++P+  T+LS+ F  ND   TG  NG++ +W  ++   T+     H G V+ L T    G I+SGGK++      +  WD Q+++R + P  L ++   +GF      L++ S  +I + S     +L G  +N  ++  ++E   G + +L+                  Q  ++S+ GT+RIW+ ++ K+           CVD      ++++G  +G + V++    + +  KK+    IT +KF+P+ +  AV + D  + IY++D++             +++ ++R      + +P V +DFS+D  ++R G       ++ T  G+I +                 G  V  + W     K    TA+V+H SN  VT           G + G +++Y + PV  +    +       GH   + +V F N    L S    D  VF W
Sbjct:  271 DPP------TMKVTLKHVYSYRGKDVRSNIEMLPT--GELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITL--HPN-KILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFE-KGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPK--TVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSL-TLAKSGKILSGGKDR-----MVSEWDLQDLVRTRRPIELPDE---KGFPRVI--LQNGSELIIGTSSNT---LLFGNIENSTNLTSLIEGDPGNLTFLLTCSSN-------------QLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDAS------------KNLLVIAR---IHHIPAPIVALDFSSDSQYLR-GQSIGAHLLFWTKAGEICD-----------------GTSVKDVKWGSSRVKIGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKN-PVTSVTAGFV----ELLGHGRIIKSVAFSN-KIQLFSCSPTDNSVFEW 885          

HSP 3 Score: 139.428 bits (350), Expect = 9.091e-33
Identity = 154/632 (24.37%), Postives = 271/632 (42.88%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDI--KQRKQFYYFEHNDDIISIALASDGELVATGQVG------------KSPF------------------ICIWNSNSLETKSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNT--LSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYV-TGGKDSCVVLHDPEFQPMTRIDLKLTN-IGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY--DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            P  ++TL  VY YRG    +N+    + ++V+F A + ++ +I  + R Q  Y  H  D+  I L  +  LVA+GQ               SP                   + IW++  L T  +L +    GI  VAFSKT  G  L  V       ++VW+W+KGK     +A +D VF+ ++  +   +  V  G  H  F++    T  L      +  + + +T+L++C   +D  V  +G  NG + IW  R     +   +VH G +YS+    SG + +GGKD  V   D +    TR  ++L +  G+P +I+++     +  ++GT  + ++   +       SL+ G      + L     + I  T S   +LRIW   +++   + +    +     +   + I +G   G + V+       +   ++    +  +KF+P G   AV + D  + IY  DA+ +           + I  LD+S DS Y+R  S  A LL +   G   I     +  +KW      +G +     A    +++     V    ++ A G + G ++++  P  +  A F +  GH   + +V +S +K  L S    D S+F+W L
Sbjct:  273 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVL-NGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNL-IVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQN----GSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLI--TSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFET----ALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAFS-NKIQLFSCSPTDNSVFEWCL 887          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 164.081 bits (414), Expect = 1.529e-40
Identity = 163/649 (25.12%), Postives = 271/649 (41.76%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIAS--KTQRFYASHNDDILCLGLHPLKDLIATGEVG------------------------------REPTIHVWDTQTMKSVSILKGEHERGVCAVDFSS--DGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWT--QVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQS---AVMMHEGGCYAIDALDKG-FVTGGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNH---KLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKG---CSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D    +  P+  + L+ V+ YRG D R+NI  L +GE+VF  A + ++MNI    ++QR Y  H  D+ C+ LHP K L+A+G+                                 E  + +WDT  + ++ +L G  E+G+C V FS    G  LA V     HL+ VW+W+KG++    +A  D +F  KW P   N +V  G     F+      G       TF    K  T L   +  N   V  TG  +G + IW     ++   A  +H GG Y++     G  ++GGKD  +   D +   +  +  +L  E   P           R ++    +++  TSS  ++  + + + N+     G+       +  S N   T S    L IW     NH   K+   KK      C D+    + + +GF  G ++V+++T    I         I+ +KF+P+ G   AV + D  + IY   + + L V        + I  LD+S+D + L   S     LF+       +I   T ++ + W S    +G     +         V +V+   D  + A G + G +++++ P  +  A F + LGH   + +V +  N   L S    D ++  W
Sbjct:  268 DPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNG-FEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFP-----------RVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLITSSQCGTLRIW-----NHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPS-GATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTK---AGEICDGTSVKDVKWGSSRVKIGFETALV--AHSSNGQVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          

HSP 2 Score: 146.362 bits (368), Expect = 5.497e-35
Identity = 165/695 (23.74%), Postives = 298/695 (42.88%), Query Frame = 3
Query: 4317 DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNL--QSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQ--------------IGAIPS----------------IHVWNSLDCTKLSTLKGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWD-QEMIR-NKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDN--DILEILE-KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGI-WPDKSDKADVNTAVVSHQSNAFVT-----------GDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            DPP        ++ LKHV+ YRG D R+N+  L      +V+ +A + ++ N+  +   Q  +  H  D+ C+T+  HP  + +VA+GQ                 I S                + +W+++  T L  L G    GIC + FS T  G+LL  V     H ++VW W+ G    +       +F  ++ P   ++ V  G  H  F+    +  +  +     +  ++P+  T+LS+ F  ND   TG  NG++ +W  ++   T+     H G V+ L T    G I+SGGK++      +  WD Q+++R  +P  L ++   +GF      L++ S  +I + S     +L G  +N  ++  ++E   G + +L+                  Q  ++S+ GT+RIW+ ++ K+           CVD      ++++G  +G + V++    + +  KK+    IT +KF+P+ +  AV + D  + IY++D++             +++ ++R      + +P V +DFS+D  ++R G       ++ T  G+I +                 G  V  + W     K    TA+V+H SN  VT           G + G +++Y + PV  +    +       GH   + +V F N    L S    D  VF W
Sbjct:  274 DPP------TMKVTLKHVYSYRGKDVRSNIEMLPT--GELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITL--HPN-KILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFE-KGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPK--TVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSL-TLAKSGKILSGGKDR-----MVSEWDLQDLVRTRRPIELPDE---KGFPRVI--LQNGSELIIGTSSNT---LLFGNIENSTNLTSLIEGDPGNLTFLLTCSSN-------------QLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDAS------------KNLLVIAR---IHHIPAPIVALDFSSDSQYLR-GQSIGAHLLFWTKAGEICD-----------------GTSVKDVKWGSSRVKIGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKN-PVTSVTAGFV----ELLGHGRIIKSVAFSN-KIQLFSCSPTDNSVFEW 888          

HSP 3 Score: 139.043 bits (349), Expect = 1.186e-32
Identity = 154/632 (24.37%), Postives = 271/632 (42.88%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDI--KQRKQFYYFEHNDDIISIALASDGELVATGQVG------------KSPF------------------ICIWNSNSLETKSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNT--LSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYV-TGGKDSCVVLHDPEFQPMTRIDLKLTN-IGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY--DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            P  ++TL  VY YRG    +N+    + ++V+F A + ++ +I  + R Q  Y  H  D+  I L  +  LVA+GQ               SP                   + IW++  L T  +L +    GI  VAFSKT  G  L  V       ++VW+W+KGK     +A +D VF+ ++  +   +  V  G  H  F++    T  L      +  + + +T+L++C   +D  V  +G  NG + IW  R     +   +VH G +YS+    SG + +GGKD  V   D +    TR  ++L +  G+P +I+++     +  ++GT  + ++   +       SL+ G      + L     + I  T S   +LRIW   +++   + +    +     +   + I +G   G + V+       +   ++    +  +KF+P G   AV + D  + IY  DA+ +           + I  LD+S DS Y+R  S  A LL +   G   I     +  +KW      +G +     A    +++     V    ++ A G + G ++++  P  +  A F +  GH   + +V +S +K  L S    D S+F+W L
Sbjct:  276 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVL-NGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNL-IVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQN----GSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLI--TSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFET----ALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAFS-NKIQLFSCSPTDNSVFEWCL 890          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 164.081 bits (414), Expect = 1.529e-40
Identity = 163/649 (25.12%), Postives = 271/649 (41.76%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIAS--KTQRFYASHNDDILCLGLHPLKDLIATGEVG------------------------------REPTIHVWDTQTMKSVSILKGEHERGVCAVDFSS--DGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWT--QVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQS---AVMMHEGGCYAIDALDKG-FVTGGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNH---KLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKG---CSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D    +  P+  + L+ V+ YRG D R+NI  L +GE+VF  A + ++MNI    ++QR Y  H  D+ C+ LHP K L+A+G+                                 E  + +WDT  + ++ +L G  E+G+C V FS    G  LA V     HL+ VW+W+KG++    +A  D +F  KW P   N +V  G     F+      G       TF    K  T L   +  N   V  TG  +G + IW     ++   A  +H GG Y++     G  ++GGKD  +   D +   +  +  +L  E   P           R ++    +++  TSS  ++  + + + N+     G+       +  S N   T S    L IW     NH   K+   KK      C D+    + + +GF  G ++V+++T    I         I+ +KF+P+ G   AV + D  + IY   + + L V        + I  LD+S+D + L   S     LF+       +I   T ++ + W S    +G     +         V +V+   D  + A G + G +++++ P  +  A F + LGH   + +V +  N   L S    D ++  W
Sbjct:  268 DPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNG-FEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFP-----------RVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLITSSQCGTLRIW-----NHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPS-GATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTK---AGEICDGTSVKDVKWGSSRVKIGFETALV--AHSSNGQVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          

HSP 2 Score: 146.362 bits (368), Expect = 5.497e-35
Identity = 165/695 (23.74%), Postives = 298/695 (42.88%), Query Frame = 3
Query: 4317 DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNL--QSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQ--------------IGAIPS----------------IHVWNSLDCTKLSTLKGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWD-QEMIR-NKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDN--DILEILE-KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGI-WPDKSDKADVNTAVVSHQSNAFVT-----------GDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            DPP        ++ LKHV+ YRG D R+N+  L      +V+ +A + ++ N+  +   Q  +  H  D+ C+T+  HP  + +VA+GQ                 I S                + +W+++  T L  L G    GIC + FS T  G+LL  V     H ++VW W+ G    +       +F  ++ P   ++ V  G  H  F+    +  +  +     +  ++P+  T+LS+ F  ND   TG  NG++ +W  ++   T+     H G V+ L T    G I+SGGK++      +  WD Q+++R  +P  L ++   +GF      L++ S  +I + S     +L G  +N  ++  ++E   G + +L+                  Q  ++S+ GT+RIW+ ++ K+           CVD      ++++G  +G + V++    + +  KK+    IT +KF+P+ +  AV + D  + IY++D++             +++ ++R      + +P V +DFS+D  ++R G       ++ T  G+I +                 G  V  + W     K    TA+V+H SN  VT           G + G +++Y + PV  +    +       GH   + +V F N    L S    D  VF W
Sbjct:  274 DPP------TMKVTLKHVYSYRGKDVRSNIEMLPT--GELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITL--HPN-KILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFE-KGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPK--TVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSL-TLAKSGKILSGGKDR-----MVSEWDLQDLVRTRRPIELPDE---KGFPRVI--LQNGSELIIGTSSNT---LLFGNIENSTNLTSLIEGDPGNLTFLLTCSSN-------------QLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDAS------------KNLLVIAR---IHHIPAPIVALDFSSDSQYLR-GQSIGAHLLFWTKAGEICD-----------------GTSVKDVKWGSSRVKIGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKN-PVTSVTAGFV----ELLGHGRIIKSVAFSN-KIQLFSCSPTDNSVFEW 888          

HSP 3 Score: 139.043 bits (349), Expect = 1.186e-32
Identity = 154/632 (24.37%), Postives = 271/632 (42.88%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDI--KQRKQFYYFEHNDDIISIALASDGELVATGQVG------------KSPF------------------ICIWNSNSLETKSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNT--LSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYV-TGGKDSCVVLHDPEFQPMTRIDLKLTN-IGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY--DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            P  ++TL  VY YRG    +N+    + ++V+F A + ++ +I  + R Q  Y  H  D+  I L  +  LVA+GQ               SP                   + IW++  L T  +L +    GI  VAFSKT  G  L  V       ++VW+W+KGK     +A +D VF+ ++  +   +  V  G  H  F++    T  L      +  + + +T+L++C   +D  V  +G  NG + IW  R     +   +VH G +YS+    SG + +GGKD  V   D +    TR  ++L +  G+P +I+++     +  ++GT  + ++   +       SL+ G      + L     + I  T S   +LRIW   +++   + +    +     +   + I +G   G + V+       +   ++    +  +KF+P G   AV + D  + IY  DA+ +           + I  LD+S DS Y+R  S  A LL +   G   I     +  +KW      +G +     A    +++     V    ++ A G + G ++++  P  +  A F +  GH   + +V +S +K  L S    D S+F+W L
Sbjct:  276 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVL-NGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNL-IVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVV--TGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQN----GSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTCSSNQLI--TSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFET----ALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAFS-NKIQLFSCSPTDNSVFEWCL 890          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 68.9366 bits (167), Expect = 3.408e-11
Identity = 36/117 (30.77%), Postives = 65/117 (55.56%), Query Frame = 3
Query: 2307 QRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVG 2657
            +R    H  ++ C+  HP K LIATG    +  + +WD ++   ++ L+ EH+  V AV+F+ +G  L + G D  HL+ ++D R  +++ + RAHK ++  + W P +    V+ G
Sbjct:  263 ERVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLATLQ-EHKSSVMAVEFNKNGNWLLTGGRD--HLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEGLFVSGG 376          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299510)

HSP 1 Score: 202.216 bits (513), Expect = 7.985e-53
Identity = 168/646 (26.01%), Postives = 306/646 (47.37%), Query Frame = 3
Query: 2091 SKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGE-VGR----EPTIHVWDTQTMKSVSIL-KGEHERGVCAVDFS--SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDN-----ILQSAVMMHEGGCYAIDALDKG-FVTGG-KDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK--GKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDG-SAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGT--RQIIAKTEIEKIIWASWSCVLGDSCIGIWPPK---CDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            +K  +  L++     +         P + LQL+WVHGYRG D R N++ L SGE++++VAAV ++ +     QR Y  H +DI+C+ +HP ++L+A+G+  GR    +  + +W T++++++ +   GE + GV AV FS  + G  + +V      +L VW W+ G  L      ++ +    + P ++N ++  G   + FW +   GF  +       ++        + P+  G   T    G + I+  +      +++    H  G   +  L +G  ++GG KD  I   D       ++YK   +   P    +    TI     G+  G I   T+   I+E S       +V GHG  +LWGLA HP   + AT   D ++ +W      +KLI    ++    C  ++      +A G  +G  LV++  +   + +       ++ + ++   G  +A+GS +  + ++       S+++++  +G S  +THLDWS DG  +   +   + LF++A   +  R  IA  +++   W + +C +G    G W  +      T V + S ++   +LA+GD  G ++LF YP  +  A+F +   +S  +  VR+L  D  L++VGG D +LMVW
Sbjct:  191 TKVTIRGLRRTFYPPVHHAPADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVT-SVQFEPD--GDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSL-----QNYKKIADTKLPEA--AGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWR----KNKLI--WTIQTGYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQV-GDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVK---WLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 814          

HSP 2 Score: 167.548 bits (423), Expect = 1.317e-41
Identity = 156/623 (25.04%), Postives = 281/623 (45.10%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVG-----KSPFICIWNSNSLETKSIL-KDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKG-------EIQTILTVCMSISDNAVC-YSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGG--KDSCVVLHDPEFQPMTRI-DLKLTNIG------YPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATA---SFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAK--YTDTNDINAADVNLNA-NLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTD 1955
            P+ +L L WV+GYRG     NL+   S +++Y+VA + +++D  +  Q +Y  H +DI+ + +    ELVA+GQ           + IW++ SL+T  +    +   G+++VAFS+   G Y+L+V     + L+VW W+ G +L       + +  A F   D  +  +T G  H+ FW    +    +  I  +         + +    V  + SD  +  YS   +G  ++       R     H+  +  +     G +  G  KD  +   D   Q   +I D KL          YP    R+      N  VGT  ++I+E   S   +   ++ GH   +LW L  HP   ++AT   D  + +W+ N+   + T++   +  +  F+  G+L A G  +G   VI   +   +   +     L+ + ++  G  +A+GS +  + ++  +    S+K+    +G S  +THLDWS+D  +++T +   +LL + A           +  +KW      +G  + G W+   Y+ TN I A      A +++A+GD  G ++LF YP  +  A F +   +S  +  VR+      LI++GG D S+  W + +
Sbjct:  216 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNL-IITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFV-------RTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD-SLQNYKKIADTKLPEAAGGVRTIYPQRPGRN----DGNIYVGTTRNNILE--GSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWRKNKL--IWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIVE 818          

HSP 3 Score: 158.303 bits (399), Expect = 1.109e-38
Identity = 162/650 (24.92%), Postives = 286/650 (44.00%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-----AIPSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWK----SGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVI--RSISRVKGKILLGTQDNDILE-ILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGS-PAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDK---SDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            +L+L+ VHGYRG D R NL  L +    ++Y+ AAV ++ +     Q  +  H +DI+C+ V  HP  R +VA+GQ       +   + +W++     L     G   +G+ ++ FS    G+ +L+V    +  ++VW+W+ G LL K     + +  A F P  D++ +  G  H+ FW         +     +D V QP  + + SV F  +    T   +G + ++          R   +AH+  +  L   L +G ++SGG++  K    I  WD               N +  ++T  P     +  I  +   R  G I +GT  N+ILE  L+++ T   ++  HG   L GLA HP    Y++A  D  V +W      LI ++ TG     + + P G  L  G   G   V++ ++  +++  +  G  +  + ++    +IA+GS +  + ++++   G                 S     K  GS P   +D+S DGNF++    D+ +  +   +      P  ++ + W++ +  VG  VAG W ++   +    V T   S   +   +GD  G ++L   F  P I+  A       + +S  +  VRF+  D  L++ GG D  + VW
Sbjct:  219 KLQLQWVHGYRGIDARRNLWVLPS--GELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDV--HPS-RELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFER-----TDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLI-MLGEGTLLSGGEKDRK----IAAWDSLQ------------NYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFT--QVVFGHGRQ-LWGLAAHPDDELYATAGHDKHVALW--RKNKLIWTIQTGYECVALAFHPFGT-LAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDG----------------FSYKKVNKIRGSQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRL---FRYPCISPRAEFHES--KVYSGMLACVRFLCGDHTLITVGGTDASLMVW 814          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0330139)

HSP 1 Score: 202.216 bits (513), Expect = 1.298e-52
Identity = 168/646 (26.01%), Postives = 306/646 (47.37%), Query Frame = 3
Query: 2091 SKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGE-VGR----EPTIHVWDTQTMKSVSIL-KGEHERGVCAVDFS--SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDN-----ILQSAVMMHEGGCYAIDALDKG-FVTGG-KDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK--GKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDG-SAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGT--RQIIAKTEIEKIIWASWSCVLGDSCIGIWPPK---CDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            +K  +  L++     +         P + LQL+WVHGYRG D R N++ L SGE++++VAAV ++ +     QR Y  H +DI+C+ +HP ++L+A+G+  GR    +  + +W T++++++ +   GE + GV AV FS  + G  + +V      +L VW W+ G  L      ++ +    + P ++N ++  G   + FW +   GF  +       ++        + P+  G   T    G + I+  +      +++    H  G   +  L +G  ++GG KD  I   D       ++YK   +   P    +    TI     G+  G I   T+   I+E S       +V GHG  +LWGLA HP   + AT   D ++ +W      +KLI    ++    C  ++      +A G  +G  LV++  +   + +       ++ + ++   G  +A+GS +  + ++       S+++++  +G S  +THLDWS DG  +   +   + LF++A   +  R  IA  +++   W + +C +G    G W  +      T V + S ++   +LA+GD  G ++LF YP  +  A+F +   +S  +  VR+L  D  L++VGG D +LMVW
Sbjct:  223 TKVTIRGLRRTFYPPVHHAPADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVT-SVQFEPD--GDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSL-----QNYKKIADTKLPEA--AGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWR----KNKLI--WTIQTGYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQV-GDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVK---WLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 846          

HSP 2 Score: 167.548 bits (423), Expect = 1.608e-41
Identity = 156/623 (25.04%), Postives = 281/623 (45.10%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVG-----KSPFICIWNSNSLETKSIL-KDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKG-------EIQTILTVCMSISDNAVC-YSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGG--KDSCVVLHDPEFQPMTRI-DLKLTNIG------YPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATA---SFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAK--YTDTNDINAADVNLNA-NLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTD 1955
            P+ +L L WV+GYRG     NL+   S +++Y+VA + +++D  +  Q +Y  H +DI+ + +    ELVA+GQ           + IW++ SL+T  +    +   G+++VAFS+   G Y+L+V     + L+VW W+ G +L       + +  A F   D  +  +T G  H+ FW    +    +  I  +         + +    V  + SD  +  YS   +G  ++       R     H+  +  +     G +  G  KD  +   D   Q   +I D KL          YP    R+      N  VGT  ++I+E   S   +   ++ GH   +LW L  HP   ++AT   D  + +W+ N+   + T++   +  +  F+  G+L A G  +G   VI   +   +   +     L+ + ++  G  +A+GS +  + ++  +    S+K+    +G S  +THLDWS+D  +++T +   +LL + A           +  +KW      +G  + G W+   Y+ TN I A      A +++A+GD  G ++LF YP  +  A F +   +S  +  VR+      LI++GG D S+  W + +
Sbjct:  248 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNL-IITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFV-------RTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD-SLQNYKKIADTKLPEAAGGVRTIYPQRPGRN----DGNIYVGTTRNNILE--GSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWRKNKL--IWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIVE 850          

HSP 3 Score: 157.918 bits (398), Expect = 1.456e-38
Identity = 162/650 (24.92%), Postives = 286/650 (44.00%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-----AIPSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWK----SGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVI--RSISRVKGKILLGTQDNDILE-ILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGS-PAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDK---SDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            +L+L+ VHGYRG D R NL  L +    ++Y+ AAV ++ +     Q  +  H +DI+C+ V  HP  R +VA+GQ       +   + +W++     L     G   +G+ ++ FS    G+ +L+V    +  ++VW+W+ G LL K     + +  A F P  D++ +  G  H+ FW         +     +D V QP  + + SV F  +    T   +G + ++          R   +AH+  +  L   L +G ++SGG++  K    I  WD               N +  ++T  P     +  I  +   R  G I +GT  N+ILE  L+++ T   ++  HG   L GLA HP    Y++A  D  V +W      LI ++ TG     + + P G  L  G   G   V++ ++  +++  +  G  +  + ++    +IA+GS +  + ++++   G                 S     K  GS P   +D+S DGNF++    D+ +  +   +      P  ++ + W++ +  VG  VAG W ++   +    V T   S   +   +GD  G ++L   F  P I+  A       + +S  +  VRF+  D  L++ GG D  + VW
Sbjct:  251 KLQLQWVHGYRGIDARRNLWVLPS--GELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDV--HPS-RELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFER-----TDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLI-MLGEGTLLSGGEKDRK----IAAWDSLQ------------NYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFT--QVVFGHGRQ-LWGLAAHPDDELYATAGHDKHVALW--RKNKLIWTIQTGYECVALAFHPFGT-LAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDG----------------FSYKKVNKIRGSQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRL---FRYPCISPRAEFHES--KVYSGMLACVRFLCGDHTLITVGGTDASLMVW 846          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 201.83 bits (512), Expect = 6.826e-52
Identity = 166/651 (25.50%), Postives = 306/651 (47.00%), Query Frame = 3
Query: 2091 SKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGE-VGR----EPTIHVWDTQTMKSVSIL-KGEHERGVCAVDFS--SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDN-----ILQSAVMMHEGGCYAIDALDKG-FVTGG-KDGTIKLCD--ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK-----GKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDG-SAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAP--RGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPK---CDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            +K  +  L++     +         P + LQL+WVHGYRG D R N++ L SGE++++VAAV ++ +     QR Y  H +DI+C+ +HP ++L+A+G+  GR    +  + +W T++++++ +   GE + GV AV FS  + G  + +V      +L VW W+ G  L      ++ +    + P ++N ++  G   + FW +   GF  +       ++        + P+  G   T    G + I+  +      +++    H  G   +  L +G  ++GG KD  I   D  + + K+  +             L  A   +R++   +     G I   T+   I+E S       +V GHG  +LWGLA HP   + AT   D ++ +W      +KLI    ++    C  ++      +A G  +G  LV++  +   + +       ++ + ++   G  +A+GS +  + ++       S+++++  +G S  +THLDWS DG  +   +   + LF++A      R  IA  +++   W + +C +G    G W  +      T V + S ++   +LA+GD  G ++LF YP  +  A+F +   +S  +  VR+L  D  L++VGG D +LMVW
Sbjct:  448 TKVTIRGLRRTFYPPVHHAPADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVT-SVQFEPD--GDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADT------------KLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWR----KNKLI--WTIQTGYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQV-GDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVK---WLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          

HSP 2 Score: 166.392 bits (420), Expect = 6.785e-41
Identity = 156/623 (25.04%), Postives = 281/623 (45.10%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVG-----KSPFICIWNSNSLETKSIL-KDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKG-------EIQTILTVCMSISDNAVC-YSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGG--KDSCVVLHDPEFQPMTRI-DLKLTNIG------YPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATA---SFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAK--YTDTNDINAADVNLNA-NLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTD 1955
            P+ +L L WV+GYRG     NL+   S +++Y+VA + +++D  +  Q +Y  H +DI+ + +    ELVA+GQ           + IW++ SL+T  +    +   G+++VAFS+   G Y+L+V     + L+VW W+ G +L       + +  A F   D  +  +T G  H+ FW    +    +  I  +         + +    V  + SD  +  YS   +G  ++       R     H+  +  +     G +  G  KD  +   D   Q   +I D KL          YP    R+      N  VGT  ++I+E   S   +   ++ GH   +LW L  HP   ++AT   D  + +W+ N+   + T++   +  +  F+  G+L A G  +G   VI   +   +   +     L+ + ++  G  +A+GS +  + ++  +    S+K+    +G S  +THLDWS+D  +++T +   +LL + A           +  +KW      +G  + G W+   Y+ TN I A      A +++A+GD  G ++LF YP  +  A F +   +S  +  VR+      LI++GG D S+  W + +
Sbjct:  473 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNL-IITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFV-------RTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD-SLQNYKKIADTKLPEAAGGVRTIYPQRPGRN----DGNIYVGTTRNNILE--GSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWRKNKL--IWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIVE 1075          

HSP 3 Score: 156.377 bits (394), Expect = 1.054e-37
Identity = 162/650 (24.92%), Postives = 286/650 (44.00%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-----AIPSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWK----SGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVI--RSISRVKGKILLGTQDNDILE-ILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGS-PAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDK---SDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            +L+L+ VHGYRG D R NL  L +    ++Y+ AAV ++ +     Q  +  H +DI+C+ V  HP  R +VA+GQ       +   + +W++     L     G   +G+ ++ FS    G+ +L+V    +  ++VW+W+ G LL K     + +  A F P  D++ +  G  H+ FW         +     +D V QP  + + SV F  +    T   +G + ++          R   +AH+  +  L   L +G ++SGG++  K    I  WD               N +  ++T  P     +  I  +   R  G I +GT  N+ILE  L+++ T   ++  HG   L GLA HP    Y++A  D  V +W      LI ++ TG     + + P G  L  G   G   V++ ++  +++  +  G  +  + ++    +IA+GS +  + ++++   G                 S     K  GS P   +D+S DGNF++    D+ +  +   +      P  ++ + W++ +  VG  VAG W ++   +    V T   S   +   +GD  G ++L   F  P I+  A       + +S  +  VRF+  D  L++ GG D  + VW
Sbjct:  476 KLQLQWVHGYRGIDARRNLWVLPS--GELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDV--HPS-RELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFER-----TDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLI-MLGEGTLLSGGEKDRK----IAAWDSLQ------------NYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFT--QVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALW--RKNKLIWTIQTGYECVALAFHPFGT-LAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDG----------------FSYKKVNKIRGSQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRL---FRYPCISPRAEFHES--KVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 202.216 bits (513), Expect = 6.992e-52
Identity = 166/651 (25.50%), Postives = 306/651 (47.00%), Query Frame = 3
Query: 2091 SKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGE-VGR----EPTIHVWDTQTMKSVSIL-KGEHERGVCAVDFS--SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDN-----ILQSAVMMHEGGCYAIDALDKG-FVTGG-KDGTIKLCD--ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK-----GKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDG-SAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAP--RGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPK---CDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            +K  +  L++     +         P + LQL+WVHGYRG D R N++ L SGE++++VAAV ++ +     QR Y  H +DI+C+ +HP ++L+A+G+  GR    +  + +W T++++++ +   GE + GV AV FS  + G  + +V      +L VW W+ G  L      ++ +    + P ++N ++  G   + FW +   GF  +       ++        + P+  G   T    G + I+  +      +++    H  G   +  L +G  ++GG KD  I   D  + + K+  +             L  A   +R++   +     G I   T+   I+E S       +V GHG  +LWGLA HP   + AT   D ++ +W      +KLI    ++    C  ++      +A G  +G  LV++  +   + +       ++ + ++   G  +A+GS +  + ++       S+++++  +G S  +THLDWS DG  +   +   + LF++A      R  IA  +++   W + +C +G    G W  +      T V + S ++   +LA+GD  G ++LF YP  +  A+F +   +S  +  VR+L  D  L++VGG D +LMVW
Sbjct:  448 TKVTIRGLRRTFYPPVHHAPADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVT-SVQFEPD--GDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADT------------KLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWR----KNKLI--WTIQTGYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQV-GDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVK---WLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          

HSP 2 Score: 166.777 bits (421), Expect = 5.720e-41
Identity = 156/623 (25.04%), Postives = 281/623 (45.10%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVG-----KSPFICIWNSNSLETKSIL-KDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKG-------EIQTILTVCMSISDNAVC-YSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGG--KDSCVVLHDPEFQPMTRI-DLKLTNIG------YPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATA---SFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAK--YTDTNDINAADVNLNA-NLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTD 1955
            P+ +L L WV+GYRG     NL+   S +++Y+VA + +++D  +  Q +Y  H +DI+ + +    ELVA+GQ           + IW++ SL+T  +    +   G+++VAFS+   G Y+L+V     + L+VW W+ G +L       + +  A F   D  +  +T G  H+ FW    +    +  I  +         + +    V  + SD  +  YS   +G  ++       R     H+  +  +     G +  G  KD  +   D   Q   +I D KL          YP    R+      N  VGT  ++I+E   S   +   ++ GH   +LW L  HP   ++AT   D  + +W+ N+   + T++   +  +  F+  G+L A G  +G   VI   +   +   +     L+ + ++  G  +A+GS +  + ++  +    S+K+    +G S  +THLDWS+D  +++T +   +LL + A           +  +KW      +G  + G W+   Y+ TN I A      A +++A+GD  G ++LF YP  +  A F +   +S  +  VR+      LI++GG D S+  W + +
Sbjct:  473 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNL-IITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFV-------RTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD-SLQNYKKIADTKLPEAAGGVRTIYPQRPGRN----DGNIYVGTTRNNILE--GSLQRRFTQVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALWRKNKL--IWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIVE 1075          

HSP 3 Score: 156.762 bits (395), Expect = 7.014e-38
Identity = 162/650 (24.92%), Postives = 286/650 (44.00%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-----AIPSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWK----SGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVI--RSISRVKGKILLGTQDNDILE-ILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGS-PAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDK---SDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            +L+L+ VHGYRG D R NL  L +    ++Y+ AAV ++ +     Q  +  H +DI+C+ V  HP  R +VA+GQ       +   + +W++     L     G   +G+ ++ FS    G+ +L+V    +  ++VW+W+ G LL K     + +  A F P  D++ +  G  H+ FW         +     +D V QP  + + SV F  +    T   +G + ++          R   +AH+  +  L   L +G ++SGG++  K    I  WD               N +  ++T  P     +  I  +   R  G I +GT  N+ILE  L+++ T   ++  HG   L GLA HP    Y++A  D  V +W      LI ++ TG     + + P G  L  G   G   V++ ++  +++  +  G  +  + ++    +IA+GS +  + ++++   G                 S     K  GS P   +D+S DGNF++    D+ +  +   +      P  ++ + W++ +  VG  VAG W ++   +    V T   S   +   +GD  G ++L   F  P I+  A       + +S  +  VRF+  D  L++ GG D  + VW
Sbjct:  476 KLQLQWVHGYRGIDARRNLWVLPS--GELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDV--HPS-RELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFER-----TDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLI-MLGEGTLLSGGEKDRK----IAAWDSLQ------------NYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFT--QVVFGHGR-QLWGLAAHPDDELYATAGHDKHVALW--RKNKLIWTIQTGYECVALAFHPFGT-LAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDG----------------FSYKKVNKIRGSQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRL---FRYPCISPRAEFHES--KVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: CG34124 (gene:FBgn0083960 transcript:FBtr0110838)

HSP 1 Score: 81.6481 bits (200), Expect = 8.134e-15
Identity = 107/480 (22.29%), Postives = 195/480 (40.62%), Query Frame = 3
Query: 4383 GFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLE--HNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLA----GSELIAKRGRI-PSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLT-RIVEK----AHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEV-IRSISRV----KGKILLGTQDND------ILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDY-------SPNGNYLVIGLKSG----AFAVLSAQSYRLLIRK---KDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKL 5711
            G+DC+   + +  +  ++V+ A+   + +   S Q+  F E  +   +  +T N HP Y N+   G+ GA P++ ++          L     N   +  ++ TG L  S     D  I +W+WE   ++ +A      I    F   +  +  + G+ H+KFW +A    G +L    GR   +DF      + + ++    ++   +G+  G++ +W++G++   I  K     H+ P+  +  T+ +G + + G +     G +++W  E +      LA+      F E     E K  +V +R + ++    +       QD +       +   +     + L    G  VL    + P  P +   SE G + ++  + + LI      PA  VD        S  G  LV   K G     +  LS      + R    K     IT +  S NSSL+  GS D  + IY+L
Sbjct:   36 GYDCKKLFNLVLVDSDTLVF-ASGNFLNYFSISRQEISFQETVYGCGVGFITKNEHPDYTNLFTVGENGARPTVFIYEYPSLNVRVKLLNAAQNCFTAGSYNKTGELFASQAGYPDFIITIWRWENAEVVLRAKSFQSDILFVHFSEHNPILLCSSGLSHIKFWKMANTFTGLKLKGDLGRFGKTDF------SDIYAMYMLQDENVISGSDWGNMLLWQAGLIKFEICRKGRKPCHTKPITRI--TMKNGEVTTVGMD-----GYVRVWYWETVD-----LADPPEDDLFVEIDPIYEFKIADVELRCMQKIHPFDESDFTHYAQDGNGGIWFCDINTYDVPQKPRKLYSCIGGKVLAA-QMSPVSPHFLCMSESGKLFVYQYDEQRLILE-KEFPAEGVDVIWLDTNISVKGTELVAAFKDGILRQMYLDLSNGERPKMTRVRAFKAHTSPITALTVSRNSSLLLTGSADKSIFIYQL 494          

HSP 2 Score: 54.6842 bits (130), Expect = 1.286e-6
Identity = 49/215 (22.79%), Postives = 88/215 (40.93%), Query Frame = 3
Query:  384 LVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSK-KGIYGK--KGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLK---LTNIG 1010
            L   G+ G  P + I+   SL  +  L +   +  ++ +++KTG    S    P+  + +W W+  +V+   ++    +    F     PI   + G+ HIKFW +       K KG  G+  K +   I  + M   +N +  SG+  G++ +W+               L   E C       G+  C        +P+TRI +K   +T +G
Sbjct:   96 LFTVGENGARPTVFIYEYPSLNVRVKLLNAAQNCFTAGSYNKTGELFASQAGYPDFIITIWRWENAEVVLRAKSFQSDILFVHF-SEHNPILLCSSGLSHIKFWKMANTFTGLKLKGDLGRFGKTDFSDIYAMYMLQDENVI--SGSDWGNMLLWQ-------------AGLIKFEICRK-----GRKPCHT------KPITRITMKNGEVTTVG 283          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: EML5 (si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1677])

HSP 1 Score: 1956.8 bits (5068), Expect = 0.000e+0
Identity = 986/2049 (48.12%), Postives = 1373/2049 (67.01%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINH------QVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSD--IEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQ--TTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI-------PSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SIL+D HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL++   H+DR+FD  + +     K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R +   H   ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V    KP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSNDN VDIY     +K+ G C G+SSFITH+DWS DS Y++TN G    L ++ P G+ +T  + L  ++W+ +T VLG ++ GIW KY+D NDIN+ D N ++ ++ T DD+GLVKLF YP   KGA F+KY GHSAH+TN+RWS D +++I+IGG D S+FQW+       S D  H       +DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL++  K        KKR++AP+ G++L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HP+KD +ATG+VGR+ +IH+W+T+ +K +S+LKG H+ GVCA+DFS+DGK+LASVGLDDNH +V+W+WRKGEKL++ R  KDKIF+IK +P+  ++L++ G+K ++FW +         G  G++ K +T +CA Y   +  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+  +G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+++  +L ++ S HHRK+ IS+I+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKG  +YITHLDW   GKLL VN+ AKEQLFFEAPRG +Q I  TE+EKI W++W+CVLG SC GIWP   ++T+V +  L+ D K+LATGDD G VKLF+YP K K+AKFK+Y+ HS HVTNVRW H+D  L SVGG+DT LM+W H  +          ++     S+ SD +SE++ G+DSDV RE  + Y+ K  S   N +    +KP L  +  T      +  VSR      K+Q        +  +G++ R                P+ + V +L    V GYRG DCRNN+HYL+ EG+ I+YH A++G+V NL +  QSF+LEH+DDILCLT+N+HPK+ NVVATGQ+G         PSIHVW +++   LS L+  H  G+CS+ FS+TG LLLSVG+D  HT+ +WKW+ G  +A   GHTQRIF+AEFRPDSD+ FV+VG+KHV+FWTLAG  L++K+G + S  +   RM TMLSVAF  N+ T+TG ++G V VWK  +L RIV KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET + +     + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GL  HP    + SA+EDGTVR+WD+  + ++  +  G PA  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P         L+R   C+D+ S  +Q+DFS D  F++     YK  +Y   +G+ V E   I++I W +W+SV+G+EV GIW   +DKADV  A VSH     VTGDD+G+VKL+  FP P         +  F GHS+++TNVRF N D  +VS GG+D  +FVW+C
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQQS-KLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDEITYSGALNGDIYVWKGINLIRTVQGAHGSGIFSMNACEEGFATGGRDGCIRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNDNSVDIYGVVQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFYRMPSGKEVTNREELKLVQWSSWTCVLGPEVNGIWPKYSDINDINSVDANFSSQVLVTADDYGLVKLFRYPCIRKGAKFKKYLGHSAHITNIRWSHDYQWVITIGGADHSVFQWKFVPE-RKSKDTLHIAPQETLIDSHSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKHRAMAMKKRERAPASGMRLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHDDDILCLAIHPVKDYVATGQVGRDSSIHIWETEFLKPLSVLKGFHQFGVCALDFSADGKRLASVGLDDNHTIVLWEWRKGEKLSTIRGSKDKIFVIKINPYMPDKLISAGVKHMKFWHRA---GGGLIGKKGSMGKTETMMCAVYGWTEEMV-FSGTCTGDICIWRDMFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKNGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLIVNADTLEDLVSFHHRKDIISEIRFSPVTGKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNYITHLDWDKRGKLLQVNTSAKEQLFFEAPRGKKQSIPVTEVEKIDWSTWTCVLGSSCEGIWPVVSEVTEVTAACLSYDKKLLATGDDLGYVKLFKYPVKGKYAKFKRYMAHSTHVTNVRWSHDDSLLASVGGSDTCLMIWNHETESC--------REARQCDSEESDIESEDDGGYDSDVTRENEIVYVIKALST--NMRPMTGVKPHLQQKEPTVDERGSRPPVSRAPPMPEKLQ--------TNNVGKKKR----------------PIEDLVLEL----VFGYRGNDCRNNVHYLN-EGADIIYHTASIGVVLNLTTACQSFYLEHSDDILCLTINQHPKFPNVVATGQVGDTGDMSATSPSIHVWEAMNKQTLSVLRCHHSRGVCSVSFSATGKLLLSVGLDPQHTLTIWKWQEGAKVASRAGHTQRIFVAEFRPDSDTQFVSVGIKHVRFWTLAGRALLSKKGVLSS--IEDARMQTMLSVAFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRL----------ETGQVI-----DCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHMDGPVWGLGAHPTRDVFLSAAEDGTVRLWDISQRKMLNKVNLGHPARTVSYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRSAIQDIRFSPDSRYLAVGSSENAVDFYDL-------TLGP--------QLNRINCCRDIPSFVMQMDFSADSCFVQLSTGAYKRVVYEVPSGKQVTEQAVIDRITWATWTSVLGDEVVGIWSRNTDKADVTCACVSHSGINIVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSAHLTNVRFTNGDRFVVSAGGDDRSLFVWRC 1964          

HSP 2 Score: 422.935 bits (1086), Expect = 1.544e-119
Identity = 224/626 (35.78%), Postives = 371/626 (59.27%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNS-EKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVG-------KSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+ V+GYRG+ C NN+ Y N    I+Y  A IG+V ++    Q +Y EH+DDI+ + +    +   +VATGQVG        SP I +W + + +T S+L+  H+ G+ SV+FS TG  LLSVGLDP  TL +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH++FW+L G  L SKKG+    +   +QT+L+V  +   N + ++GT++GDV +W+E+ L R++A  H+G ++++ +       VTGGK+        + L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W LG HP + +F + ++D ++R+W +++R+ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  + +++FSPD  +LAVGS++N VD YD T      R   C+   SF+  +D+S DS +++ ++GA + ++++ P G+ +T+  ++  I WA +T VLG ++ GIW++ TD  D+  A V+ +   I TGDDFG+VKLF++P P K A  +++ GHSAH+TNVR++   +F++S GG D+S+F WR
Sbjct: 1346 EKLQTNNVGKKKRPIEDLVLELVFGYRGNDCRNNVHYLNEGADIIYHTASIGVVLNLTTACQSFYLEHSDDILCLTINQHPKFPNVVATGQVGDTGDMSATSPSIHVWEAMNKQTLSVLRCHHSRGVCSVSFSATGKLLLSVGLDPQHTLTIWKWQEGAKVASRAGHTQRIFVAEFR-PDSDTQFVSVGIKHVRFWTLAGRALLSKKGVLSSIEDARMQTMLSV--AFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRLE---TGQVIDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHMDGPVWGLGAHPTRDVFLSAAEDGTVRLWDISQRKMLNKVNLGHPARTVSYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRSAIQDIRFSPDSRYLAVGSSENAVDFYDLTLGPQLNRINCCRDIPSFVMQMDFSADSCFVQLSTGAYKRVVYEVPSGKQVTEQAVIDRITWATWTSVLGDEVVGIWSRNTDKADVTCACVSHSGINIVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSAHLTNVRFTNGDRFVVSAGGDDRSLFVWR 1963          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: EML5 (si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1677])

HSP 1 Score: 1405.58 bits (3637), Expect = 0.000e+0
Identity = 674/1341 (50.26%), Postives = 935/1341 (69.72%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINH------QVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSD--IEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDL 4154
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SIL+D HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL++   H+DR+FD  + +     K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R +   H   ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V    KP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSNDN VDIY     +K+ G C G+SSFITH+DWS DS Y++TN G    L ++ P G+ +T  + L  ++W+ +T VLG ++ GIW KY+D NDIN+ D N ++ ++ T DD+GLVKLF YP   KGA F+KY GHSAH+TN+RWS D +++I+IGG D S+FQW+       S D  H       +DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL++  K        KKR++AP+ G++L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HP+KD +ATG+VGR+ +IH+W+T+ +K +S+LKG H+ GVCA+DFS+DGK+LASVGLDDNH +V+W+WRKGEKL++ R  KDKIF+IK +P+  ++L++ G+K ++FW +         G  G++ K +T +CA Y   +  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+  +G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+++  +L ++ S HHRK+ IS+I+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKG  +YITHLDW   GKLL VN+ AKEQLFFEAPRG +Q I  TE+EKI W++W+CVLG SC GIWP   ++T+V +  L+ D K+LATGDD G VKLF+YP K K+AKFK+Y+ HS HVTNVRW H+D  L SVGG+DT LM+W H  +          ++     S+ SD +SE++ G+DSDV RE  + Y+ K  S   N +    +KP L
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQQS-KLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDEITYSGALNGDIYVWKGINLIRTVQGAHGSGIFSMNACEEGFATGGRDGCIRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNDNSVDIYGVVQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFYRMPSGKEVTNREELKLVQWSSWTCVLGPEVNGIWPKYSDINDINSVDANFSSQVLVTADDYGLVKLFRYPCIRKGAKFKKYLGHSAHITNIRWSHDYQWVITIGGADHSVFQWKFVPE-RKSKDTLHIAPQETLIDSHSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKHRAMAMKKRERAPASGMRLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHDDDILCLAIHPVKDYVATGQVGRDSSIHIWETEFLKPLSVLKGFHQFGVCALDFSADGKRLASVGLDDNHTIVLWEWRKGEKLSTIRGSKDKIFVIKINPYMPDKLISAGVKHMKFWHRA---GGGLIGKKGSMGKTETMMCAVYGWTEEMV-FSGTCTGDICIWRDMFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKNGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLIVNADTLEDLVSFHHRKDIISEIRFSPVTGKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNYITHLDWDKRGKLLQVNTSAKEQLFFEAPRGKKQSIPVTEVEKIDWSTWTCVLGSSCEGIWPVVSEVTEVTAACLSYDKKLLATGDDLGYVKLFKYPVKGKYAKFKRYMAHSTHVTNVRWSHDDSLLASVGGSDTCLMIWNHETESC--------REARQCDSEESDIESEDDGGYDSDVTRENEIVYVIKALST--NMRPMTGVKPHL 1322          

HSP 2 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 516/1377 (37.47%), Postives = 751/1377 (54.54%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL---ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSP-NSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXX-XXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP+  L+LEWV+GYRG+ CRNN++Y  + EIV+ VA VG+V N     Q+FY  HNDDI+ L LHP + L+ATG+VG+EP I VWD+ T+++VSIL+  H  G+  + F  DG+ L SVGLD  + + VWDWR+G+ LA+   H D+IF I WD +  ++LV+ G+K I+FW+  G   T KRG FG    L T LC A   ++  + Y+G+ +G +Y+WK  N++++    H  G ++++A ++GF TGG+DG I+L D  F  +  +     E  Q  + LS     +RSV      IL  T   EI E+         +++QGH EGELW LAVHP+K +  T SDD  + IW +   +H LI    ++ P RC  +S DG  +A+G KDGSF VL +  + E+     RKE I ++K+SP  G +LAVGS+DN VDIY  +  ++++  C G SS+ITH+DWSTD K L  N G   +LF+  P G +++  + E++ + W+SW+CVLG    GIWP   DI D+NSV      +VL T DD+G VKLF YP   K AKFK+YLGHSAH+TN+RW H+ ++++++GGAD ++  WK     VP   S +   I  PQ  L D+ SEE +         DS++E+E  + Y  + Y E L         P L  Q    +   A   RE                      R+ ++G                     + L  +HGYRG+DCR+NL Y   +   IVYH AAVG+V+N Q   Q F+L H+DDILCL +  HP  ++ VATGQ+G   SIH+W +     LS LKG H  G+C+LDFS+ G  L SVG+D++HTI +W+W  G  L+   G   +IF+ +  P      ++ GVKH+KFW  AG  LI K+G +          T M +V   T +  ++G   G + +W+   L + V KAH GPVF +    ++   V+GGK+     G + LWD    R    Y    I     +  +K L  +    IR+IS   G IL+GT++ +ILE+ +K G +  L+Q H EG + GLA HP LP  ++ S+D T+RIWDL      + ++ L  G   C  +SP+G  L +GL  G+F +++A +   L+    R   I++I+FSP     +AV S D+ VDIY                  +V++  R   CK   +    +D+   G  ++      +   +    G+  + P    + I   +W+ V+G    GIWP  S+  +V  A +S+      TGDD G VKL   F  P     A      +  HS++VTNVR+ +DDS L S GG D C+ +W
Sbjct:    4 RTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQQSKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTILCLACARDE--ITYSGALNGDIYVWKGINLIRTVQGAHGSGIFSMNACEEGFATGGRDGCIRLWDLNFKPI--TVIDLRETDQGYKGLS-----VRSVCWRGDHILVGTQDSEIFEVVVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSL--VDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSP-DGAHLAVGSNDNSVDIYGVVQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFYRMPSG-KEVTNREELKLVQWSSWTCVLGPEVNGIWPKYSDINDINSVDANFSSQVLVTADDYGLVKLFRYPCIRKGAKFKKYLGHSAHITNIRWSHDYQWVITIGGADHSVFQWKF----VPERKSKDTLHI-APQETLIDSHSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDL---------PQLKEQCKEKHRAMAMKKRE----------------------RAPASG---------------------MRLHFIHGYRGYDCRSNLFY--TQTGEIVYHVAAVGVVYNRQQNTQRFYLGHDDDILCLAI--HP-VKDYVATGQVGRDSSIHIWETEFLKPLSVLKGFHQFGVCALDFSADGKRLASVGLDDNHTIVLWEWRKGEKLSTIRGSKDKIFVIKINPYMPDKLISAGVKHMKFWHRAGGGLIGKKGSMGK------TETMMCAVYGWTEEMVFSGTCTGDICIWRDMFLVKTV-KAHDGPVFSMHA--LEKGFVTGGKD-----GIVALWDDTFERCLKTYA---IKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEV-DKNGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRCCC-FSPDGKALAVGLNDGSFLIVNADTLEDLVSFHHRKDIISEIRFSPVTGKYLAVASGDSFVDIY------------------NVMSSKRVGVCKGSMNYITHLDWDKRGKLLQVNTSAKEQLFFEAPRGKKQSIPVTEVEKIDWSTWTCVLGSSCEGIWPVVSEVTEVTAACLSYDKKLLATGDDLGYVKL---FKYPVKGKYAKFKR--YMAHSTHVTNVRWSHDDSLLASVGGSDTCLMIW 1263          

HSP 3 Score: 368.237 bits (944), Expect = 3.398e-104
Identity = 239/643 (37.17%), Postives = 350/643 (54.43%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTT-GPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPYRQN 6272
             L L+ V+GYRG  CRNNL+Y  A+   IVY  A VG+V+N +  +Q F+L HNDDI+ L +  HP+ R +VATGQ+G  P I VW+S     +S L+ +H +GI  L F   G  L+SVG+D+ +TI VW W  G +LA A GHT RIF   +     S  V+ GVKH+KFW+L G+ L  KRG     F     + T+L +A   ++ TY+GA+NG ++VWK   L R V+ AH   +F +     +    +GG++     G I+LWD   +  KP  +   I++R   +  K L       +RS+      IL+GTQD++I E++    T  +L MQ H EG L  LAVHP  P   + S+D +VRIW L    LI       P  C   S +G +L +G+K G+F VL  +    ++  KDR + I ++K+SP+ + +AVGSNDN VDIY +                 V    +   C    S    +D+STD  +++    + +   Y   +G+ V   E+++ + W SW+ V+G EV GIWP  SD  D+N+   +  S   VT DDYGLVKL   F  P I   A      + GHS+++TN+R+ +D   +++ GG D  VF WK   ++P R++
Sbjct:   10 HLRLEWVYGYRGHQCRNNLYYTAAK--EIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLAL--HPE-RVLVATGQVGKEPYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQQSKLVSCGVKHIKFWSLCGNALTPKRGV----FGKTGDLQTILCLACARDEITYSGALNGDIYVWKGINLIRTVQGAHGSGIFSM--NACEEGFATGGRD-----GCIRLWD---LNFKPITV---IDLRETDQGYKGLS------VRSVCWRGDHILVGTQDSEIFEVVVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNDNSVDIYGV-----------------VQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFYRMPSGKEVTNREELKLVQWSSWTCVLGPEVNGIWPKYSDINDINSVDANFSSQVLVTADDYGLVKL---FRYPCIRKGAKFKK--YLGHSAHITNIRWSHDYQWVITIGGADHSVFQWK---FVPERKS 599          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 696/1422 (48.95%), Postives = 958/1422 (67.37%), Query Frame = 3
Query: 1992 DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            DS +  SDS LSD+   +S++E+EAQ +Y R V K+++ QL+K     +    KR+KAP +GL+L++VHGYRG DCRNN+FY Q+GE+V+HVAAV +V N    TQRFY  H+DDIL L +HPLKD +A+G+VGR+P IHVWD QT+K +S+LKG+H+RGVCA++F++DGK L SVG+D+ H +V+WDW+KGEKLA +R HKDKIF++K +P   ++LV VGMK I+FW   GGG T +RG FGN+ K +T + A Y  ++  + ++G+ +G VYIWKD  L  ++  H+G  +A+ +LDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  +NH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ + HHRKE ISDI+FS   GKYLAV SHD+FVDIY+ ++ +R+ +CKG SS ITH+DW   GKLL VN+GAKEQLFFEAPRG RQ I+  E EK+ WA+W+ VLG +C GIWP    ++ VN+ SLT D K+LATGDDFG VKLF +PSK +FAKFK+Y+ HSA+VTNVRW ++D  LLSVGGADTALM+W          + I  ++  +  S+ SD D+EE+ G+DSDV REK+MDY  K Y+  ++ +Q   +KP                          Q   +L+ +   + R +       P +L+ +      + V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA  ++H+L +G QSF+LEH DDILCLTVN+HPKY+N++ATGQIG  PSIHVW+++    +S L+  H  GI  ++FS+TG LLLSVG+D +HTI VW+W+ G+ +    GHT RIF+ EFRPDSD+ FV+VG+KH+KFWTL G  L+ K+G I +  V    M TMLSVAF  N+ T+TGA+NG V+VW+   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET  P+     E++RS+ R KGKIL+GT+D +I+E+ EK      ++  H +G + GLA HP    + SAS+DGT+R WDL  K L+  ++ G PA C  YSPNG  + IG+++G F VL   S  +  +K+DR   I DI+FS ++ L+AVGS ++ VD Y L        PS          L+R  YCKD+    +Q+DFS D  +I      YK +I+   +G++V++   +++I W SW+SV+G+EV GIWP  ++KADVN A VSH     VTGDD+GLVKL+  FP     +     +  + GHS++VTN+RF  DD +++S GG DC VFVW+C
Sbjct:   29 DSNSGESDSDLSDVSELDSDIEQEAQISYERQVYKEDLPQLKKKLAGSL----KRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSED-LVFSGATTGDVYIWKDTTLMKSIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-ANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSKRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPT---LSLVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIWA--------REGIGPRESKVVDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYA--VSIRQMTGVKP------------------------HQQQKEILVDERPPVSRAA-----PLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGA--VEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGLPV-----EIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDLADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFSSDNRLLAVGSVESAVDFYDL-----TLGPS----------LNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSGKLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----SEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWRC 1364          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 503/1323 (38.02%), Postives = 774/1323 (58.50%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTNIGY---PNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT---RDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQL-LTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKV-----TKSDIEDGKK--RKKAP----------------SQGLQLEWVHGYRGYDCRNNIFYLQSG-EIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAI---SHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            +  + AP+  L L +V+GYRG  C NNLFYT + ++VY VA + +VY+ +Q  Q +Y  H+DDI+S+ +    + VA+GQVG+ P I +W+  +L+  S+LK QH  G+ ++ F+  G  L+SVG+D    + +WDWKKG+ L+ +R H D++    F+V   P    K VT G+KHIKFW   G  L+ ++GI+G  G+ +T+++ C   S++ V +SG   GDVYIW++  L + I   H G ++++ S   G+VTGGKD  V L D  F+       + R  L  ++ G     N  +R++     + LVGT+  +I+EI  S P     L+ GH  GE+W L  HP   I AT SDD +LRIW+++    +  +R + K  R C F+ DG  +A+G+ DGSF V+      DM+  H+   RKE++ +++FS D G +LAV S+D+FVDIY+   S KR G+CKG SS ITH+DW +    ++ N+GA E L F+AP G   T + L    ++WA +T VLG   +GIW   +    +NA+ +  +  L+ATGDDFG VKLF++PS  + A F+KY  HSA+VTNVRWS D   L+S+GG D ++  W    A  G G    +V   ++ SD    + G  +S++ +E   +YT  +    + Q+  V      K  + D +    + AP                 + L L+ V GYRG+DCRNN+ YL  G +I+FH AA  ++ ++++ TQ FY  H DDILCL +  HP  +++IATG++G  P+IHVWD  + +++S+L+  H +G+  V+FS+ GK L SVG+D  H + VW W++G ++ S   H D+IF++++ P ++ Q V+VG+K I+FWT VGG    K+G  G V    + T L  A+  N   + +TG+ +G V++W+++ L   V   H G  + +     D   VTGGK+      G +KL D+   +  ++++L  E   P ++       +RSV  GKGKIL  T  GEIME+   +   N ++ GH +G +WGLA HPSK++  + SDD  +  W++  ++ KL+    L  PA+C   S +G  V++G ++G F+VL + SL        R   I DI+FS +  + LAVGS ++ VD Y      S  R+  CK    ++  LD+S D K + V++G+ ++   E P G + +  +  +++I WASW+ VLGD  +GIWP   +  DVN   ++  G  + TGDDFG VKLF++P   KFAK K+Y GHSAHVTN+R+ ++D+Y++SVGG D ++ VW+
Sbjct:   77 LKRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKI----FVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSEDLV-FSGATTGDVYIWKDTTLMKSIKA-HDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTL--LVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHH---RKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTS-KRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPTLS---LVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIW----AREGIGPRESKV-VDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYAVSIRQMTGVKPHQQQKEILVDERPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANN--LTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRC-RAFQL--ETGLPVEI-------VRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDL--ADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFS-SDNRLLAVGSVESAVDFYDLTLGPSLNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSG-KLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLFDFPCSEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWR 1363          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 1310.82 bits (3391), Expect = 0.000e+0
Identity = 697/1422 (49.02%), Postives = 958/1422 (67.37%), Query Frame = 3
Query: 1992 DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            DS +  SDS LSD+   +S++E+EAQ +Y R V K+++ QL+K     +    KR+KAP +GL+L++VHGYRG DCRNN+FY Q+GE+V+HVAAV +V N    TQRFY  H+DDIL L +HPLKD +A+G+VGR+P IHVWD QT+K +S+LKG+H+RGVCA++F++DGK L SVG+D+ H +V+WDW+KGEKLA +R HKDKIF++K +P   ++LV VGMK I+FW   GGG T +RG FGN+ K +T + A Y  ++  V ++G+ +G VYIWKD  L  ++  H+G  +A+ +LDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  +NH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ + HHRKE ISDI+FS   GKYLAV SHD+FVDIY+ ++ +R+ +CKG SS ITH+DW   GKLL VN+GAKEQLFFEAPRG RQ I+  E EK+ WA+W+ VLG +C GIWP    ++ VN+ SLT D K+LATGDDFG VKLF +PSK +FAKFK+Y+ HSA+VTNVRW ++D  LLSVGGADTALM+W          + I  ++  +  S+ SD D+EE+ G+DSDV REK+MDY  K Y+  ++ +Q   +KP                          Q   +L+ +   + R +       P +L+ +      + V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA  ++H+L +G QSF+LEH DDILCLTVN+HPKY+N++ATGQIG  PSIHVW+++    +S L+  H  GI  ++FS+TG LLLSVG+D +HTI VW+W+ G+ +    GHT RIF+ EFRPDSD+ FV+VG+KH+KFWTL G  L+ K+G I +  V    M TMLSVAF  N+ T+TGA+NG V+VW+   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET  P+     E++RS+ R KGKIL+GT+D +I+E+ EK      ++  H +G + GLA HP    + SAS+DGT+R WDL  K L+  ++ G PA C  YSPNG  + IG+++G F VL   S  +  +K+DR   I DI+FS ++ L+AVGS ++ VD Y L        PS          L+R  YCKD+    +Q+DFS D  +I      YK +I+   +G++V++   +++I W SW+SV+G+EV GIWP  ++KADVN A VSH     VTGDD+GLVKL+  FP     +     +  + GHS++VTN+RF  DD +++S GG DC VFVW+C
Sbjct:  442 DSNSGESDSDLSDVSELDSDIEQEAQISYERQVYKEDLPQLKKKLAGSL----KRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSEDLV-FSGATTGDVYIWKDTTLMKSIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-ANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSKRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPT---LSLVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIWA--------REGIGPRESKVVDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYA--VSIRQMTGVKP------------------------HQQQKEILVDERPPVSRAA-----PLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGA--VEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGLPV-----EIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDLADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFSSDNRLLAVGSVESAVDFYDL-----TLGPS----------LNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSGKLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----SEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWRC 1777          

HSP 2 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 503/1323 (38.02%), Postives = 774/1323 (58.50%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTNIGY---PNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT---RDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQL-LTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKV-----TKSDIEDGKK--RKKAP----------------SQGLQLEWVHGYRGYDCRNNIFYLQSG-EIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAI---SHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            +  + AP+  L L +V+GYRG  C NNLFYT + ++VY VA + +VY+ +Q  Q +Y  H+DDI+S+ +    + VA+GQVG+ P I +W+  +L+  S+LK QH  G+ ++ F+  G  L+SVG+D    + +WDWKKG+ L+ +R H D++    F+V   P    K VT G+KHIKFW   G  L+ ++GI+G  G+ +T+++ C   S++ V +SG   GDVYIW++  L + I   H G ++++ S   G+VTGGKD  V L D  F+       + R  L  ++ G     N  +R++     + LVGT+  +I+EI  S P     L+ GH  GE+W L  HP   I AT SDD +LRIW+++    +  +R + K  R C F+ DG  +A+G+ DGSF V+      DM+  H+   RKE++ +++FS D G +LAV S+D+FVDIY+   S KR G+CKG SS ITH+DW +    ++ N+GA E L F+AP G   T + L    ++WA +T VLG   +GIW   +    +NA+ +  +  L+ATGDDFG VKLF++PS  + A F+KY  HSA+VTNVRWS D   L+S+GG D ++  W    A  G G    +V   ++ SD    + G  +S++ +E   +YT  +    + Q+  V      K  + D +    + AP                 + L L+ V GYRG+DCRNN+ YL  G +I+FH AA  ++ ++++ TQ FY  H DDILCL +  HP  +++IATG++G  P+IHVWD  + +++S+L+  H +G+  V+FS+ GK L SVG+D  H + VW W++G ++ S   H D+IF++++ P ++ Q V+VG+K I+FWT VGG    K+G  G V    + T L  A+  N   + +TG+ +G V++W+++ L   V   H G  + +     D   VTGGK+      G +KL D+   +  ++++L  E   P ++       +RSV  GKGKIL  T  GEIME+   +   N ++ GH +G +WGLA HPSK++  + SDD  +  W++  ++ KL+    L  PA+C   S +G  V++G ++G F+VL + SL        R   I DI+FS +  + LAVGS ++ VD Y      S  R+  CK    ++  LD+S D K + V++G+ ++   E P G + +  +  +++I WASW+ VLGD  +GIWP   +  DVN   ++  G  + TGDDFG VKLF++P   KFAK K+Y GHSAHVTN+R+ ++D+Y++SVGG D ++ VW+
Sbjct:  490 LKRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKI----FVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSEDLV-FSGATTGDVYIWKDTTLMKSIKA-HDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPM--TLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHH---RKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTS-KRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPTLS---LVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIW----AREGIGPRESKV-VDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYAVSIRQMTGVKPHQQQKEILVDERPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANN--LTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRC-RAFQL--ETGLPVEI-------VRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDL--ADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFS-SDNRLLAVGSVESAVDFYDLTLGPSLNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSG-KLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLFDFPCSEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWR 1776          

HSP 3 Score: 351.288 bits (900), Expect = 2.742e-97
Identity = 164/336 (48.81%), Postives = 230/336 (68.45%), Query Frame = 3
Query:  360 IALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDAR---FMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTR 1358
            +AL  D   VATGQVGK P+IC+W+S +L T SIL+D HTHG++ +AF   G  L SVGLD   T+ VWDWKKG+VL++   HSDR+FD     F+    P + V+CG+KHIKFW+LCGN L+ K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+  NL R I   H   ++S+ SC  G+ TGG+D CV L D +F+P+T+IDL+    GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH+ GELWAL +HPK+ +  TGSDD S+R+W ++E   +    +++ +RS  F +DGS +A+G+ DGSF+V+R R
Sbjct:   66 LALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFL----PHRLVSCGVKHIKFWALCGNALTPKRGIFGKTGDLQTIL--CLATAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHSCEEGFATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSLSEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRVR 395          

HSP 4 Score: 224.942 bits (572), Expect = 2.986e-58
Identity = 142/360 (39.44%), Postives = 202/360 (56.11%), Query Frame = 3
Query: 2304 TQRFYASHND--DILC----LGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSL 3356
             Q  Y  HN   +++C    L LHP K  +ATG+VG++P I VWD+  + +VSIL+  H  GV  + F +DG++LASVGLD  + + VWDW+KG  LA+   H D+IF I WDP   ++LV+ G+K I+FW   G   T KRG FG    L T LC A    K  V Y+G+ +G +Y+WK  N+ ++    H  G +++ + ++GF TGG+DG ++L D  F  + K      E  Q  + LS     IRSV     +ILA T   EI E+         +++QGH EGELW L +HP + +  T SDD  + +W +  S H LI    ++   R      DGS +A+G KDGSF VL +
Sbjct:   46 VQPQYKKHNSFPNVICKMAILALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALCGNALTPKRGIFGKTGDLQTILCLA--TAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHSCEEGFATGGRDGCVRLWDVDFKPITKIDLREAE--QGYKGLS-----IRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSL--SEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRV 394          

HSP 5 Score: 206.068 bits (523), Expect = 1.728e-52
Identity = 132/381 (34.65%), Postives = 200/381 (52.49%), Query Frame = 3
Query: 4488 QSFFLEHND--DILC--LTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRK 5612
            Q  + +HN   +++C    +  HP  +  VATGQ+G  P I VW+S   T +S L+ VH +G+  L F + G  L SVG+D  +T+ VW W+ G +LA A GH+ RIF   + P      V+ GVKH+KFW L G+ L  KRG     F     + T+L +A    + TY+GA+NG ++VWK   LTR ++ AH   +F + +   +    +GG++     G ++LWD +    KP      I++R   +  K L       IRS+     +IL GTQD++I E++ +      L MQ H EG L  L +HP  P   + S+D +VR+W L    LI       A   V +  +G+ L +G+K G+F VL  + + L + K
Sbjct:   47 QPQYKKHNSFPNVICKMAILALHPD-KIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALCGNALTPKRGI----FGKTGDLQTILCLATAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHS--CEEGFATGGRD-----GCVRLWDVDF---KPI---TKIDLREAEQGYKGLS------IRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSLSEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRVRYFSLRVSK 403          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 1310.43 bits (3390), Expect = 0.000e+0
Identity = 697/1422 (49.02%), Postives = 958/1422 (67.37%), Query Frame = 3
Query: 1992 DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            DS +  SDS LSD+   +S++E+EAQ +Y R V K+++ QL+K     +    KR+KAP +GL+L++VHGYRG DCRNN+FY Q+GE+V+HVAAV +V N    TQRFY  H+DDIL L +HPLKD +A+G+VGR+P IHVWD QT+K +S+LKG+H+RGVCA++F++DGK L SVG+D+ H +V+WDW+KGEKLA +R HKDKIF++K +P   ++LV VGMK I+FW   GGG T +RG FGN+ K +T + A Y  ++  V ++G+ +G VYIWKD  L  ++  H+G  +A+ +LDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  +NH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ + HHRKE ISDI+FS   GKYLAV SHD+FVDIY+ ++ +R+ +CKG SS ITH+DW   GKLL VN+GAKEQLFFEAPRG RQ I+  E EK+ WA+W+ VLG +C GIWP    ++ VN+ SLT D K+LATGDDFG VKLF +PSK +FAKFK+Y+ HSA+VTNVRW ++D  LLSVGGADTALM+W          + I  ++  +  S+ SD D+EE+ G+DSDV REK+MDY  K Y+  ++ +Q   +KP                          Q   +L+ +   + R +       P +L+ +      + V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA  ++H+L +G QSF+LEH DDILCLTVN+HPKY+N++ATGQIG  PSIHVW+++    +S L+  H  GI  ++FS+TG LLLSVG+D +HTI VW+W+ G+ +    GHT RIF+ EFRPDSD+ FV+VG+KH+KFWTL G  L+ K+G I +  V    M TMLSVAF  N+ T+TGA+NG V+VW+   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET  P+     E++RS+ R KGKIL+GT+D +I+E+ EK      ++  H +G + GLA HP    + SAS+DGT+R WDL  K L+  ++ G PA C  YSPNG  + IG+++G F VL   S  +  +K+DR   I DI+FS ++ L+AVGS ++ VD Y L        PS          L+R  YCKD+    +Q+DFS D  +I      YK +I+   +G++V++   +++I W SW+SV+G+EV GIWP  ++KADVN A VSH     VTGDD+GLVKL+  FP     +     +  + GHS++VTN+RF  DD +++S GG DC VFVW+C
Sbjct:  442 DSNSGESDSDLSDVSELDSDIEQEAQISYERQVYKEDLPQLKKKLAGSL----KRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSEDLV-FSGATTGDVYIWKDTTLMKSIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-ANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSKRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPT---LSLVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIWA--------REGIGPRESKVVDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYA--VSIRQMTGVKP------------------------HQQQKEILVDERPPVSRAA-----PLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGA--VEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGLPV-----EIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDLADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFSSDNRLLAVGSVESAVDFYDL-----TLGPS----------LNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSGKLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----SEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWRC 1777          

HSP 2 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 503/1323 (38.02%), Postives = 774/1323 (58.50%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTNIGY---PNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT---RDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQL-LTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKV-----TKSDIEDGKK--RKKAP----------------SQGLQLEWVHGYRGYDCRNNIFYLQSG-EIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAI---SHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            +  + AP+  L L +V+GYRG  C NNLFYT + ++VY VA + +VY+ +Q  Q +Y  H+DDI+S+ +    + VA+GQVG+ P I +W+  +L+  S+LK QH  G+ ++ F+  G  L+SVG+D    + +WDWKKG+ L+ +R H D++    F+V   P    K VT G+KHIKFW   G  L+ ++GI+G  G+ +T+++ C   S++ V +SG   GDVYIW++  L + I   H G ++++ S   G+VTGGKD  V L D  F+       + R  L  ++ G     N  +R++     + LVGT+  +I+EI  S P     L+ GH  GE+W L  HP   I AT SDD +LRIW+++    +  +R + K  R C F+ DG  +A+G+ DGSF V+      DM+  H+   RKE++ +++FS D G +LAV S+D+FVDIY+   S KR G+CKG SS ITH+DW +    ++ N+GA E L F+AP G   T + L    ++WA +T VLG   +GIW   +    +NA+ +  +  L+ATGDDFG VKLF++PS  + A F+KY  HSA+VTNVRWS D   L+S+GG D ++  W    A  G G    +V   ++ SD    + G  +S++ +E   +YT  +    + Q+  V      K  + D +    + AP                 + L L+ V GYRG+DCRNN+ YL  G +I+FH AA  ++ ++++ TQ FY  H DDILCL +  HP  +++IATG++G  P+IHVWD  + +++S+L+  H +G+  V+FS+ GK L SVG+D  H + VW W++G ++ S   H D+IF++++ P ++ Q V+VG+K I+FWT VGG    K+G  G V    + T L  A+  N   + +TG+ +G V++W+++ L   V   H G  + +     D   VTGGK+      G +KL D+   +  ++++L  E   P ++       +RSV  GKGKIL  T  GEIME+   +   N ++ GH +G +WGLA HPSK++  + SDD  +  W++  ++ KL+    L  PA+C   S +G  V++G ++G F+VL + SL        R   I DI+FS +  + LAVGS ++ VD Y      S  R+  CK    ++  LD+S D K + V++G+ ++   E P G + +  +  +++I WASW+ VLGD  +GIWP   +  DVN   ++  G  + TGDDFG VKLF++P   KFAK K+Y GHSAHVTN+R+ ++D+Y++SVGG D ++ VW+
Sbjct:  490 LKRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQAGEVVYHVAAVAVVYNRQQHTQRFYLGHDDDILSLTVHPLKDYVASGQVGRDPAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKI----FVVKGNPFRMDKLVTVGMKHIKFWLHTGGGLTFRRGIFGNLGKQETMMSACYGRSEDLV-FSGATTGDVYIWKDTTLMKSIKA-HDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPM--TLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHH---RKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTS-KRVGICKGASSCITHVDWDVRGKLLQVNTGAKEQLFFEAPRGRRQTISSLEFEKMEWATWTSVLGGTCEGIWPTLS---LVNASSLTKDKKLLATGDDFGFVKLFSFPSKGQFAKFKKYVAHSANVTNVRWSNDDAMLLSVGGADTALMIW----AREGIGPRESKV-VDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYAVSIRQMTGVKPHQQQKEILVDERPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANN--LTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRC-RAFQL--ETGLPVEI-------VRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHTQGRIWGLATHPSKDVFISASDDGTIRFWDL--ADKKLLNKVSLGHPAKCTAYSPNGEMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFS-SDNRLLAVGSVESAVDFYDLTLGPSLNRIGYCKDIPGFVIQLDFSADSKYIEVSTGSYKRQIHEVPSG-KLVSDQALMDRITWASWTSVLGDEVLGIWPRNAEKADVNCACVSHAGINVVTGDDFGLVKLFDFPCSEKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWR 1776          

HSP 3 Score: 351.288 bits (900), Expect = 2.990e-97
Identity = 164/336 (48.81%), Postives = 230/336 (68.45%), Query Frame = 3
Query:  360 IALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDAR---FMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTR 1358
            +AL  D   VATGQVGK P+IC+W+S +L T SIL+D HTHG++ +AF   G  L SVGLD   T+ VWDWKKG+VL++   HSDR+FD     F+    P + V+CG+KHIKFW+LCGN L+ K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+  NL R I   H   ++S+ SC  G+ TGG+D CV L D +F+P+T+IDL+    GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH+ GELWAL +HPK+ +  TGSDD S+R+W ++E   +    +++ +RS  F +DGS +A+G+ DGSF+V+R R
Sbjct:   66 LALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFL----PHRLVSCGVKHIKFWALCGNALTPKRGIFGKTGDLQTIL--CLATAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHSCEEGFATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSLSEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRVR 395          

HSP 4 Score: 224.942 bits (572), Expect = 3.037e-58
Identity = 142/360 (39.44%), Postives = 202/360 (56.11%), Query Frame = 3
Query: 2304 TQRFYASHND--DILC----LGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSL 3356
             Q  Y  HN   +++C    L LHP K  +ATG+VG++P I VWD+  + +VSIL+  H  GV  + F +DG++LASVGLD  + + VWDW+KG  LA+   H D+IF I WDP   ++LV+ G+K I+FW   G   T KRG FG    L T LC A    K  V Y+G+ +G +Y+WK  N+ ++    H  G +++ + ++GF TGG+DG ++L D  F  + K      E  Q  + LS     IRSV     +ILA T   EI E+         +++QGH EGELW L +HP + +  T SDD  + +W +  S H LI    ++   R      DGS +A+G KDGSF VL +
Sbjct:   46 VQPQYKKHNSFPNVICKMAILALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALCGNALTPKRGIFGKTGDLQTILCLA--TAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHSCEEGFATGGRDGCVRLWDVDFKPITKIDLREAE--QGYKGLS-----IRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSL--SEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRV 394          

HSP 5 Score: 204.912 bits (520), Expect = 3.894e-52
Identity = 132/380 (34.74%), Postives = 199/380 (52.37%), Query Frame = 3
Query: 4488 QSFFLEHND--DILC--LTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIR 5609
            Q  + +HN   +++C    +  HP  +  VATGQ+G  P I VW+S   T +S L+ VH +G+  L F + G  L SVG+D  +T+ VW W+ G +LA A GH+ RIF   + P      V+ GVKH+KFW L G+ L  KRG     F     + T+L +A    + TY+GA+NG ++VWK   LTR ++ AH   +F + +   +    +GG++     G ++LWD +    KP      I++R   +  K L       IRS+     +IL GTQD++I E++ +      L MQ H EG L  L +HP  P   + S+D +VR+W L    LI       A   V +  +G+ L +G+K G+F VL  + + L  R
Sbjct:   47 QPQYKKHNSFPNVICKMAILALHPD-KIQVATGQVGKDPYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALCGNALTPKRGI----FGKTGDLQTILCLATAKEEVTYSGALNGDIYVWKGLNLTRTIQAAHGAGIFSMHS--CEEGFATGGRD-----GCVRLWDVDF---KPI---TKIDLREAEQGYKGLS------IRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSLSEHTLIARCNMEEAVRSVSFINDGSQLALGMKDGSFTVLRVRYFSLRSR 402          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 2055.03 bits (5323), Expect = 0.000e+0
Identity = 1039/2039 (50.96%), Postives = 1403/2039 (68.81%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-----LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIED--GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T SILKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGKVL++   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+   L R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+ +T+IDL+ +  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F  DGS +A+G+ DGSF+V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  +D+Y     +K+TG C  +SSFITHLDWS+DS Y++TN GA E L +K P G+H+T    + +I W  +T V+G ++ GIW KYTD  DIN+ D N ++    TGDDFGLVKLF +PS  KGA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR     +T+ +  +      +DS +D SDS LSD+   +S++E+E Q NY R V K+++ QL++  K   +     KR+KAP + L+L++VHGYRGYDCRNN+FY Q+GE+V+HVAA+ +V +    +QRFY  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGV A+DFS+DGK L SVGLDDNH +V WDW+KGEK+A TR HKDKIF++K +PH+ ++LV VGMK I+FW Q GGGFT KRGTFG + KL+T +C +Y      + ++G+ +G +YIWKD +L   +  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   +CATVSDD  L IWE+  S H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ S HHRKE I+DIKFSP  GKYLAV SHDNFVDIY+ +S +R+ +CKG SSYITH+DW T GKLL VNSGAKEQLF+EAPRG R +I   E+EKI W +W+CVLG +C GIWP   DITDVN+ SLT D K LATGDDFG VKLF YP K   AKFK+Y+GHSAHVTNVRWL++D  LL+VGGADTALM+W           S+ NK ++   S+ SDTD+EE+ G+DSDV REKS+DY  K Y+  ++ ++ E  KP        +  LK + + E                     R S S     P +L  +  N   + + +L L HV GYRGFDCR+NLHYL+ +G+ IV+H AA  IV NL +G QSF+LEH DDILCLTVN+HPKY+NV+ATGQIGA PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+A+FRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G + S  V+  +M TMLSVAF  N  T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET +PL     + +RS+ R KGK+L+GT+D +I+E+ EK      +M  H EG + GLA HP      +AS DGT RIWDL  K L+  ++ G  A C  YSPNG  + IG+++G F +L   S ++  +K+DR   I DI+ SP++  +AVGS +N VD Y L            Q P    +L+R  YCKD+ S  +Q+DFS D  +I+     YK +++   +G+ V +   I++I W +W+S++G+EV GIWP  +DKADVN A VSH     VTGDD+GLVKL+  FP           +  + GHS++VTNVRF +DD +++STGG+DC VFVW+C
Sbjct:    1 MADRTAPACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQ-PNRLVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDVTYSGALNGDIYVWKGLTLARTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRILAGTQDSEIFEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGLIDVYAVAQRYKKTGECNKSSSFITHLDWSVDSNYLQTNDGAGERLFYKMPSGKHLTNKDEIKAIHWFSWTCVVGPEVSGIWPKYTDITDINSVDANFSSTAAVTGDDFGLVKLFRFPSLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVTNGVIETAPQEGIIDSCSDESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDCRNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGHDDDILSLAIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGTFGTIGKLETMMCVSYG-RAEDLVFSGAATGDIYIWKDVVLLKTIKAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELS-SQHRMLAVRKLKKGGRCCAFSPDGKALAVGLSDGSFLVVNADTLEDMVSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSKRVGICKGASSYITHIDWDTRGKLLQVNSGAKEQLFYEAPRGKRYVIKAAEMEKIEWHTWTCVLGPTCEGIWPAHSDITDVNAASLTKDRKALATGDDFGFVKLFSYPVKGCDAKFKKYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIWTRE-----AFGSLENKPVD---SEESDTDAEEDGGYDSDVAREKSIDYTTKIYA--VSIREMEGTKP--------HQQLKEASAEE---------------------RPSVSRAIPQPEKLQKNNINKKKKVIEELSLDHVFGYRGFDCRDNLHYLN-DGADIVFHTAAASIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYKNVIATGQIGATPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSALLYKKGIVGS--VDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQPL-----DCVRSVCRGKGKVLVGTKDGEIIEVGEKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYSPNGEMVTIGMRNGEFVILLVNSLKIWGKKRDRKGAIQDIRISPDNRYLAVGSAENTVDFYDL-----------TQGP----SLNRFGYCKDIPSFVIQMDFSADSKYIQVATGAYKRQVHEVPSGKQVVDGAVIDRITWATWTSILGDEVIGIWPRNADKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNVRFSHDDKYIISTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 2030.76 bits (5260), Expect = 0.000e+0
Identity = 1030/2035 (50.61%), Postives = 1390/2035 (68.30%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-----LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIED--GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI---PSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDC 6224
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T SILKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGKVL++   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+   L R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+ +T+IDL+ +  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F  DGS +A+G+ DGSF+V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  +D+Y     +K+TG C  +SSFITHLDWS+DS Y++TN GA E L +K P G+H+T    + +I W  +T V+G ++ GIW KYTD  DIN+ D N ++    TGDDFGLVKLF +PS  KGA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR     +T+ +  +      +DS +D SDS LSD+   +S++E+E Q NY R V K+++ QL++  K   +     KR+KAP + L+L++VHGYRGYDCRNN+FY Q+GE+V+HVAA+ +V +    +QRFY  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGV A+DFS+DGK L SVGLDDNH +V WDW+KGEK+A TR HKDKIF++K +PH+ ++LV VGMK I+FW Q GGGFT KRGTFG + KL+T +C +Y      + ++G+ +G +YIWKD +L   +  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   +CATVSDD  L IWE+  S H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ S HHRKE I+DIKFSP  GKYLAV SHDNFVDIY+ +S +R+ +CKG SSYITH+DW T GKLL VNSGAKEQLF+EAPRG R +I   E+EKI W +W+CVLG +C GIWP   DITDVN+ SLT D K LATGDDFG VKLF YP K   AKFK+Y+GHSAHVTNVRWL++D  LL+VGGADTALM+W   R+      S+ NK ++   S+ SDTD+EE+ G+DSDV REKS+DY  K Y+  ++ ++ E  KP        +  LK + + E      V     L   S  I +         P +L  +  N   + + +L L HV GYRGFDCR+NLHYL+ +G+ IV+H AA  IV NL +G QSF+LEH DDILCLTVN+HPKY+NV+ATGQIG +   PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+A+FRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G + S  V+  +M TMLSVAF  N  T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET +PL     + +RS+ R KGK+L+GT+D +I+E+ EK      +M  H EG + GLA HP      +AS DGT RIWDL  K L+  ++ G  A C  YSPNG  + IG+++G F +L   S ++  +K+DR   I DI+ SP++  +AVGS +N VD Y L            Q P    +L+R  YCKD+ S  +Q+DFS D  +I+  +  Y+V +   S   +                S++G+EV GIWP  +DKADVN A VSH     VTGDD+GLVKL+  FP           +  + GHS++VTNVRF +DD +++STGG+DC
Sbjct:    1 MADRTAPACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQ-PNRLVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDVTYSGALNGDIYVWKGLTLARTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRILAGTQDSEIFEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGLIDVYAVAQRYKKTGECNKSSSFITHLDWSVDSNYLQTNDGAGERLFYKMPSGKHLTNKDEIKAIHWFSWTCVVGPEVSGIWPKYTDITDINSVDANFSSTAAVTGDDFGLVKLFRFPSLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVTNGVIETAPQEGIIDSCSDESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDCRNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGHDDDILSLAIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGTFGTIGKLETMMCVSYG-RAEDLVFSGAATGDIYIWKDVVLLKTIKAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELS-SQHRMLAVRKLKKGGRCCAFSPDGKALAVGLSDGSFLVVNADTLEDMVSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSKRVGICKGASSYITHIDWDTRGKLLQVNSGAKEQLFYEAPRGKRYVIKAAEMEKIEWHTWTCVLGPTCEGIWPAHSDITDVNAASLTKDRKALATGDDFGFVKLFSYPVKGCDAKFKKYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIWT--REAF---GSLENKPVD---SEESDTDAEEDGGYDSDVAREKSIDYTTKIYA--VSIREMEGTKP--------HQQLKEASAEERYIMQTVFCPFFLPSVSRAIPQ---------PEKLQKNNINKKKKVIEELSLDHVFGYRGFDCRDNLHYLN-DGADIVFHTAAASIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYKNVIATGQIGKMISTPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSALLYKKGIVGS--VDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQPL-----DCVRSVCRGKGKVLVGTKDGEIIEVGEKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYSPNGEMVTIGMRNGEFVILLVNSLKIWGKKRDRKGAIQDIRISPDNRYLAVGSAENTVDFYDL-----------TQGP----SLNRFGYCKDIPSFVIQMDFSADSKYIQVFMAHYRVYLPFISASNL------------SVSLSILGDEVIGIWPRNADKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNVRFSHDDKYIISTGGDDC 1953          

HSP 2 Score: 865.529 bits (2235), Expect = 0.000e+0
Identity = 534/1378 (38.75%), Postives = 765/1378 (55.52%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS-AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFC-TNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK---MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQ-IVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP+  L+LEWV+GYRG+ CRNN++Y    E+V+ VA VG+V N    +Q+F+  HNDDI+ L LHP + L+ATG+VG++P I +WD+ T+++VSILK  H  GV  + F S+G++LASVGLD  + + +WDW+KG+ LA+   H D+IF I WDP+  N+LV+ G+K I+FWT  G   T KRG FG    L T LC A    K  V Y+G+ +G +Y+WK   L   +   H  G +++ A ++GF TGG+DG I+L D  F  + K      E  Q  + LS     IRSV     +ILA T   EI E+         +++QGH EGELW LA+HP K +  T SDD  + +W +  ++H LI    ++   R      DGS +A+G KDGSF VL +  + E+     RKE I ++KFSP  G YLAVGS+D  +D+Y+ A  +++   C   SS+ITHLDWS D   L  N GA E+LF++ P G + +  K EI+ I W SW+CV+G    GIWP   DITD+NSV          TGDDFG VKLF +PS  K AKF++Y+GHSAHVTNVRW H+ +++LS GGAD ++  W+     +P E   N      PQ  + D+ S+E +         DSD+E+E  ++Y  + Y E L         P L  Q         S+ RE                                       P+        L+LK VHGYRG+DCRNNL Y  A    +VYH AA+ +V++     Q F+L H+DDIL L +  HP  ++ VATGQ+G   +IHVW++     LS LKG H  G+ +LDFS+ G  L+SVG+D++HTI  W W+ G  +A   GH  +IF+ +  P      V VG+KH+KFW   G    AKRG     F    ++ TM+ V++    D  ++GA  G +++WK  VL + + KAH GPVF ++   +D   V+GGK+     G ++LWD    R    Y    I     S ++K L  +    IR+I+   G IL+GT++ +ILEI +K G +  L+Q H EG + GLA HP LP  ++ S+D T+RIW+L ++   + ++ L  G   C  +SP+G  L +GL  G+F V++A +   ++    R + I DIKFSP++   +AV S+DN VDIY                  +V++  R   CK   S    ID+ T G  ++      +   Y    G+  V +  ++EKI W +W+ V+G    GIWP  SD  DVN A ++    A  TGDD+G VKL+S +PV   +         + GHS++VTNVR++ DDS L++ GG D  + +W
Sbjct:    4 RTAPACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTILCLA--CAKEDVTYSGALNGDIYVWKGLTLARTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDADFKAITKIDLRESE--QGYKGLS-----IRSVCWKADRILAGTQDSEIFEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSL--ADHALIARCNMEEAVRSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSP-DGSYLAVGSNDGLIDVYAVAQRYKKTGECNKSSSFITHLDWSVDSNYLQTNDGAGERLFYKMPSG-KHLTNKDEIKAIHWFSWTCVVGPEVSGIWPKYTDITDINSVDANFSSTAAVTGDDFGLVKLFRFPSLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRF----IP-EGVTNGVIETAPQEGIIDSCSDESDSDLSDVPELDSDIEQETQINYDRQVYKEDL---------PQLKQQNKEKQQSLPSLKREK-------------------------------------APDE------SLKLKFVHGYRGYDCRNNLFYTQA--GEVVYHVAAIAVVYDRLQHSQRFYLGHDDDILSLAI--HP-VKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGT----FGTIGKLETMMCVSYGRAEDLVFSGAATGDIYIWKDVVLLKTI-KAHDGPVFAMYA--LDKGFVTGGKD-----GVVELWDDMFERCLKTYA---IKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEI-DKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKG-GRCCAFSPDGKALAVGLSDGSFLVVNADTLEDMVSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIY------------------NVLSSKRVGICKGASSYITHIDWDTRGKLLQVNSGAKEQLFYEAPRGKRYVIKAAEMEKIEWHTWTCVLGPTCEGIWPAHSDITDVNAASLTKDRKALATGDDFGFVKLFS-YPVKGCDAKFK----KYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIW 1266          

HSP 3 Score: 379.407 bits (973), Expect = 1.135e-105
Identity = 238/633 (37.60%), Postives = 347/633 (54.82%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            QL L+ V+GYRG  CRNNL+Y    G  +VY  A VG+V+N +   Q FFL HNDDI+ L +  HP  R +VATGQ+G  P I +W+S     +S LK VH +G+  L F S G  L SVG+D  +T+ +W W+ G +LA A GH+ RIF   + P   +  V+ GVKH+KFWTL G+ L AKRG     F     + T+L +A    D TY+GA+NG ++VWK   L R ++ AHS  +F ++    +    +GG++     G I+LWD +      F     I++R   +  K L       IRS+     +IL GTQD++I E++ ++     L MQ H EG L  LA+HP  P   + S+D +VR+W L    LI       A   V +  +G+ L +G+K G+F VL  +    ++  KDR + I ++KFSP+ S +AVGSND ++D+Y +           C   +S +T                +D+S D N+++      +   Y   +G+ +   ++I+ I W SW+ VVG EV+GIWP  +D  D+N+   +  S A VTGDD+GLVKL   F  P +   A     V  GHS++VTNVR+ +D   ++STGG D  VF W+
Sbjct:   10 QLRLEWVYGYRGHQCRNNLYY--TAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLAL--HPD-RTLVATGQVGKDPYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFWTLCGNALTAKRGI----FGKTGDLQTILCLACAKEDVTYSGALNGDIYVWKGLTLARTIQGAHSAGIFSMYA--CEEGFATGGRD-----GCIRLWDAD------FKAITKIDLRESEQGYKGLS------IRSVCWKADRILAGTQDSEIFEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGLIDVYAVAQR--YKKTGECNKSSSFIT---------------HLDWSVDSNYLQTNDGAGERLFYKMPSGKHLTNKDEIKAIHWFSWTCVVGPEVSGIWPKYTDITDINSVDANFSSTAAVTGDDFGLVKL---FRFPSLKKGAKFRKYV--GHSAHVTNVRWSHDCQWVLSTGGADHSVFQWR 592          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 1971.05 bits (5105), Expect = 0.000e+0
Identity = 1011/2039 (49.58%), Postives = 1370/2039 (67.19%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-----LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIED--GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T SILKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGKVL++   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+   L R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+ +T+IDL+ +  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F  DGS +A+G+ DGSF+V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  +D+Y     +K+TG C  +SSFITHLDWS+DS Y++TN GA E L +K P G+H+T    + +I W  +T V+G ++ GIW KYTD  DIN+ D N ++    TGDDFGLVKLF +PS  KGA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR     +T+ +  +      +DS +D SDS LSD+   +S++E+E Q NY R V K+++ QL++  K   +     KR+KAP + L+L++VHGYRGYDCRNN+FY Q+GE+V+HVAA+ +V +    +QRFY  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGV A+DFS+DGK L SVGLDDNH +V WDW+KGEK+A TR HKDKIF++K +PH+ ++LV VGMK I+FW Q GGGFT KRGTFG + KL+T +C +Y      + ++G+ +G +YIWKD +L   +  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   +CATVSDD  L IWE+  S H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ S HHRKE I+DIKFSP                                            GKLL VNSGAKEQLF+EAPRG R +I   E+EKI W +W+CVLG +C GIWP   DITDVN+ SLT D K LATGDDFG VKLF YP K   AKFK+Y+GHSAHVTNVRWL++D  LL+VGGADTALM+W   R+      S+ NK ++   S+ SDTD+EE+ G+DSDV REKS+DY  K Y+  ++ ++ E  KP        +  LK + + E                     R S S     P +L  +  N   + + +L L HV GYRGFDCR+NLHYL+ +G+ IV+H AA  IV NL +G QSF+LEH DDILCLTVN+HPKY+NV+ATGQIGA PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+A+FRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G + S  V+  +M TMLSVAF  N  T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET +PL     + +RS+ R KGK+L+GT+D +I+E+ EK      +M  H EG + GLA HP      +AS DGT RIWDL  K L+  ++ G  A C  YSPNG  + IG+++G F +L   S ++  +K+DR   I DI+ SP++  +AVGS +N VD Y L            Q P    +L+R  YCKD+ S  +Q+DFS D  +I+     YK +++   +G+ V +   I++I W +W+S++G+EV GIWP  +DKADVN A VSH     VTGDD+GLVKL+  FP           +  + GHS++VTNVRF +DD +++STGG+DC VFVW+C
Sbjct:    1 MADRTAPACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQ-PNRLVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDVTYSGALNGDIYVWKGLTLARTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRILAGTQDSEIFEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGLIDVYAVAQRYKKTGECNKSSSFITHLDWSVDSNYLQTNDGAGERLFYKMPSGKHLTNKDEIKAIHWFSWTCVVGPEVSGIWPKYTDITDINSVDANFSSTAAVTGDDFGLVKLFRFPSLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVTNGVIETAPQEGIIDSCSDESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDCRNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGHDDDILSLAIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGTFGTIGKLETMMCVSYG-RAEDLVFSGAATGDIYIWKDVVLLKTIKAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELS-SQHRMLAVRKLKKGGRCCAFSPDGKALAVGLSDGSFLVVNADTLEDMVSFHHRKEIIADIKFSP--------------------------------------------GKLLQVNSGAKEQLFYEAPRGKRYVIKAAEMEKIEWHTWTCVLGPTCEGIWPAHSDITDVNAASLTKDRKALATGDDFGFVKLFSYPVKGCDAKFKKYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIWT--REAF---GSLENKPVD---SEESDTDAEEDGGYDSDVAREKSIDYTTKIYA--VSIREMEGTKP--------HQQLKEASAEE---------------------RPSVSRAIPQPEKLQKNNINKKKKVIEELSLDHVFGYRGFDCRDNLHYLN-DGADIVFHTAAASIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYKNVIATGQIGATPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSALLYKKGIVGS--VDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQPL-----DCVRSVCRGKGKVLVGTKDGEIIEVGEKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYSPNGEMVTIGMRNGEFVILLVNSLKIWGKKRDRKGAIQDIRISPDNRYLAVGSAENTVDFYDL-----------TQGP----SLNRFGYCKDIPSFVIQMDFSADSKYIQVATGAYKRQVHEVPSGKQVVDGAVIDRITWATWTSILGDEVIGIWPRNADKADVNCACVSHAGINVVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNVRFSHDDKYIISTGGDDCSVFVWRC 1913          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: EML5 (echinoderm microtubule associated protein like 5 [Source:NCBI gene;Acc:100145498])

HSP 1 Score: 1867.05 bits (4835), Expect = 0.000e+0
Identity = 955/2037 (46.88%), Postives = 1336/2037 (65.59%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR------LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKS--DIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVA--KLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVF 6233
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDWKKGK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN+L+ K+G++GK G++QTIL  C++ + + V YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D CV L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVGSND+ VDIY     +K+ G C G+ +FITH+DWS DS +++TN G+ + + ++ PGG+ ++  + L  I+WA +T V G ++ GIW KY+++NDI++ D N    ++ T DD+G++KLF YP+  KGA FRKY GHSAHVTNVRWS D +++IS+GG D S+FQW+      L D +  +      VDS ++ SDS  SD+   +SE+E+E QT Y R V K+++ QL++  K        K+R++AP   ++L +VHGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  HNDDILCL +HPLKD +ATG+VGRE T+H+WDT+T+K +S+LKG H+ GVCAVDFS+DGK+LASVG+DDNH +V+WDW+KGEKL+S +  K+KIF++K +P+  ++L+  G+K +RFW + GGG   ++   G  A  K+DT +   Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ ALDKGFVTGGKDG + L D++F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSF++++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S+DNFVDIY+ +S +R+ VCKG +SYITHLDW T     +  +GAKEQLFFEAPRG ++ I   E+EKI WASW+ V G SC GIWP   +++DV + SLT+DGKVLATGDDFG VKLF YP K KF KFK+Y+ HS+HVTN+RW+H+D  L++VGG+DT+LM+W H  +         +++  +  S+ SD DSEE+ G+DSDV RE  M+Y  K  S   N +    +KP L  +  S +  +  VSR      K+Q+          +G++ R                P+ + V +L    V GYRG DCRNN+HYL+ +G  I+YHAA+VGI++N+ +G QSF+ EH DDILCLTVN+HPK+ N+VATGQ+   PSIHVW+++    LS L+  H  GICS+ FS+TG LLLSVG+D +HT+ +WKW+ G  +A   GH QRIF+AEFRPDSD+ FV+VGVKHV+FWTLAG  L++K+G + S  +   RM TML+VAF   + T+TG ++G V VWK  +L+RIV KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET +     + + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++                                          K + G     + +SP   ++A+G  +    I                    ++  S   + K    P V +               YK  +Y   +G+++ E   I++I W +W+SV+G+EV GIW   ++K+DV  A VSH   + VTGDD+G+VKL+  FP P         +  F GHS+++ N+RF + D ++VS GG+D CV+
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNSLTPKRGVFGKTGDLQTIL--CLACARDEVTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSMNACEEGFATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGVVQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPGGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKLFRYPALKKGAKFRKYLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWKFIPDRKLKDVLHIAPQ-ESLVDSNSEESDSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQCKDLHRSASSKRRERAPLNSIRLHFVHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHNDDILCLAIHPLKDYVATGQVGRESTVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRAGGGLIGRKACIGTGAGAKIDTMMSVVYGWTEE-MSFSGTSTGDVCIWRDLFLMKTVKAHDGPVFSMHALDKGFVTGGKDGVVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCSFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIYNVMSSKRIGVCKGSASYITHLDWDTRSVTPVCYTGAKEQLFFEAPRGKKRNIPSHEVEKISWASWTSVQGPSCEGIWPVIGEVSDVMAASLTNDGKVLATGDDFGFVKLFRYPVKGKFGKFKRYVAHSSHVTNLRWIHDDSLLITVGGSDTSLMLWTHEME--------GHRETRLCDSEESDLDSEEDGGYDSDVTRENEMNYTIKALST--NIRPMVGIKPHLQQKELSLDE-RPPVSRALPPPEKLQT--------NNVGKKKR----------------PIEDLVLEL----VFGYRGKDCRNNVHYLN-DGDDILYHAASVGILYNVATGSQSFYQEHTDDILCLTVNQHPKFINIVATGQVATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFRPDSDTQFVSVGVKHVRFWTLAGRALLSKKGMLSS--IEDARMQTMLAVAFGAGNLTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRL----------ETGQ-----TTDCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILINGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIGDKKMLN-----------------------------------------KVNLGHAARTVCYSPEGDMVAIGMKNGEFII--------------------LLVTSLKIWGKKRDHPCVIVSTGC-----------YKRLVYEVPSGKLLTEQAVIDRITWATWTSVLGDEVVGIWSRHNEKSDVTCACVSHSGISLVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSAHLANIRFTSGDRYVVSAGGDDYCVW 1897          

HSP 2 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 517/1378 (37.52%), Postives = 762/1378 (55.30%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAF-CTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL---ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXX-XXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP+  L+LEWV+GYRG+ CRNN++Y  + EIV+ VA VG+V N     Q+FY  HNDDI+ L LHP + L+ATG+VG+EP I VWD+ T+++VSILK  H  G+  + F  DG++L SVGLD  + + VWDW+KG+ L+    H D+IF I WD +  N+LV+ G+K I+FW+  G   T KRG FG    L T LC A   ++  V Y+G+ +G +Y+WK  N+ ++    H  G ++++A ++GF TGG+DG ++L D  F  +  +     E  Q  + LS     +RSV      IL  T   EI E+         +++QGH EGELW LAVHP+K +  T SDD  + IW +   +H LI    ++ P RC  +S DG  +A+G KDGSF VL +  + E+     RKE I ++K+SP  G +LAVGS+D+ VDIY  +  ++++  C G  ++ITH+DWS+D K L  N G+ +++F+  P G +++  K E++ I WA W+CV G    GIWP   +  D++SV     G+VL T DD+G +KLF YP+  K AKF++YLGHSAHVTNVRW H+ ++++SVGGAD ++  WK   D   L+D ++      PQ  L D++SEE +         DS++E+E    Y  + Y E L Q + +              +L  S S +                     RR R+            P N +        L  VHGYRG+DCR+NL Y   +   IVYH AAVG+V+N Q   Q F+L HNDDILCL +  HP  ++ VATGQ+G   ++H+W++     LS LKG H  G+C++DFS+ G  L SVGID++HTI +W W+ G  L+   G  ++IF+ +  P      +  G+KH++FW  AG  LI ++  I +      ++ TM+SV +  T + +++G   G V +W+   L + V KAH GPVF +    +D   V+GGK+     G + LWD    R    Y    I     +  +K L  +    IR+IS   G IL+GT++ +ILE+ +K G V  L+Q H EG + GLA HP LP  ++ S+D T+RIWDL      + ++ L  G   C  +SP+G  L +GL  G+F +++A +   L+    R   I+DI+FSP +   +AV S DN VDIY                  +V++  R   CK   S    +D+ T      C     +   +    G+  N P    + I   SW+SV G    GIWP   + +DV  A +++      TGDD+G VKL+  +PV             +  HSS+VTN+R+++DDS L++ GG D  + +W
Sbjct:    4 RTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLCGNSLTPKRGVFGKTGDLQTILCLACARDE--VTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSMNACEEGFATGGRDGCVRLWDLNFKPI--TVIDLRETDQGYKGLS-----VRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSL--IDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSP-DGSFLAVGSNDSCVDIYGVVQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMP-GGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKLFRYPALKKGAKFRKYLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWKFIPDR-KLKDVLHIA----PQESLVDSNSEESDSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQC------------KDLHRSASSK---------------------RRERA------------PLNSI-------RLHFVHGYRGYDCRSNLFY--TQTGEIVYHVAAVGVVYNRQQNTQRFYLGHNDDILCLAI--HP-LKDYVATGQVGRESTVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRAGGGLIGRKACIGTG--AGAKIDTMMSVVYGWTEEMSFSGTSTGDVCIWRDLFLMKTV-KAHDGPVFSMHA--LDKGFVTGGKD-----GVVALWDDSFERCLKTYA---IKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEV-DKSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKG-GRCCSFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIY------------------NVMSSKRIGVCKGSASYITHLDWDTRSVTPVCYTGAKEQLFFEAPRGKKRNIPSHEVEKISWASWTSVQGPSCEGIWPVIGEVSDVMAASLTNDGKVLATGDDFGFVKLF-RYPV----KGKFGKFKRYVAHSSHVTNLRWIHDDSLLITVGGSDTSLMLW 1268          

HSP 3 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 467/1316 (35.49%), Postives = 721/1316 (54.79%), Query Frame = 3
Query:  177 APNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDAR---FMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTNIGY---PNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSP-DGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAP-GGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGL--SDIGACNSELEKEAQTNYT--------------------RLVSKDE---VNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGE-IVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            AP + + L +V+GYRG+ C +NLFYT + +IVY VA +G+VY+ +Q  Q +Y  HNDDI+ +A+    + VATGQVG+   + IW++ +++  S+LK  H +G+ +V FS  G  L SVG+D N T+ +WDWKKG+ LSS +   +++F  +   +M    P K +T GIKH++FW   G  L  +K   G     +I T+++V    ++  + +SGT  GDV IWR+  L + +   H G ++S+ +   G+VTGGKD  V L D  F+       + R  L   + G     N  +R++     + LVGT+  +I+E+  S P     L+ GH  GE+W L  HP   I AT SDD +LRIW ++    +  +R + K  R C F+ DG  +A+G+ DGSF ++    + ++ +   RK+++ +++FSP  G +LAV S DNFVDIY+  +S KR GVCKG++S+ITHLDW   S      +GA E L F+AP G +    +  +  I WA +T V G   +GIW    + +D+ AA +  +  ++ATGDDFG VKLF YP   K   F++Y  HS+HVTN+RW  D   LI++GG D S+  W  T  + G     H+     D  +S L   + G  +S++ +E + NYT                    + +S DE   V++     +    +   +KK P + L LE V GYRG DCRNN+ YL  G+ I++H A+VGI+ N+A+ +Q FY  H DDILCL +  HP   +++ATG+V   P+IHVWD  + +++S+L+  H +G+C+V FS+ GK L SVGLD  H + +W W++G ++AS   H  +IF+ ++ P ++ Q V+VG+K +RFWT  G    +K+G   ++  A++ T L  A+      + +TG+ SG V +WKD+IL   V   H G  + +     D   VTGGK+      G +KL D+   +  ++++L           ++ C  +RSV  GKGKIL  T + EI+E+   +   NIL+ GH +G +WGLA HPS++   + ++D                      G  R  DI             G   +L+  +LG  A +         + +SP  G  +A+G  +    I    S +     +             D   ++V++G  ++L +E P G + +  +  I++I WA+W+ VLGD  +GIW    + +DV    ++  G  L TGDDFG VKLF++P   KFAK K++LGHSAH+ N+R+   D Y++S GG D    VW+
Sbjct:  672 APLNSIRLHFVHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHNDDILCLAIHPLKDYVATGQVGRESTVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYM----PDKLITAGIKHMRFWRRAGGGLIGRKACIGTGAGAKIDTMMSVVYGWTEE-MSFSGTSTGDVCIWRDLFLMKTVKA-HDGPVFSMHALDKGFVTGGKDGVVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGP--VTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRCCSFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIYNVMSS-KRIGVCKGSASYITHLDWDTRSVTPVCYTGAKEQLFFEAPRGKKRNIPSHEVEKISWASWTSVQGPSCEGIWPVIGEVSDVMAASLTNDGKVLATGDDFGFVKLFRYPVKGKFGKFKRYVAHSSHVTNLRWIHDDSLLITVGGSDTSLMLW--THEMEG-----HRETRLCDSEESDLDSEEDGGYDSDVTRENEMNYTIKALSTNIRPMVGIKPHLQQKELSLDERPPVSRALPPPEKLQTNNVGKKKRPIEDLVLELVFGYRGKDCRNNVHYLNDGDDILYHAASVGILYNVATGSQSFYQEHTDDILCLTVNQHPKFINIVATGQVATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFRPDSDTQFVSVGVKHVRFWTLAGRALLSKKGMLSSIEDARMQTMLAVAFGAGN--LTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRC-RAFRLETGQ-------TTDC--VRSVCRGKGKILVGTRNAEIIEVGEKNAACNILINGHVDGPIWGLATHPSRDFFLSAAED----------------------GTVRLWDI-------------GDKKMLNKVNLGHAART---------VCYSPE-GDMVAIGMKNGEFIILLVTSLKIWGKKR-------------DHPCVIVSTGCYKRLVYEVPSG-KLLTEQAVIDRITWATWTSVLGDEVVGIWSRHNEKSDVTCACVSHSGISLVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSAHLANIRFTSGDRYVVSAGGDDYC--VWR 1898          

HSP 4 Score: 359.762 bits (922), Expect = 1.280e-99
Identity = 233/642 (36.29%), Postives = 347/642 (54.05%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPYRQ 6269
             L L+ V+GYRG  CRNNL+Y  A+   IVY  A VG+V+N +  +Q F++ HNDDI+ L +  HP+ R +VATGQ+G  P I VW+S     +S LK VH +GI  L F   G  L+SVG+D  +TI VW W+ G +L+ A GHT RIF   +     +  V+ GVKH+KFW+L G+ L  KRG     F     + T+L +A   ++ TY+GA+NG ++VWK   L R ++ AH+  +F +     +    +GG++     G ++LWD   +  KP  +   I++R   +  K L       +RS+      IL+GTQD++I EI+  +    +L MQ H EG L  LAVHP  P   + S+D +VRIW L    LI       P  C   S +G +L +G+K G+F VL  +    ++  KDR + I ++K+SP+ S +AVGSND+ VDIY +                 V    +   C    +    +D+S+D  F++      K   Y    G+ V+  E+++ I W  W+ V G EV GIWP  S+  D+++   ++     VT DDYG++KL   F  P +   A      + GHS++VTNVR+ +D   ++S GG D  VF WK   ++P R+
Sbjct:   10 HLRLEWVYGYRGHQCRNNLYYTAAK--EIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLAL--HPE-RVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLCGNSLTPKRGV----FGKTGDLQTILCLACARDEVTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSM--NACEEGFATGGRD-----GCVRLWD---LNFKPITV---IDLRETDQGYKGLS------VRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGV-----------------VQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPGGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKL---FRYPALKKGAKFRK--YLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWK---FIPDRK 598          

HSP 5 Score: 254.218 bits (648), Expect = 4.446e-67
Identity = 141/418 (33.73%), Postives = 237/418 (56.70%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVI 1349
             + Q   +  K  P   L L+ V+GYRG  C NN+ Y N  + I+Y  A +GI+Y++    Q +Y EH DDI+ + +    +   +VATGQV  +P I +W++ S +T S+L+  H+ GI SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ G+KH++FW+L G  L SKKG+    +   +QT+L V     +  + ++GT++GDV +W+++ L R++A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++
Sbjct: 1348 EKLQTNNVGKKKRPIEDLVLELVFGYRGKDCRNNVHYLNDGDDILYHAASVGILYNVATGSQSFYQEHTDDILCLTVNQHPKFINIVATGQVATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFR-PDSDTQFVSVGVKHVRFWTLAGRALLSKKGMLSSIEDARMQTMLAVAFGAGN--LTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRLE---TGQTTDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILINGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIGDKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIIL 1757          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: EML5 (echinoderm microtubule associated protein like 5 [Source:NCBI gene;Acc:100145498])

HSP 1 Score: 1861.27 bits (4820), Expect = 0.000e+0
Identity = 953/2041 (46.69%), Postives = 1329/2041 (65.12%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR------LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKS--DIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVA--KLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDC 6224
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDWKKGK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN+L+ K+G++GK G++QTIL  C++ + + V YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D CV L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVGSND+ VDIY     +K+ G C G+ +FITH+DWS DS +++TN G+ + + ++ PGG+ ++  + L  I+WA +T V G ++ GIW KY+++NDI++ D N    ++ T DD+G++KLF YP+  KGA FRKY GHSAHVTNVRWS D +++IS+GG D S+FQW+      L D +  +      VDS ++ SDS  SD+   +SE+E+E QT Y R V K+++ QL++  K        K+R++AP   ++L +VHGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  HNDDILCL +HPLKD +ATG+VGRE T+H+WDT+T+K +S+LKG H+ GVCAVDFS+DGK+LASVG+DDNH +V+WDW+KGEKL+S +  K+KIF++K +P+  ++L+  G+K +RFW + GGG   ++   G  A  K+DT +   Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ ALDKGFVTGGKDG + L D++F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSF++++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S+DNFVDIY+ +S +R+ VCKG +SYITHLDW T     +  +GAKEQLFFEAPRG ++ I   E+EKI WASW+ V G SC GIWP   +++DV + SLT+DGKVLATGDDFG VKLF YP K KF KFK+Y+ HS+HVTN+RW+H+D  L++VGG+DT+LM+W H  +         +++  +  S+ SD DSEE+ G+DSDV RE  M+Y  K  S   N +    +KP L                        Q   L L +   + R   S     P +L ++        +  L L+ V GYRG DCRNN+HYL+ +G  I+YHAA+VGI++N+ +G QSF+ EH DDILCLTVN+HPK+ N+VATGQ+G         PSIHVW+++    LS L+  H  GICS+ FS+TG LLLSVG+D +HT+ +WKW+ G  +A   GH QRIF+AEFRPDSD+ FV+VGVKHV+FWTLAG  L++K+G + S  +   RM TML+VAF   + T+TG ++G V VWK  +L+RIV KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET +     + + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K +                                         + K + G     + +SP   ++A+G  +    I                    ++  S   + K    P V +               YK  +Y   +G+++ E   I++I W +W+SV+G+EV GIW   ++K+DV  A VSH   + VTGDD+G+VKL+  FP P         +  F GHS+++ N+RF + D ++VS GG+DC
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNSLTPKRGVFGKTGDLQTIL--CLACARDEVTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSMNACEEGFATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGVVQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPGGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKLFRYPALKKGAKFRKYLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWKFIPDRKLKDVLHIAPQ-ESLVDSNSEESDSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQCKDLHRSASSKRRERAPLNSIRLHFVHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHNDDILCLAIHPLKDYVATGQVGRESTVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRAGGGLIGRKACIGTGAGAKIDTMMSVVYGWTEE-MSFSGTSTGDVCIWRDLFLMKTVKAHDGPVFSMHALDKGFVTGGKDGVVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCSFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIYNVMSSKRIGVCKGSASYITHLDWDTRSVTPVCYTGAKEQLFFEAPRGKKRNIPSHEVEKISWASWTSVQGPSCEGIWPVIGEVSDVMAASLTNDGKVLATGDDFGFVKLFRYPVKGKFGKFKRYVAHSSHVTNLRWIHDDSLLITVGGSDTSLMLWTHEME--------GHRETRLCDSEESDLDSEEDGGYDSDVTRENEMNYTIKALST--NIRPMVGIKPHL------------------------QQKELSLDERQGVVRPPVSRALPPPEKLQTNNVGKKKRPIEDLVLELVFGYRGKDCRNNVHYLN-DGDDILYHAASVGILYNVATGSQSFYQEHTDDILCLTVNQHPKFINIVATGQVGDAADMSATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFRPDSDTQFVSVGVKHVRFWTLAGRALLSKKGMLSS--IEDARMQTMLAVAFGAGNLTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRL----------ETGQ-----TTDCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILINGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIGDKKM-----------------------------------------LNKVNLGHAARTVCYSPEGDMVAIGMKNGEFII--------------------LLVTSLKIWGKKRDHPCVIVSTGC-----------YKRLVYEVPSGKLLTEQAVIDRITWATWTSVLGDEVVGIWSRHNEKSDVTCACVSHSGISLVTGDDFGMVKLF-DFPCPE----KFAKHKRFLGHSAHLANIRFTSGDRYVVSAGGDDC 1906          

HSP 2 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 517/1378 (37.52%), Postives = 762/1378 (55.30%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAF-CTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL---ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXX-XXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP+  L+LEWV+GYRG+ CRNN++Y  + EIV+ VA VG+V N     Q+FY  HNDDI+ L LHP + L+ATG+VG+EP I VWD+ T+++VSILK  H  G+  + F  DG++L SVGLD  + + VWDW+KG+ L+    H D+IF I WD +  N+LV+ G+K I+FW+  G   T KRG FG    L T LC A   ++  V Y+G+ +G +Y+WK  N+ ++    H  G ++++A ++GF TGG+DG ++L D  F  +  +     E  Q  + LS     +RSV      IL  T   EI E+         +++QGH EGELW LAVHP+K +  T SDD  + IW +   +H LI    ++ P RC  +S DG  +A+G KDGSF VL +  + E+     RKE I ++K+SP  G +LAVGS+D+ VDIY  +  ++++  C G  ++ITH+DWS+D K L  N G+ +++F+  P G +++  K E++ I WA W+CV G    GIWP   +  D++SV     G+VL T DD+G +KLF YP+  K AKF++YLGHSAHVTNVRW H+ ++++SVGGAD ++  WK   D   L+D ++      PQ  L D++SEE +         DS++E+E    Y  + Y E L Q + +              +L  S S +                     RR R+            P N +        L  VHGYRG+DCR+NL Y   +   IVYH AAVG+V+N Q   Q F+L HNDDILCL +  HP  ++ VATGQ+G   ++H+W++     LS LKG H  G+C++DFS+ G  L SVGID++HTI +W W+ G  L+   G  ++IF+ +  P      +  G+KH++FW  AG  LI ++  I +      ++ TM+SV +  T + +++G   G V +W+   L + V KAH GPVF +    +D   V+GGK+     G + LWD    R    Y    I     +  +K L  +    IR+IS   G IL+GT++ +ILE+ +K G V  L+Q H EG + GLA HP LP  ++ S+D T+RIWDL      + ++ L  G   C  +SP+G  L +GL  G+F +++A +   L+    R   I+DI+FSP +   +AV S DN VDIY                  +V++  R   CK   S    +D+ T      C     +   +    G+  N P    + I   SW+SV G    GIWP   + +DV  A +++      TGDD+G VKL+  +PV             +  HSS+VTN+R+++DDS L++ GG D  + +W
Sbjct:    4 RTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLCGNSLTPKRGVFGKTGDLQTILCLACARDE--VTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSMNACEEGFATGGRDGCVRLWDLNFKPI--TVIDLRETDQGYKGLS-----VRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSL--IDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSP-DGSFLAVGSNDSCVDIYGVVQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMP-GGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKLFRYPALKKGAKFRKYLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWKFIPDR-KLKDVLHIA----PQESLVDSNSEESDSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQC------------KDLHRSASSK---------------------RRERA------------PLNSI-------RLHFVHGYRGYDCRSNLFY--TQTGEIVYHVAAVGVVYNRQQNTQRFYLGHNDDILCLAI--HP-LKDYVATGQVGRESTVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRAGGGLIGRKACIGTG--AGAKIDTMMSVVYGWTEEMSFSGTSTGDVCIWRDLFLMKTV-KAHDGPVFSMHA--LDKGFVTGGKD-----GVVALWDDSFERCLKTYA---IKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEV-DKSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKG-GRCCSFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIY------------------NVMSSKRIGVCKGSASYITHLDWDTRSVTPVCYTGAKEQLFFEAPRGKKRNIPSHEVEKISWASWTSVQGPSCEGIWPVIGEVSDVMAASLTNDGKVLATGDDFGFVKLF-RYPV----KGKFGKFKRYVAHSSHVTNLRWIHDDSLLITVGGSDTSLMLW 1268          

HSP 3 Score: 359.377 bits (921), Expect = 2.012e-99
Identity = 233/642 (36.29%), Postives = 347/642 (54.05%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPYRQ 6269
             L L+ V+GYRG  CRNNL+Y  A+   IVY  A VG+V+N +  +Q F++ HNDDI+ L +  HP+ R +VATGQ+G  P I VW+S     +S LK VH +GI  L F   G  L+SVG+D  +TI VW W+ G +L+ A GHT RIF   +     +  V+ GVKH+KFW+L G+ L  KRG     F     + T+L +A   ++ TY+GA+NG ++VWK   L R ++ AH+  +F +     +    +GG++     G ++LWD   +  KP  +   I++R   +  K L       +RS+      IL+GTQD++I EI+  +    +L MQ H EG L  LAVHP  P   + S+D +VRIW L    LI       P  C   S +G +L +G+K G+F VL  +    ++  KDR + I ++K+SP+ S +AVGSND+ VDIY +                 V    +   C    +    +D+S+D  F++      K   Y    G+ V+  E+++ I W  W+ V G EV GIWP  S+  D+++   ++     VT DDYG++KL   F  P +   A      + GHS++VTNVR+ +D   ++S GG D  VF WK   ++P R+
Sbjct:   10 HLRLEWVYGYRGHQCRNNLYYTAAK--EIVYFVAGVGVVYNTREHKQKFYMGHNDDIISLAL--HPE-RVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLCGNSLTPKRGV----FGKTGDLQTILCLACARDEVTYSGALNGDIYVWKGLNLARTIQGAHAAGIFSM--NACEEGFATGGRD-----GCVRLWD---LNFKPITV---IDLRETDQGYKGLS------VRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGV-----------------VQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPGGKEVSNKEELKGIQWARWTCVSGLEVNGIWPKYSESNDISSVDANYPGQVLVTADDYGIIKL---FRYPALKKGAKFRK--YLGHSAHVTNVRWSHDYQWIISVGGADHSVFQWK---FIPDRK 598          

HSP 4 Score: 249.21 bits (635), Expect = 1.523e-65
Identity = 142/425 (33.41%), Postives = 238/425 (56.00%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVG-------KSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVI 1349
             + Q   +  K  P   L L+ V+GYRG  C NN+ Y N  + I+Y  A +GI+Y++    Q +Y EH DDI+ + +    +   +VATGQVG        +P I +W++ S +T S+L+  H+ GI SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ G+KH++FW+L G  L SKKG+    +   +QT+L V     +  + ++GT++GDV +W+++ L R++A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++
Sbjct: 1353 EKLQTNNVGKKKRPIEDLVLELVFGYRGKDCRNNVHYLNDGDDILYHAASVGILYNVATGSQSFYQEHTDDILCLTVNQHPKFINIVATGQVGDAADMSATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFR-PDSDTQFVSVGVKHVRFWTLAGRALLSKKGMLSSIEDARMQTMLAVAFGAGN--LTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRLE---TGQTTDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILINGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIGDKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIIL 1769          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml6 (echinoderm microtubule associated protein like 6 [Source:MGI Symbol;Acc:MGI:2442895])

HSP 1 Score: 2040.39 bits (5285), Expect = 0.000e+0
Identity = 1028/2039 (50.42%), Postives = 1393/2039 (68.32%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  L+ATGQVGK P+ICIWNS ++ T SILKD HTHG++ +AF   G +L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+   L R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L +K P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   KGA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS  SD+   +S++E+E Q NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N     QR Y  H+DDIL L +HP+KD +ATG+VGR+  +HVWDTQT+K +S+LKG H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +P + ++LV VG+K I+FW Q GGGFT+KRG+FG+  KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  S H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGAKEQLFFEAPRG +  I  +E EKI W +W+CVLG +C GIWP   D+TDVN+ +LT DG +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W   R+ V  ++S       +  S+ SDTD+EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP    +  S    +  VSR      K+Q                  N  T  ++L           V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA GIV NL +G QSF+LEH DDILCLTVN+HPKYRNVVAT QIG  PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ GT +A   GH +RIF+ EFRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G I S  +   +M TMLSVAF  N+ T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + +     E +RS+ R KGKIL+GT+D +I+E+ EK      L+  H EG + GLA HP    + SAS DGT RIWDL  K L+  +  G  A C  YSP+G  + IG+K+G F +L   + ++  +K+DR   I DI+ SP++  +AVGS++  VD Y L  T G              +L+R  YCKD+ S  +Q+DFS D  +I+     YK +++    G+ V E   +EKI W SW+SV+G+EV GIWP  +DKADVN A V+H     VTGDD+GL+KL+  FP           +  + GHS++VTN+RF +DD ++VSTGG+DC VFVW+C
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDVHTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRMVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLTLVRTIQGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTEVIDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEAVSNGVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAVHVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATTRGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKRGSFGSAGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRTALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-SQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMLSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRGRKHTIRPSEAEKIEWDTWTCVLGPTCEGIWPAHSDVTDVNAANLTKDGSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--REFVGTQES------KLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKPHQQLKEVSMEE-RPPVSRAAPQPEKLQ-----------------KNNITKKKKL-----------VEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHTKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGS--MEAAKMQTMLSVAFGANNLTFTGAINGDVYVWKEHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQLV-----ECVRSVCRGKGKILVGTKDGEIIEVGEKSAASNILIDGHMEGEIWGLATHPSKDMFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNTLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEQTVDFYDL--TQG-------------TSLNRIGYCKDIPSFVIQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVVEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLLKLF-DFPC----TEKFAKHKRYFGHSAHVTNIRFSSDDKYVVSTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml5 (echinoderm microtubule associated protein like 5 [Source:MGI Symbol;Acc:MGI:2442513])

HSP 1 Score: 1924.44 bits (4984), Expect = 0.000e+0
Identity = 994/2055 (48.37%), Postives = 1383/2055 (67.30%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASV--SRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPY 6263
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q ++  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+G++LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ SC  G+ TGG+D C+ L D  F+P+T IDL+ T  GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G+ + L++K PGG+ +T  + +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G+VKLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       +S +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++ P   ++L ++HGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IHVWDT+T+K +SILKG H+ G+CAVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+ TR  KDKIF++K +P+  ++L+  G+K ++FW + GGG   K+G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +   +L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+FVDIY+  S +R+ VCKG +SYITH+DW + GKLL VN+GAKEQLFFEAPRG RQ I   E+EKI WA+W+ VLG  C GIWP   ++T+V +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GGAD +LMVW +  +        ++++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  +  S +  +  V  SR   +    Q   L    S  +G++ R                P+ + V +L      GYRG DCRNN+HYL+ +G  I+YH A++GI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PS+H+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HT+ +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VG+KHVKFWTLAG  L++K+G + S  +   RM TML+VAF  N+ T+TG ++G V VWK  +L R+V +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      +  + +RS+ R KGKIL+GT++++I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D   ++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADV  A VSH   + VTGDD+G+VKLY  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC  ++P+
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFFRGHSDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHTAGIFSMNSCEEGFATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNVDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAYLAVGCNDSSVDIYGVAQRYKKVGECVGSLSFITHLDWSSDSRYLQTNDGSGKRLLYKMPGGKEVTSKEEIKGMHWASWTCVAGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYGVVKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDALHIAPQ-ESLAESNSDESDSDLSDVPELDSEIEQETQLTYHRQVYKEDLPQLKEQCKEKQKSATSKRRERTPGTSIRLHFIHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLAIHPLKDYVATGQVGRDPSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVTRGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGLIGKKGYVGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDVFLVKTVKAHDGPVFSMHALEKGFVTGGKDGMVALWDDSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDIISDIRFSPGSGKYLAVASHDSFVDIYNVTSSKRVGVCKGATSYITHIDWDSRGKLLQVNTGAKEQLFFEAPRGKRQTIPSVEVEKISWATWTSVLGLCCEGIWPVIGEVTEVTASCLTSDKMVLATGDDLGFVKLFRYPAKGKFGKFKKYVAHSTHVTNVRWTYDDSMLVTLGGADMSLMVWTNEVE--------SHREKKYCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMFGVKPHLQQKEPSVDERQGVVRGSRPPVSRAPPQPEKL---QSNNVGKKKR----------------PIEDLVLELAF----GYRGRDCRNNVHYLN-DGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSS--LEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QVTDCVRSVCRGKGKILVGTRNSEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLY-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCV-HMPH 1977          

HSP 2 Score: 404.445 bits (1038), Expect = 1.182e-113
Identity = 219/626 (34.98%), Postives = 363/626 (57.99%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+  +GYRG  C NN+ Y N  + I+Y  A IGI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P + IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH+KFW+L G  L SKKG+    +   +QT+L V  +   N + ++GT++GDV +W+++ L RV+A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ S+IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS +++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+  A V+ +   + TGDDFG+VKL+++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1354 EKLQSNNVGKKKRPIEDLVLELAFGYRGRDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFR-PDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSSLEDARMQTMLAV--AFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQVTDCVRSVCRGKGKILVGTRNSEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLYDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1971          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml5 (echinoderm microtubule associated protein like 5 [Source:MGI Symbol;Acc:MGI:2442513])

HSP 1 Score: 1872.83 bits (4850), Expect = 0.000e+0
Identity = 974/2053 (47.44%), Postives = 1359/2053 (66.20%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI-------PSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPY 6263
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q ++  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+G++LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ SC  G+ TGG+D C+ L D  F+P+T IDL+ T  GY                                        GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G+ + L++K PGG+ +T  + +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G+VKLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       +S +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++ P   ++L ++HGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IHVWDT+T+K +SILKG H+ G+CAVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+ TR  KDKIF++K +P+  ++L+  G+K ++FW + GGG   K+G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +   +L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+FVDIY+  S +R+ VCKG +SYITH+DW + GKLL VN+GAKEQLFFEAPRG RQ I   E+EKI WA+W+ VLG  C GIWP   ++T+V +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GGAD +LMVW +  +        ++++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  Q   + + +  VSR      K+Q        S  +G++ R                P+ + V +L      GYRG DCRNN+HYL+ +G  I+YH A++GI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PS+H+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HT+ +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VG+KHVKFWTLAG  L++K+G + S  +   RM TML+VAF  N+ T+TG ++G V VWK  +L R+V +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      +  + +RS+ R KGKIL+GT++++I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D   ++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADV  A VSH   + VTGDD+G+VKLY  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC  ++P+
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFFRGHSDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHTAGIFSMNSCEEGFATGGRDGCIRLWDLTFKPITVIDLRETEQGYK---------------------------------------GHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNVDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAYLAVGCNDSSVDIYGVAQRYKKVGECVGSLSFITHLDWSSDSRYLQTNDGSGKRLLYKMPGGKEVTSKEEIKGMHWASWTCVAGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYGVVKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDALHIAPQ-ESLAESNSDESDSDLSDVPELDSEIEQETQLTYHRQVYKEDLPQLKEQCKEKQKSATSKRRERTPGTSIRLHFIHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLAIHPLKDYVATGQVGRDPSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVTRGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGLIGKKGYVGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDVFLVKTVKAHDGPVFSMHALEKGFVTGGKDGMVALWDDSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDIISDIRFSPGSGKYLAVASHDSFVDIYNVTSSKRVGVCKGATSYITHIDWDSRGKLLQVNTGAKEQLFFEAPRGKRQTIPSVEVEKISWATWTSVLGLCCEGIWPVIGEVTEVTASCLTSDKMVLATGDDLGFVKLFRYPAKGKFGKFKKYVAHSTHVTNVRWTYDDSMLVTLGGADMSLMVWTNEVE--------SHREKKYCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMFGVKPHL-QQKEPSVDERPPVSRAPPQPEKLQ--------SNNVGKKKR----------------PIEDLVLELAF----GYRGRDCRNNVHYLN-DGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGIFYLCAATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSS--LEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QVTDCVRSVCRGKGKILVGTRNSEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLY-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCV-HMPH 1930          

HSP 2 Score: 403.675 bits (1036), Expect = 1.826e-113
Identity = 218/626 (34.82%), Postives = 363/626 (57.99%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVG-------KSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+  +GYRG  C NN+ Y N  + I+Y  A IGI++++    Q +Y EHNDDI+ + +    +   +VATGQVG        +P + IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH+KFW+L G  L SKKG+    +   +QT+L V  +   N + ++GT++GDV +W+++ L RV+A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ S+IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS +++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+  A V+ +   + TGDDFG+VKL+++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1307 EKLQSNNVGKKKRPIEDLVLELAFGYRGRDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGIFYLCAATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFR-PDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSSLEDARMQTMLAV--AFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQVTDCVRSVCRGKGKILVGTRNSEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLYDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1924          

HSP 3 Score: 311.997 bits (798), Expect = 6.250e-85
Identity = 218/641 (34.01%), Postives = 326/641 (50.86%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTT-GPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPYRQ 6269
             L L+ V+GYRG  CRNNL+Y  A+   IVY  A VG+V++ +  +Q FF  H+DDI+ L +  HP+ R +VATGQ+G  P I VW+S     +S LK VH +GI  L F   G  L+SVG+D+ + + VW W+ G +L+ A GHT RIF   +     +  V+ GVKH+KFW+L G+ L  KRG     F     + T+L +A   ++ TY+GA+NG ++VWK   L R ++ AH+  +F +  +  +G   +GG++     G I+LWD                      T KP+                          ++++ E +   K     H EG L  LAVHP  P   + S+D +VRIW L    LI       P  C   + +G +L +G+K G+F VL  +    ++  KDR + I ++K+SP+ + +AVG ND+ VDIY +           C    S +T                +D+S+D  +++      K  +Y    G+ V   E+I+ + W SW+ V G EV GIWP  SD  D+N+   ++     VT DDYG+VKL   F  P +   A      + GHS++VTNVR+ +D   ++S GG D  VF WK   ++P R+
Sbjct:   10 HLRLEWVYGYRGHQCRNNLYYTAAK--EIVYFVAGVGVVYSPREHRQKFFRGHSDDIISLAL--HPE-RVLVATGQVGKEPYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLCGNALTPKRGV----FGKTGDLQTILCLACARDELTYSGALNGDIYVWKGINLIRTIQGAHTAGIFSM-NSCEEGF-ATGGRD-----GCIRLWDL---------------------TFKPIT-------------------------VIDLRETEQGYK----GHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNVDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAYLAVGCNDSSVDIYGVAQR--YKKVGECVGSLSFIT---------------HLDWSSDSRYLQTNDGSGKRLLYKMPGGKEVTSKEEIKGMHWASWTCVAGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYGVVKL---FRYPCLRKGAKFRK--YIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWK---FIPERK 559          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 361.688 bits (927), Expect = 5.136e-108
Identity = 224/620 (36.13%), Postives = 334/620 (53.87%), Query Frame = 3
Query: 2154 RKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVG--------REPTIHVWDTQTMKSVSILK-GEHERGVCAVDFSSD--GKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWK---DNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKIL-ASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISH----QRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            R + PS  L+L+WV+GYRG DCR N++ L +GE+V+ VA+V ++ ++  + QR Y  HNDDI CL +HP    IATG+V           P + VWD+ ++ ++ +L  G  +R VC V FS    G  L +V   ++H+L VWDW K  K+  ++   + + +  + P + + L+  G   I FW+  GG  + ++G F    K    LC  +   + G   TG   G +Y+W    + I Q     H+GG +A+ AL  G +   GG+D  + L    ++KV +     PE+  P          +R+V  G+G  L   T+   I+  S     ++LVQGH E ELWGLA HPS+    T   D  + +W  E   H+ +  + ++ PAR       GS +AVG   G +L+L   +   +A      E+IS + FSP  G YLAVGSHDN V +Y+         RL  C G SS+ITHLDW+ D    + NSG  E L+++ P   +QI +   +  + WA+ +CVLG    GIWP   D TD+N+V+ + DGK+L + DDFG+V LF YP     A   +Y GHS+HVTNV +L +D   L+ GG DT+++ W+
Sbjct:   47 RSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFL--EGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVE--VPEDFGP----------VRTVAEGRGDTLYVGTTRNSILLGSVHTGFSLLVQGHVE-ELWGLATHPSRAQFVTCGQDKLVHLWSSE--THQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSP-DGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWD-PVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWR 647          

HSP 2 Score: 349.362 bits (895), Expect = 1.085e-103
Identity = 217/640 (33.91%), Postives = 344/640 (53.75%), Query Frame = 3
Query:   99 KFFSLAE*IQMIIVNEFQ-IFEMSNKLA-PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKS--------PFICIWNSNSLETKSILK-DQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNAL-VGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVI--RTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFK---RTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            K F     + M+I +E    + +  +   P+S+L LDWVYGYRG  C  NL+   + ++VYFVA + ++Y +++++Q +Y  HNDDI  +A+  D   +ATGQV  +        P + +W+S SL T  +L        +  VAFSK+  G  L +V    +  L+VWDW K   +  ++  ++ V  A F  +D P   +TCG  HI FWSL G +LS ++G++ K  + + +L  C++  +     +G   G++Y+W +  N + + +   H G ++++ +   G +   GG+D  VVL   ++  +  +++   + G     VR+V     + L VGT  + I+   V T      L+ GH   ELW L  HP ++ F T   D  + +W     +P+ +  I+   RS GF+  GS++A+G + G + ++   T D++ +H   D  E +  + FSPDG +LAVGS+DN V +Y      +   R G C G+SSFITHLDW+ DST   TNSG  E+L +     + IT    + +++WA  T VLG  + GIW +  D  DINA   + +  L+ + DDFG V LF+YP     A   KY GHS+HVTNV + +D    ++ GG D S+ QWR+
Sbjct:   22 KMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTD-PSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVL--CVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVP-EDFG----PVRTVAEGRGDTLYVGTTRNSILLGSVHTGFS--LLVQGHVE-ELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHT--DGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 648          

HSP 3 Score: 271.552 bits (693), Expect = 4.153e-77
Identity = 198/651 (30.41%), Postives = 317/651 (48.69%), Query Frame = 3
Query: 4347 TQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI--------PSIHVWNSLDCTKLSTLK-GVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSG--VLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKIL-LGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTT-GPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPV--PRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            ++L+L  V+GYRG DCR NL+ L      +VY  A+V ++++++  +Q  +L HNDDI CL V  HP    + ATGQ+           P + VW+S+  + L  L  GV    +C + FS +  G LL +V   NDH ++VW W   + +  +    + + +A F P   S+ +  G  H+ FW+L G  L  ++G     F    +   +L V F       TG   G+++VW  G   +T+ V+ AH G VF L   L DG +VSGG   G+D   + LW  +  + +   + ED                    +R+++  +G  L +GT  N IL      G    L+Q H E  L GLA HP   Q+ +  +D  V +W  ET   + S +   PA    + P+G+ L +G  +G + +L  +++ L+    D  +QI+ + FSP+ + +AVGS+DN+V +Y +D  G                +SR   C    S    +D++ D         DY++  +   T + +   + +  + W + + V+G  V GIWP+ +D  D+N    SH     V+ DD+G V L+ S+P   PR  +        + GHSS+VTNV F+ DDS  ++TGG+D  V  W+ +
Sbjct:   53 SRLKLDWVYGYRGRDCRANLYLLPT--GEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAV--HPDMVTI-ATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGL----FEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFAL-CALRDGTLVSGG---GRDR-RVVLWGSDYSKVQEVEVPEDFGP-----------------VRTVAEGRGDTLYVGTTRNSILLGSVHTG-FSLLVQGHVE-ELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGG--------------RKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLF-SYPCCQPRALSHK------YGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVA 649          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 366.311 bits (939), Expect = 5.438e-108
Identity = 227/645 (35.19%), Postives = 346/645 (53.64%), Query Frame = 3
Query: 2079 TRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEV------GRE--PTIHVWDTQTMKSVSILK-GEHERGVCAVDFSSD--GKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD--NILQSAVM-MHEGGCYAIDALDKGFVT--GGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGK-ILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAI----SHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            T  + KD+V+      K+++         P++ L+LEWV+GYRG DCRNN++ L +GE V+ +A+V ++ N+  + QR YA HNDD+ CL +HP +  IATG+V      G++  P + +WD+ T+ ++ ++  G  +R V  + FS    G  L +V   ++H+L VWDW+K E+LA  +   + +F   + P + N +V  G   + FWT  G     K+G F    K    LC  ++ N  G   TG  SG + +W    N +  AV   HEGG +A+  L  G +   GGKD  +   +  + K+HK+    PE   P          IR+V  GKG  IL  T+   +++ +  G    + QGH + ELWGLA+H SK    T   D +  +W+     H+ +  K ++ PA+       GS VAVG   G + V    +   +       E++S +++SP  G +LA+GSHDN + IY        + R+  C G SS+ITHLDWS + + L+ NSG  E L++  P   +Q+++      I WA+++C LG    G+WP   D TD+N+V    + K+L TGDDFG+V LF YP     A    Y GHS+HVTNV +L  D +L+S GG DT++M W+
Sbjct:  165 TMYMPKDQVDSYSLEAKAEL---------PTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSEN--GDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAE--IPEQFGP----------IRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTD-ELWGLAIHASKPQFLTCGHDKHATLWDA--VGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPD-GNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYW-VPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWR 781          

HSP 2 Score: 344.354 bits (882), Expect = 1.810e-100
Identity = 206/613 (33.61%), Postives = 337/613 (54.98%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKS--------PFICIWNSNSLETKSILK-DQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLI--VRSVHWLSNNA-LVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVI--RTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT---ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            P  +L L+WVYGYRG  C NNL+   + + VYF+A + ++Y+++++ Q +Y  HNDD+  +A+  D   +ATGQV  +        P + IW+S +L T  ++        ++ +AFSK+  G +L +V    +  L+VWDW+K + L+  +  ++ VF A F  +D  I  VTCG  H+ FW+L GN+L+ K+G++ K+ + + +L  C++ S+N    +G  +G++ +W +  N +   +   H G ++++     G +   GGKD  ++  +  +Q + + ++       P     +R+V     N  L+GT  + +++  +S    P  +  GH   ELW L +H  K  F T   D    +W      P+    I+   +S GF+  GS++A+G + G + V    T+D++ VH   D  E L  +++SPDG++LA+GS+DN + IY  T     + R G C G+SSFITHLDWS++S ++ +NSG  E+L +     + +   +    I+WA +T  LG  + G+W + +D  DINA        L+ TGDDFG V LF+YP     A    Y+GHS+HVTNV +  +   LIS GG D SI QWR+
Sbjct:  185 PTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNI-IVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVL--CVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEI-------PEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTP--ITQGHT-DELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHT--DGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRV 782          

HSP 3 Score: 272.322 bits (695), Expect = 3.944e-76
Identity = 202/653 (30.93%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI--------PSIHVWNSLDCTKLSTLKGVHINGICSLDFSST---------GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGV--LTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGK-ILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTG-GITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            +L+L+ V+GYRG DCRNNL+ L       VY  A+V +++N++   Q  +  HNDD+ CL V  HP  R  +ATGQ+           P + +W+S+      TL  +H+ GI   D + T         G  L +V   NDH ++VW W+    LA      + +F A+F P   +I V  G  H+ FWTL G+ L  K+G     F  Q +   +L V F  N  T TG  +G++ VW  G   ++  V+ AH G +F L   L DG +VSGG   GKD   I  W+      +  + AE        E   P        IR+++  KG  IL+GT  N +L+     G    + Q H +  L GLA+H   PQ+ +   D    +WD +  + +   +   PA    + P+G+ + +G  +G + V   ++  L+    D  +Q++ +++SP+ + +A+GS+DN + IY +   G   T    C   +S +T                +D+S +  F+     DY++  +  S  + V   E    I W +++  +G  V G+WP+ SD  D+N    +H+     TGDD+G V L+ S+P  +       P+ ++ GHSS+VTNV F+ +DSHL+STGG+D  +  W+
Sbjct:  188 RLKLEWVYGYRGRDCRNNLYLLPT--GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAV--HPD-RITIATGQVAGTSKDGKQLPPHVRIWDSV------TLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGL----FEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFAL-CMLRDGTLVSGG---GKDRRLIS-WNGNY---QKLHKAE------IPEQFGP--------IRTVAEGKGNVILIGTTRNFVLQ-GTLSGDFTPITQGHTD-ELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFIT---------------HLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLF-SYPCSQFR----APSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWR 781          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q6ZMW3|EMAL6_HUMAN (Echinoderm microtubule-associated protein-like 6 OS=Homo sapiens OX=9606 GN=EML6 PE=2 SV=2)

HSP 1 Score: 2050.02 bits (5310), Expect = 0.000e+0
Identity = 1037/2039 (50.86%), Postives = 1400/2039 (68.66%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  LVATGQVGK P+ICIW+S +++T S+LKD HTHG++ +AF   G  L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+  NL R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L ++ P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   +GA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS LSD+   +S++E+EAQ NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N    +QR Y  H+DDIL L +HP+KD +ATG+VGR+  IHVWDTQT+K +S+LKG+H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +PH+ ++LV VG+K I+FW Q GGGFT+KRGTFG+V KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  + H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGA+EQLFFEAPRG R II  +EIEKI W +W+CVLG +C GIWP   DITDVN+ SLT D  +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W   R+ V  ++S       +  S+ SDTD EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP    +  S    +  VSR      K+Q                  N  T  ++L           V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA GIV NL +G QSF+LEH DDILCLTVN+HPKYRNVVAT QIG  PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ G  +A   GH +RIF+ EFRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G I S  +   +M TMLSVAF  N+ T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + +     E +RS+ R KGKIL+GT+D +I+E+ EK      L+  H EG + GLA HP    + SAS DGT RIWDL  K L+  ++ G  A C  YSP+G  + IG+K+G F +L   S ++  +K+DR   I DI+ SP++  +AVGS+++ VD Y L            Q  N    L+R  YCKD+ S  +Q+DFS DG +I+     YK +++    G+ V E   IEKI W SW+SV+G+EV GIWP  +DKADVN A V+H     VTGDD+GLVKL+  FP           +  + GHS++VTN+RF  DD ++VSTGG+DC VFVW+C
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRMPSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGTFGSVGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDILLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-AQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--REFVGTQES------KLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKPHQQLKEVSVEE-RPPVSRAAPQPEKLQ-----------------KNNITKKKKL-----------VEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGS--LGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQLV-----ECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDL-----------TQGTN----LNRIGYCKDIPSFVIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAVVIEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLF-DFPC----TEKFAKHKRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q5SQM0|EMAL6_MOUSE (Echinoderm microtubule-associated protein-like 6 OS=Mus musculus OX=10090 GN=Eml6 PE=2 SV=1)

HSP 1 Score: 2040.39 bits (5285), Expect = 0.000e+0
Identity = 1028/2039 (50.42%), Postives = 1393/2039 (68.32%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQ-----VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGK--KRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  QL L+WVYGYRGHQC NNL+YT  +++VYFVAG+G+VY+ ++  Q ++  HNDDIIS+AL  D  L+ATGQVGK P+ICIWNS ++ T SILKD HTHG++ +AF   G +L SVGLD   T+ +WDW+KGK+L+S   HSDR+FD  +     P + V+CG+KHIKFW+LCGN L++K+GI+GK G++QTIL  C++ +   + YSG LNGD+Y+W+   L R I   HS  ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  ++ GH  GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  + SFITH+DWSLDS Y++TN GA E L +K P G+ +T  + +  I WA +T V G ++ GIW KYT+  DIN+ D N N++++ +GDDFGLVKLF +P   KGA FRKY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +         DS+++ SDS  SD+   +S++E+E Q NY R V K+++ QL++ +K         KR+KAP   L+L+++HGYRGYDCRNN+FY Q+GE+V+H+AAV +V N     QR Y  H+DDIL L +HP+KD +ATG+VGR+  +HVWDTQT+K +S+LKG H+RGVCA+DFS+DGK L SVGLDD H +V WDW+KGEK+A+TR HKDKIF++K +P + ++LV VG+K I+FW Q GGGFT+KRG+FG+  KL+T +C +Y      + ++G+ +G ++IWKD +L   V  H+G  +A+ ALDKGFVTGGKDG ++L D+ F +  K+Y +    L      +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  S H+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  ++ ++ S HHRKE ISDIKFS   GKYLAV SHDNFVDIY+ ++ +R+ +CKG SSYITH+DW + GKLL VNSGAKEQLFFEAPRG +  I  +E EKI W +W+CVLG +C GIWP   D+TDVN+ +LT DG +LATGDDFG VKLF YP K + A+FK+Y+GHSAHVTNVRWLHND  LL+VGGADTALM+W   R+ V  ++S       +  S+ SDTD+EE+ G+DSDV REK++DY  K Y+  ++ ++ E  KP    +  S    +  VSR      K+Q                  N  T  ++L           V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA GIV NL +G QSF+LEH DDILCLTVN+HPKYRNVVAT QIG  PSIH+W+++    LS L+  H  G+  ++FS+TG LL+SVG+D +HTI VW+W+ GT +A   GH +RIF+ EFRPDSD+ FV+VGVKH+KFWTLAGS L+ K+G I S  +   +M TMLSVAF  N+ T+TGA+NG V+VWK   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + +     E +RS+ R KGKIL+GT+D +I+E+ EK      L+  H EG + GLA HP    + SAS DGT RIWDL  K L+  +  G  A C  YSP+G  + IG+K+G F +L   + ++  +K+DR   I DI+ SP++  +AVGS++  VD Y L  T G              +L+R  YCKD+ S  +Q+DFS D  +I+     YK +++    G+ V E   +EKI W SW+SV+G+EV GIWP  +DKADVN A V+H     VTGDD+GL+KL+  FP           +  + GHS++VTN+RF +DD ++VSTGG+DC VFVW+C
Sbjct:    1 MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDVHTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQ-PNRMVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTIL--CLACAKEDITYSGALNGDIYVWKGLTLVRTIQGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTEVIDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEAVSNGVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAVHVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATTRGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKRGSFGSAGKLETMMCVSYG-RMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRTALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-SQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMLSFHHRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRGRKHTIRPSEAEKIEWDTWTCVLGPTCEGIWPAHSDVTDVNAANLTKDGSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWT--REFVGTQES------KLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYA--VSIREMEGTKPHQQLKEVSMEE-RPPVSRAAPQPEKLQ-----------------KNNITKKKKL-----------VEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHTKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGS--MEAAKMQTMLSVAFGANNLTFTGAINGDVYVWKEHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQLV-----ECVRSVCRGKGKILVGTKDGEIIEVGEKSAASNILIDGHMEGEIWGLATHPSKDMFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNTLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEQTVDFYDL--TQG-------------TSLNRIGYCKDIPSFVIQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVVEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLLKLF-DFPC----TEKFAKHKRYFGHSAHVTNIRFSSDDKYVVSTGGDDCSVFVWRC 1957          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q05BV3|EMAL5_HUMAN (Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3)

HSP 1 Score: 1942.55 bits (5031), Expect = 0.000e+0
Identity = 994/2047 (48.56%), Postives = 1378/2047 (67.32%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q +Y  H+DDIIS+AL  +  LVATGQVGK P+ICIW+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+GK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G  + L ++ PGG+ +T T+ +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G++KLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       DS +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++AP   ++L +VHGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IH+WDT+T+K +SILKG H+ GV AVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+  R  KDKIF++K +P+  ++L+  G+K ++FW + GGG   ++G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+F+DIY+ +S +R+ +CKG +SYITH+DW   GKLL VN+GAKEQLFFEAPRG +Q I   E+EKI WASW+ VLG  C GIWP   ++TDV +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GG D +LMVW +  +          ++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  Q   + + +  VSR      K+Q        +  +G++ R                P+ + V +L    + GYRG DCRNN+HYL+ +G  I+YH A+VGI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PSIH+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HTI +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VGVKHVKFWTLAG  L++K+G + +  +   RM TML++AF  N+ T+TG ++G V VWK  +L RIV +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      ++ + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D ++++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADVN A VSH   + VTGDD+G+VKL+  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGHSDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGIFSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGTYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRMPGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYGIIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDAVHIAPQ-ESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKQKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAVDFSADGKRLASVGIDDSHTVVLWDWKKGEKLSIARGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDIFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLLQVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASCLTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTDMSLMVWTNEME--------GYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMLGIKPHL-QQKEPSIDERPPVSRAPPQPEKLQ--------TNNVGKKKR----------------PIEDLVLEL----IFGYRGRDCRNNVHYLN-DGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLST--LEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QATDCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKC 1964          

HSP 2 Score: 410.994 bits (1055), Expect = 8.644e-115
Identity = 218/626 (34.82%), Postives = 366/626 (58.47%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+ ++GYRG  C NN+ Y N  + I+Y  A +GI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P I IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ G+KH+KFW+L G  L SKKG+    +   +QT+L +  +   N + ++GT++GDV +W+++ L R++A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS+Y++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+N A V+ +   + TGDDFG+VKLF++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1346 EKLQTNNVGKKKRPIEDLVLELIFGYRGRDCRNNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQEGAKIASRAGHNQRIFVAEFR-PDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDARMQTMLAI--AFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQATDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVPSGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1963          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q6ED65|EMAL5_RAT (Echinoderm microtubule-associated protein-like 5 OS=Rattus norvegicus OX=10116 GN=Eml5 PE=1 SV=2)

HSP 1 Score: 1928.29 bits (4994), Expect = 0.000e+0
Identity = 992/2051 (48.37%), Postives = 1374/2051 (66.99%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDA--ISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASV--SRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q +Y  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+GK+LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T  GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +D+ IR    N DG  +A+G+ DGS +V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G+ + L++K PGG+ +T  + +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G+VKLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA  I+    +       +D   S + ++   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++AP   ++L ++HGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IHVWDT+T+K +SILKG H+ G+CAVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+  R  KDKIF++K +P+  ++L+  G+K ++FW + GGG   ++G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +   +L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+FVDIY+  S +R+ VCKG +SYITH+DW + GKLL VN+GAKEQLFFEAPRG +Q I   E+EKI WA+W+ VLG  C GIWP   ++TDV +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GGAD +LMVW         E   + +K N   S+ SDTDSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  +  S +  +  V  SR   +    Q   L    S  +G++ R                P+ + V +L      GYRG DCRNN+HYL+ +G  I+YH A+VGI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PS+H+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HT+ +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VG+KHVKFWTLAG  L++K+G + +  +   RM TML+VAF  N+ T+TG ++G V VWK  +L R+V +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      +  + +RS+ R KGKIL+GT++++I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D   ++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADV  A VSH   + VTGDD+G+VKLY  FP P         +  F GHS +VTN+RF + D H+VS GG+DC VFVWKC
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGHSDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHTAGIFSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMDEPIRCAAVNADGVHLALGMKDGSLTVLRVRDMTEVVHIKDRKEAIHELKYSPDGTYLAVGCNDSSVDIYGVAQRYKKVGECVGSLSFITHLDWSSDSKYLQTNDGSGKRLLYKMPGGKEVTSKEEVKGMHWASWTCVAGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYGVVKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDALHIAPQESLTESNSDESDSDLSDVPEL---DSEIEQETQLTYHRQVYKEDLPQLKEQCKEKQKSATSKRRERAPGNSIRLHFIHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLAIHPLKDYVATGQVGRDPSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVARGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGLIGRKGYVGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDVFLVKTVKAHDGPVFSMHALEKGFVTGGKDGVVALWDDSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPVTLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDVISDIQFSPGSGKYLAVASHDSFVDIYNVTSSKRVGVCKGATSYITHIDWDSRGKLLQVNTGAKEQLFFEAPRGKKQTIPSVEVEKISWATWTSVLGLCCEGIWPIIGEVTDVTASCLTSDKMVLATGDDLGFVKLFRYPAKGKFGKFKKYVAHSTHVTNVRWTYDDSMLVTLGGADMSLMVWTS-------EVERHREKKNC-DSEESDTDSEEDGGYDSDVTRENEISYTIRALST--NIRPMFGVKPHLQQKEPSVDERQGVVRGSRPPVSRAPPQPEKL---QSNNVGKKKR----------------PIEDLVLELAF----GYRGRDCRNNVHYLN-DGDDIIYHTASVGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLST--LEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QVTDCVRSVCRGKGKILVGTRNSEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLY-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSVFVWKC 1972          

HSP 2 Score: 404.831 bits (1039), Expect = 6.195e-113
Identity = 218/626 (34.82%), Postives = 363/626 (57.99%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+  +GYRG  C NN+ Y N  + I+Y  A +GI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P + IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH+KFW+L G  L SKKG+    +   +QT+L V  +   N + ++GT++GDV +W+++ L RV+A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ S+IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS +++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+  A V+ +   + TGDDFG+VKL+++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1354 EKLQSNNVGKKKRPIEDLVLELAFGYRGRDCRNNVHYLNDGDDIIYHTASVGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFR-PDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSTLEDARMQTMLAV--AFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQVTDCVRSVCRGKGKILVGTRNSEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLYDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSVFVWK 1971          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q8BQM8|EMAL5_MOUSE (Echinoderm microtubule-associated protein-like 5 OS=Mus musculus OX=10090 GN=Eml5 PE=2 SV=2)

HSP 1 Score: 1924.44 bits (4984), Expect = 0.000e+0
Identity = 994/2055 (48.37%), Postives = 1383/2055 (67.30%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW------RLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASV--SRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPY 6263
            M+ + AP+  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY  ++ +Q ++  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S +++T S+LKD HTHGI+ +AF   G  L+SVGLD    + VWDWK+G++LS    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H+  ++S+ SC  G+ TGG+D C+ L D  F+P+T IDL+ T  GY  L VRSV W  ++ LVGTQ S+I EI V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    N DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG +LAVG ND+ VDIY     +K+ G C G+ SFITHLDWS DS Y++TN G+ + L++K PGG+ +T  + +  + WA +T V G ++ GIW KY+D NDIN+ D N    ++ T DD+G+VKLF YP   KGA FRKY GHSAHVTNVRWS D +++ISIGG D S+FQW      +L DA+  +       +S +D SDS LSD+   +SE+E+E Q  Y R V K+++ QL++  K   +    K+R++ P   ++L ++HGYRGYDCR+N+FY Q GEIV+HVAAVG++ N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+P+IHVWDT+T+K +SILKG H+ G+CAVDFS+DGK+LASVG+DD+H +V+WDW+KGEKL+ TR  KDKIF++K +P+  ++L+  G+K ++FW + GGG   K+G  G + K DT +CA Y   +  + ++G+ +G V IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D++F +  K+Y +   +L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   ICATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+ +  +L ++ S HHRK+ ISDI+FSP  GKYLAV SHD+FVDIY+  S +R+ VCKG +SYITH+DW + GKLL VN+GAKEQLFFEAPRG RQ I   E+EKI WA+W+ VLG  C GIWP   ++T+V +  LTSD  VLATGDD G VKLF YP+K KF KFK+Y+ HS HVTNVRW ++D  L+++GGAD +LMVW +  +        ++++     S+ SD DSEE+ G+DSDV RE  + Y  +  S   N +    +KP L  +  S +  +  V  SR   +    Q   L    S  +G++ R                P+ + V +L      GYRG DCRNN+HYL+ +G  I+YH A++GI+HN+ +G QSF+ EHNDDILCLTVN+HPK+ N+VATGQ+G         PS+H+W++++   LS L+  H  G+CS+ FS+TG LLLSVG+D +HT+ +W+W+ G  +A   GH QRIF+AEFRPDSD+ FV+VG+KHVKFWTLAG  L++K+G + S  +   RM TML+VAF  N+ T+TG ++G V VWK  +L R+V +AH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET      +  + +RS+ R KGKIL+GT++++I+E+ EK      L+  H +G + GLA HP    + SA+EDGTVR+WD+  K ++  +  G  A  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P        TL+R +YCKD+ S  +Q+DFS D   ++     YK  +Y   +G+ + +   I++I W +W+S++G+EV GIW   ++KADV  A VSH   + VTGDD+G+VKLY  FP P         +  F GHS +VTN+RF + D H+VS GG+DC +FVWKC  ++P+
Sbjct:    1 MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFFRGHSDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQ-PNKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACARDELTYSGALNGDIYVWKGINLIRTIQGAHTAGIFSMNSCEEGFATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGLSVRSVCWRGDHILVGTQDSEIFEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIARCNMEEPIRCAAVNVDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAYLAVGCNDSSVDIYGVAQRYKKVGECVGSLSFITHLDWSSDSRYLQTNDGSGKRLLYKMPGGKEVTSKEEIKGMHWASWTCVAGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYGVVKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDALHIAPQ-ESLAESNSDESDSDLSDVPELDSEIEQETQLTYHRQVYKEDLPQLKEQCKEKQKSATSKRRERTPGTSIRLHFIHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGHDDDILCLAIHPLKDYVATGQVGRDPSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVTRGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGLIGKKGYVGTLGKNDTMMCAVYGWTEE-MAFSGTSTGDVCIWRDVFLVKTVKAHDGPVFSMHALEKGFVTGGKDGMVALWDDSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDIISDIRFSPGSGKYLAVASHDSFVDIYNVTSSKRVGVCKGATSYITHIDWDSRGKLLQVNTGAKEQLFFEAPRGKRQTIPSVEVEKISWATWTSVLGLCCEGIWPVIGEVTEVTASCLTSDKMVLATGDDLGFVKLFRYPAKGKFGKFKKYVAHSTHVTNVRWTYDDSMLVTLGGADMSLMVWTNEVE--------SHREKKYCDSEESDIDSEEDGGYDSDVTRENEISYTIRALST--NIRPMFGVKPHLQQKEPSVDERQGVVRGSRPPVSRAPPQPEKL---QSNNVGKKKR----------------PIEDLVLELAF----GYRGRDCRNNVHYLN-DGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSS--LEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRL----------ETG-----QVTDCVRSVCRGKGKILVGTRNSEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDL-------TLGP--------TLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLY-DFPCP----EKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCV-HMPH 1977          

HSP 2 Score: 404.445 bits (1038), Expect = 8.266e-113
Identity = 219/626 (34.98%), Postives = 363/626 (57.99%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKS-------PFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
             + Q   +  K  P   L L+  +GYRG  C NN+ Y N  + I+Y  A IGI++++    Q +Y EHNDDI+ + +    +   +VATGQVG S       P + IW++ + +T SIL+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH+KFW+L G  L SKKG+    +   +QT+L V  +   N + ++GT++GDV +W+++ L RV+A  H+G ++++ +       VTGGK+        V L D E +      L+    G     VRSV       LVGT+ S+IIE  V   N   ++++ GH  G +W L  HP +  F + ++D ++R+W + +++ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  +H+++FSPD  +LAVGS++N VD YD T   +  R   CK   SF+  +D+S DS +++ +SG  +  +++ P G+H+     +  I WA +T +LG ++ GIW+++ +  D+  A V+ +   + TGDDFG+VKL+++P P K A  +++ GHS HVTN+R++   + ++S GG D S+F W+
Sbjct: 1354 EKLQSNNVGKKKRPIEDLVLELAFGYRGRDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFR-PDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSSLEDARMQTMLAV--AFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLE---TGQVTDCVRSVCRGKGKILVGTRNSEIIE--VGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRHLQVSSGCYKRHVYEVPSGKHLVDHAAIDRITWATWTSILGDEVMGIWSRHAEKADVTCACVSHSGISLVTGDDFGMVKLYDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWK 1971          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3I092 (echinoderm microtubule-associated protein-like 6 OS=Lingula unguis OX=7574 GN=LOC106159823 PE=4 SV=1)

HSP 1 Score: 2198.32 bits (5695), Expect = 0.000e+0
Identity = 1106/2039 (54.24%), Postives = 1444/2039 (70.82%), Query Frame = 3
Query:  168 NKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-LTDAISGSGDINHQ------VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAK-EQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPS--DFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            +K AP S L LDWVYGYRGHQC +NL YT + ++ YFVAG+GIVY+++  KQ +YF H+DDIIS+A+  +  L+ATGQVGK+PFIC+W+S +++T SILKD HTHGI S+AF++ G  L SVG DP AT+ +WDWKKGK++++TR H+DRV D +F   +   + VTCG+KHIKFW+L GN+L+SKKG++GK GEIQT+L  C++     + YSG+++GD+Y+W+ NNL RV+   H GA+YS+++   GY + GKD CV L D +F+P+T IDL  T  GY  L +RSV W     L+GTQ S++IE+ V   +KP+ L+ GHA GELWAL VHPKK IFAT SDD +LR+W M + E L+   +D  IRSC  N DG+ IA G+ DGSF V++T+D+ EV   +DRKEV+HE+K+SPDGH+LAV SNDNFVDIY     +K+ GVC G+SSFITH+DWS DS Y++TNSGAAE L +K P G+ IT    + +I W  +TGVLG ++ GIW KYTDTNDINA D      +I TGDDFG VK+F +PS  +GA FRKY GHSAHVTNVR+S++K+ +IS+GG D +IFQW+ + +     GD   +      VDS ++ SDS +SD+G  +S++E E Q  Y R V K++ ++L+   K ++E G+KR KAP +GL+LE+VHGYRGYDCRNN+FY QSGEIV+HVAAVGIV +     QRFY  H DDILCL +HP+KD+IATG+VGR+P +HVWD +T+K +S+LKG+H+RG+CAVDFS DGKKLASVGLDDNH +VVWDWRKGEKLA+TR HKDKIF+IKW+P++ N+LV+VG+K I+FWTQ GGGFT  RGTFG V KLD+ +C  +   +  VCYTG  +G VYIW+   L   V  HEG C+A+ ALDKGFVTGGKDG I L DE F +  K+Y +    L P    +L    P IR+VVLG G IL  T +GEI+E+   G +NILVQGH EGELWGLA HP KN CATVSDD  L +W++    H+++  K +K P RCC  S DG  +AVG  DGSF+V++  +L +I + HHRKEEISDI+F+P PGKYLAV SHDNFVDIY+ +S +R+ VCKG SSYITH+DW + GKLL+VNSGAK EQLFFEAPRG RQ +   E+EKI WASW+ V G +  GIWPPK D+TDVN+ SL+ D ++LATGDDFG VK+FEYP K KFAKFK+Y+GHSAHVTNVRW   D+ L+S GGADTA+MVW H         +  ++ +   +SD SDTDSEE+ G+DSDV REK MDY AKTY+  +  ++T  +KP L  Q    +  K +VSR     VKVQ + L             S   T  +R         I +++ L L+ ++GYRGFDCRNNLHYL+ +G+ IVYHAA  G+V NL +G QSF+LEH DDI+CLTVN+HPKY+N +A+GQIGA P++H+W+++    ++ L+G H  G+CS+DFS TG  L+SVGID +HTI VW+W+  T +A   GHT+RIF AEFRPDSD  FV VGVKHVKFW++AG ELI K+G + +     +  RM TMLS+AF  N+ TYTGAM+G V+VWK   L R+V KAH+GPVF +FTTL DGLIV+GGKEK GK++G++KLWDQEM R + F L     V               +V++S+ R KGKIL+GT+D++I E  EK G V+ L++ H EG L GLA HP + ++++AS DGTVRIWD+  KM++Q L  G A CVD+S +G  + +GLK+G F +L+     L  +K+DR K ITDI+FSP+S  IAVGS DN VD+Y L            Q P    +L+R  YCK + S  +Q+DFS DG  +R     Y  +++   +G  V++  KI KI W +W+SV+G EV GIWP  +D ADVN A ++H  NA VTGDD+GLVKL+  FP           +  + GHS++VTNVRF  DD +L+STGG+DCC+FVWKC
Sbjct:    4 DKTAPKSHLRLDWVYGYRGHQCRSNLQYTATREVAYFVAGVGIVYNVRDHKQRFYFGHDDDIISLAMHPEQILIATGQVGKAPFICVWDSYTMKTVSILKDGHTHGIGSIAFARDGQRLASVGTDPQATVCIWDWKKGKIIATTRGHTDRVLDIQFN-PNKENELVTCGVKHIKFWTLSGNSLTSKKGVFGKVGEIQTML--CLAFGPEDITYSGSMSGDIYVWKGNNLARVVQNAHKGAVYSMDTADEGYASAGKDGCVCLWDSDFKPITSIDLADTPTGYQGLCIRSVCWRGEKILIGTQDSEVIEVSVRERDKPRCLIQGHAEGELWALAVHPKKPIFATASDDHTLRLWNMVDNELLSRTSLDHPIRSCALNEDGTQIAAGMNDGSFIVLKTKDLSEVIQIKDRKEVIHEMKYSPDGHFLAVASNDNFVDIYAVAQRYKKVGVCSGSSSFITHIDWSEDSKYLQTNSGAAERLFYKMPAGKRITSRDEIEAIHWYSWTGVLGQEVNGIWEKYTDTNDINATDAYFGGEVIVTGDDFGCVKMFKFPSLKRGAKFRKYLGHSAHVTNVRFSYNKQHVISVGGADHAIFQWKFIPEGAPLEGDDQQEAESGEHVDSNSEESDSDVSDVGELDSDVENEKQVQYDRAVYKEDASKLKTAIKEEMEPGEKRNKAPDEGLKLEFVHGYRGYDCRNNLFYTQSGEIVYHVAAVGIVYSRDHHRQRFYLDHTDDILCLAIHPIKDIIATGQVGRDPPVHVWDAETLKCLSVLKGQHQRGICAVDFSGDGKKLASVGLDDNHTIVVWDWRKGEKLATTRGHKDKIFVIKWNPYDLNKLVSVGVKHIKFWTQAGGGFTANRGTFGTVGKLDSMMCITFGKTED-VCYTGGANGEVYIWQGVTLLKTVKAHEGPCFAMHALDKGFVTGGKDGIIGLWDEQFERCLKTYAVKRATLAPGTRGLLVEDSPAIRAVVLGHGHILVGTRNGEILEVDKSGPMNILVQGHKEGELWGLATHPIKNYCATVSDDKTLRVWDI-TREHRMVNCKLMKKPGRCCCFSPDGKVIAVGLNDGSFVVVNSDTLEDIVAFHHRKEEISDIRFAPDPGKYLAVASHDNFVDIYNVLSSKRVGVCKGASSYITHIDWDSRGKLLVVNSGAKNEQLFFEAPRGKRQALRSAEMEKINWASWTGVFGHTVTGIWPPKSDVTDVNATSLSYDRRLLATGDDFGFVKVFEYPVKGKFAKFKKYVGHSAHVTNVRWSAQDKCLVSTGGADTAVMVWAH--------PAAGDRMVTRGESDDSDTDSEEDGGYDSDVTREKDMDYDAKTYANPI--RETTGVKPHLQEQKEEID--KPTVSRNAPETVKVQRSDL-------------SQMSTNSKR-------KKISEISDLSLEFIYGYRGFDCRNNLHYLN-DGADIVYHAAGAGVVMNLATGNQSFYLEHTDDIICLTVNQHPKYKNFIASGQIGASPAVHIWDAVSKQTVTVLQG-HTKGVCSVDFSCTGKHLVSVGIDAEHTICVWRWQEATKVASCPGHTERIFRAEFRPDSDGHFVTVGVKHVKFWSVAGGELIGKKGILTNAGSGADVQRMQTMLSIAFGANNLTYTGAMSGDVYVWKDNTLLRLVNKAHNGPVFTMFTTLRDGLIVTGGKEKVGKESGAVKLWDQEMKRCRSFQLDSGAQV---------------DVVKSVCRTKGKILVGTRDSEIYEHAEKTGAVQVLVRGHSEGELWGLATHPTMARFATASYDGTVRIWDIVNKMMVQKLAIGAAHCVDFSSDGEMVAVGLKTGEFMLLTVTGLTLWGKKRDRNKTITDIRFSPDSKYIAVGSEDNCVDLYDLS-----------QGP----SLNRAGYCKGIPSFVIQMDFSADGKHLRVSSGSYVHQVFEVPSGNPVSDEAKISKITWATWTSVLGNEVLGIWPRNADNADVNCAHLAHTGNALVTGDDFGLVKLF-QFPC----TEKFAAHKKYYGHSAHVTNVRFTFDDRYLLSTGGDDCCIFVWKC 1968          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: K1QFE3 (Echinoderm microtubule-associated protein-like 6 OS=Crassostrea gigas OX=29159 GN=CGI_10026183 PE=4 SV=1)

HSP 1 Score: 2164.04 bits (5606), Expect = 0.000e+0
Identity = 1080/2034 (53.10%), Postives = 1421/2034 (69.86%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMT--TMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKE-KGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+ K AP SQL L+WV+GYRGHQC NNL+YT S+++ YFVAG+GIVY+ ++ KQ ++  H+DDI+ +AL  D  +VATGQ GK+PFIC+W++ ++ET SIL+D H +G+++V F K G  ++SVGLD +AT+NVWDW+KGK+L++ R HSDRVFD +F         V+CG+KHIKFWSLCGN L++KKG++GK GEIQTI+  C++   +   YSGTL GD+Y+WR NNL+RVI   H GA+++++    GY TGGKD  V L DP+F+P+T ++L  + +GY  L VRSV W  +  L+GTQ S I E+ V   +KP+ ++ GHA GELWAL VHPKK IFATGSDD +LR+W MN  E ++ + +D+KIRSC F+ DGS IA+G+ DGSF V++TRD+ EV + +DRKEV+HE+KFSP G +LAV SNDNFVDIY     +K  G C+G+SSFITH+DWS DS Y++TNSGAAE L FK P G+ +T  + ++SI W  FTGVLG ++ GIW KYTDTND+NA D N    ++ TGDDFGLVKLF +P   KGA FRKY GHSAHVTNVR+S DK  +I+ GG D ++FQW+ L D  S     +  VDS ++ SDS LSD+   +S+LE E Q  Y+R + K++  +++K+ K +++ G+KRK+ P+ GL+L+++HGYRGYDCRNN+FY Q+GE+V+HVAA GIV N    +Q+FY  H DDILCL +HP+KDL+ATG+VGR+P +HVWD +T+K+ SILKG+H+RGVCAVDFS DGKKLASVGLDDNH +VVWDWRKGEKLA+TR HKDKIF+IKW+P   N+L+ VG+K I+FWTQ GGGFT+ RGTFGNV+K    LC A+      + ++G   G V+IWKD+ LQ +V  HEG  +A+ +LDKGFVTGGKDG I L D+ F +  K Y +    ++     +L +  P IR++VLG GKIL  T +GE++E+   G + IL QGH +GELWGL +HP+K ICATVSDD  L +W++  + HK+I  K LK   R    S DG  +AVG KDGSF+V++  ++ E+ S HHRKEEISDI FSP  GKYLAV SHDNFVDIY+ +S +R+  CK  SSYITH+DW   GKLLMVN+GAKEQLF+EAPRG R  ++ +E+EK+ WA+W+CVLG +C GIWPPK DITDVN+  L+ D ++LATGDDFG VKLF+YP K KFAK K+Y+GHSAHVTNVRW  +D+ L+S GGADTA+MVW+          S  ++     +SD SDTDSEEE G+DSDVEREK++DY  K Y   + ++  E  KP L          K SVSR      KVQ          EI        K TP              V  L+L++VHGYRGFD RNNLHY++ +G+ IV+HAA  GIV NL +G QSF+LEH DDI+CL VN+H K++N+VA+GQIG  PSIHVW+++     S L+G H  G+CS+DFS TG  ++SV + +DH IAVW+W+ G  +A A GH QRIF AEFRPDSDS FV+VGVKHVKFW++AGSEL+ KRG +          T  TMLSVAF  N+ T+TGAMNG V+VWK   LTR+V KAH+GPVF +FTTL DG IV+GGKE  GKD G +KLWDQEM+R + F L E  N               ++V++S+ R KGKIL+GT+DN +LEI EK   V+ L+  HGEG + GL  HP   +++++S DG+VRIWDL  K L+  LT   A  V +S +G  + +G K+G F V SA   +LL +++DR   I DI+FSP+   +AVGS +N VD Y L S      P+          L+R  YCK + S  +Q+DFS D  +IR     Y  +++   +G+I+ + + I+ I W SW+SV+G+EV GIWP  S  ADVN A +SH   A  TGDD+G VKL+  FP   +N     P+  F GHS++VTNVRF  DD +L+STGG+DC +FVW+C
Sbjct:    1 MATKTAPKSQLRLEWVFGYRGHQCRNNLYYTASKEVTYFVAGVGIVYNPREHKQRFFLGHDDDILCLALHPDKTMVATGQTGKNPFICVWDTTTMETVSILQDGHQNGVAAVGFDKEGGRVVSVGLDQHATINVWDWRKGKILATVRGHSDRVFDVQFNPY-AENSLVSCGVKHIKFWSLCGNALTAKKGVFGKTGEIQTIM--CLAFGPDDTTYSGTLAGDIYVWRGNNLDRVIPAAHQGAIFTLDMSEDGYSTGGKDGTVRLWDPDFKPVTSVNLSNSPVGYKGLSVRSVCWRGDRVLIGTQDSQIFEVIVRDRDKPRCIVDGHAEGELWALAVHPKKPIFATGSDDQTLRLWNMNNFEAISKMSVDQKIRSCAFDADGSHIALGLTDGSFMVLKTRDLSEVIHLKDRKEVIHEMKFSPCGKYLAVASNDNFVDIYSTEQRYKLLGTCRGSSSFITHIDWSTDSNYLQTNSGAAERLFFKMPAGKQVTNREEISSIHWYTFTGVLGNEVNGIWEKYTDTNDVNAVDANFQGEVLVTGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRFSHDKTRVITTGGADHAVFQWKFLADGSSEPDPQSGFVDSNSEESDSDLSDVADMDSDLEAEKQVVYSRAIYKEDAAKIRKLNKEELQAGQKRKRGPTAGLKLQFIHGYRGYDCRNNLFYTQNGEVVYHVAAAGIVYNRDKHSQKFYTEHTDDILCLCIHPIKDLVATGQVGRDPAVHVWDAETLKTASILKGQHQRGVCAVDFSGDGKKLASVGLDDNHCIVVWDWRKGEKLATTRGHKDKIFVIKWNPFEANKLITVGVKHIKFWTQAGGGFTSTRGTFGNVSKSCDMLCVAFG-RAADISFSGGSDGNVFIWKDSNLQKSVKAHEGPLFAMHSLDKGFVTGGKDGMIGLWDDQFERCLKQYYIKKSGIEQSSRGVLMTDLPPIRAIVLGHGKILVGTKNGEVLEVDKGGPMTILAQGHMQGELWGLGMHPTKPICATVSDDKTLRVWDL-GTEHKMISYKILKQAGRSVGFSSDGKFLAVGQKDGSFMVVNGENMEEVISFHHRKEEISDINFSPGEGKYLAVASHDNFVDIYNVLSKKRVGTCKAASSYITHVDWDGAGKLLMVNTGAKEQLFYEAPRGKRLTLSNSEVEKLNWATWTCVLGKTCEGIWPPKSDITDVNATCLSKDRQLLATGDDFGFVKLFQYPVKGKFAKHKRYVGHSAHVTNVRWSADDKLLVSTGGADTAVMVWQC--------SSAADRNTTCGESDDSDTDSEEEGGYDSDVEREKNIDYNTKIYVNPIREK--EGTKPHLQEHAEVE---KPSVSRNAPVPPKVQ--------RVEIPSTGSKRKKITP--------------VNDLQLEYVHGYRGFDSRNNLHYIN-DGADIVFHAAGAGIVQNLSTGNQSFYLEHTDDIICLAVNQHSKFKNIVASGQIGNPPSIHVWDAVTKETKSMLRGGHSRGVCSVDFSCTGKYIVSVDLADDHQIAVWRWQDGVKVASAPGHNQRIFRAEFRPDSDSQFVSVGVKHVKFWSVAGSELVGKRGILTDAGTGTKIKTLHTMLSVAFGANNMTFTGAMNGDVYVWKDTTLTRLVPKAHNGPVFTMFTTLRDGFIVTGGKEGSGKDNGPVKLWDQEMMRRRAFPLTETGN--------------KIDVVKSVCRAKGKILVGTKDNTVLEITEKNAAVQVLVAGHGEGEVWGLDTHPLAAKFATSSYDGSVRIWDLANKSLVGKLTVSAARSVAFSLDGELIAVGCKNGEFLVFSANDLKLLGKRRDRSGAINDIRFSPDKKHLAVGSEENCVDFYDLSS-----GPA----------LNRSGYCKGIPSFVIQMDFSADSRYIRVSTGAYIHQVFEVPSGKIIEDQKIIDNITWASWTSVLGKEVVGIWPKDSSNADVNCAHLSHLGTALATGDDFGFVKLF-DFPCSEVN----APHKSFVGHSAHVTNVRFSFDDKYLISTGGDDCSIFVWRC 1959          

HSP 2 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 532/1381 (38.52%), Postives = 759/1381 (54.96%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAV-MMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL--STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFC-TNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRN-KPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL--ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSP-NSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXX-XXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            K AP   L+LEWV GYRG+ CRNN++Y  S E+ + VA VGIV N     QRF+  H+DDILCL LHP K ++ATG+ G+ P I VWDT TM++VSIL+  H+ GV AV F  +G ++ SVGLD +  + VWDWRKG+ LA+ R H D++F ++++P+  N LV+ G+K I+FW+  G   T K+G FG   ++ T +C A+ P+     Y+G+ +G +Y+W+ N L   +   H+G  + +D  + G+ TGGKDGT++L D  F  V  S  LS   +    +      ++RSV     ++L  T   +I E+          +V GH EGELW LAVHP K I AT SDD  L +W +  +N + I    +    R C    DGS +A+G  DGSF+VL    L E+     RKE I ++KFSP  GKYLAV S+DNFVDIYS    ++ L  C+G SS+ITH+DWSTD   L  NSGA E+LFF+ P G +Q+  + EI  I W +++ VLG+   GIW    D  DVN+V     G+VL TGDDFG VKLF++P   K AKF++Y+GHSAHVTNVR+ H+   +++ GGAD A+  WK   D     D         PQS   D++SEE +         DSD+E EK + Y    Y E                         A+  R+ N            K+  + G++ R  G T                   L+L+ +HGYRG+DCRNNL Y   +   +VYH AA GIV+N     Q F+ EH DDILCL +  HP  +++VATGQ+G  P++HVW++      S LKG H  G+C++DFS  G  L SVG+D++H I VW W  G  LA   GH  +IF+ ++ P   +  + VGVKH+KFWT AG    + RG     F N  +   ML VAF    D +++G  +G+V++WK   L + V KAH GP+F + +  +D   V+GGK+     G I LWD +  R  K +Y+ +     G  ++++ +    +  IR+I    GKIL+GT++ ++LE+ +K G +  L Q H +G L GL +HP  P  ++ S+D T+R+WDL  E KM+   +       V +S +G +L +G K G+F V++ ++   +I    R ++I+DI FSP     +AV S+DN VDIY                  +V++  R   CK   S    +D+   G  +       +   Y    G+ +       + +  +  + V+G+   GIWP KSD  DVN   +S       TGDD+G VKL+  +PV          +  + GHS++VTNVR+  DD  LVSTGG D  V VW+CS
Sbjct:    4 KTAPKSQLRLEWVFGYRGHQCRNNLYYTASKEVTYFVAGVGIVYNPREHKQRFFLGHDDDILCLALHPDKTMVATGQTGKNPFICVWDTTTMETVSILQDGHQNGVAAVGFDKEGGRVVSVGLDQHATINVWDWRKGKILATVRGHSDRVFDVQFNPYAENSLVSCGVKHIKFWSLCGNALTAKKGVFGKTGEIQTIMCLAFGPDD--TTYSGTLAGDIYVWRGNNLDRVIPAAHQGAIFTLDMSEDGYSTGGKDGTVRLWDPDFKPV-TSVNLSNSPVGYKGL------SVRSVCWRGDRVLIGTQDSQIFEVIVRDRDKPRCIVDGHAEGELWALAVHPKKPIFATGSDDQTLRLWNM--NNFEAISKMSVDQKIRSCAFDADGSHIALGLTDGSFMVLKTRDLSEVIHLKDRKEVIHEMKFSPC-GKYLAVASNDNFVDIYSTEQRYKLLGTCRGSSSFITHIDWSTDSNYLQTNSGAAERLFFKMPAG-KQVTNREEISSIHWYTFTGVLGNEVNGIWEKYTDTNDVNAVDANFQGEVLVTGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRFSHDKTRVITTGGADHAVFQWKFLADGSSEPD---------PQSGFVDSNSEESDSDLSDVADMDSDLEAEKQVVYSRAIYKE------------------------DAAKIRKLN------------KEELQAGQK-RKRGPTA-----------------GLKLQFIHGYRGYDCRNNLFY--TQNGEVVYHVAAAGIVYNRDKHSQKFYTEHTDDILCLCI--HP-IKDLVATGQVGRDPAVHVWDAETLKTASILKGQHQRGVCAVDFSGDGKKLASVGLDDNHCIVVWDWRKGEKLATTRGHKDKIFVIKWNPFEANKLITVGVKHIKFWTQAGGGFTSTRGT----FGNVSKSCDMLCVAFGRAADISFSGGSDGNVFIWKDSNLQKSV-KAHEGPLFAMHS--LDKGFVTGGKD-----GMIGLWDDQFERCLKQYYIKKS----GIEQSSRGVLMTDLPPIRAIVLGHGKILVGTKNGEVLEV-DKGGPMTILAQGHMQGELWGLGMHPTKPICATVSDDKTLRVWDLGTEHKMISYKILKQAGRSVGFSSDGKFLAVGQKDGSFMVVNGENMEEVISFHHRKEEISDINFSPGEGKYLAVASHDNFVDIY------------------NVLSKKRVGTCKAASSYITHVDWDGAGKLLMVNTGAKEQLFYEAPRGKRLTLSNSEVEKLNWATWTCVLGKTCEGIWPPKSDITDVNATCLSKDRQLLATGDDFGFVKLFQ-YPV----KGKFAKHKRYVGHSAHVTNVRWSADDKLLVSTGGADTAVMVWQCS 1263          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A267FUT0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016715g2 PE=4 SV=1)

HSP 1 Score: 2134.38 bits (5529), Expect = 0.000e+0
Identity = 1070/2059 (51.97%), Postives = 1418/2059 (68.87%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLT----DAISGSGDINHQV-------DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEV-NQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDAL---DKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQM--LSSACPTIRSVVLGKGK-ILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKH-----------RRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYS-----ERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDT--GSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            P + L L+WVYGYR HQC NN  Y   ++IVYFVAG+GIV + +++ Q Y+  H+DDI+S+ L     L ATGQVGK P ICIWN+ + E  S+L   H HG+  ++F+ TG  L+S+GLDP AT+ VW+W+KGK++S+ R H+DRVFD +F  SD P   V+CG+KHIKFW+L GN+LSSKKGI+GK GEIQT+ +  ++       Y+ T+ GD+Y+W  NNLERV+A +HSG  + + SC +G+ +GGKD CV L+D + QP++ I L  T  GYP + VRSV W  +  L GTQ  +I+EI     ++P  L+  H+ GELWAL  HPKK +FAT SDD +LRIW    R+     R+D+K RSC FN DGSLIA G +DG F+V RTRD++E+ +A++RKEVLHE+KFSPDG +LAVGSNDNFVDIYD     K+ G C+GNSSFITHLDWS DS YI+TNSGAAE L+FKAP G+ + +   + +IKW  +TGVLG  ++GIW KYTDTND+NA DVN    ++ATGDDFGLVKLF YPS  KG++FR+Y GHSAHVTNVRW  D   L+SIGG D ++FQWRL     D ++G G +   V       DS ++GSD+  S  G  +S++E E Q NY R V K ++ + L+   ++++  G+KRK+AP  GL+L++ HGYR YDC  N+FY QSGEI+F+VAA+G+V N  + TQRFY  H DDILCL +HP  D++ATG+VG++PTIHVW+ +++K++SILKG+HERGVC V FS DG+KLASVGLDDNH +VVWDWRKGE+LA+TRAHKD++F+I+W+PH+ N+L+ VG++ IRFWT  G G T+ RGTFG+VAKLDT L A Y  +     YT   SGLVY+W+ N+L   V  HEG C+A++ +      FVTGGKDG + + D+   +  +++ L   N+    +  L    PT+RSV+ G+   ILA T +GE++E+  DG + +LVQGH +GE+WGLA HP++ IC T SDD  L +W ++    +++  + L  PARCCDIS DG  + VGF+DGSF VL+  SL  + +  HRKEEISDIKFSP PGKYLAV SHDNFVDIY+  + QR+ VCKGCSSY+TH+DW  +GKLLMVNSGA+EQLFFEAPRG RQ++ K +IE++ W SW+CVLGD+C G+WPPKCDITDVN+ SL+ D  +LAT DDFG VKLFEYP+K KFAK+KQY+GHSAHVTN RW  +D  L+SVGGADTAL++W+H                PL  +       +P SD SDTDSEEE G+DSDVEREK MDY +KTY      ER+ ++ TE  +    +     + L+ +VSR+T    KV             G + R              P+   E+V  L+L+ VHGYRGFDCR+NLHYL+  G +IVYHAA   IVH + +G QSFFL H+DDILCL VNR PK+  VVA+ QIG A P I VW+S     L+TL+G H  G+CSLDFS++G  L+SVG+D+ HTIAVW+W+ G L+    G++QR+F AEFRPDSDS FV+VGVKHVKFWTLAGS+L+ +RG++        RMTTMLS+AF  N  TYTGAM+G V+VW+   L R+VEKAH GPVF L+TTL DGLIVSGGKEKG  +  G +KLWDQEM R + + L               L DK+  VI+S+ RV+GKIL+GT++++I+E+ EK G +  + + HGEG L GLAVHP   Q+++AS+DGT RIWD+  K ++  L +GPA  V +S NG  L  GLK+G+  +L+  S +L+ +++DRG  ++D++FSP+S L+AVGS +  VD Y++   GG               LSR  YCK L +  +Q DFS D  +++     Y  ++++   G+ V +P  +E I W +W+S+VG EV GIWP  + K D+N A + H   A  TGDD+G VKL+ +FPV          +  + GHS++VTNVRF  DDS+LVS GG+DCCVFVWKC
Sbjct:    5 PTNHLRLEWVYGYRSHQCRNNALYNARDEIVYFVAGVGIVLNAEEKTQRYFLGHDDDIVSLVLHPQKILAATGQVGKEPKICIWNTTNSEVVSLLTANHQHGVGILSFNSTGELLVSIGLDPVATITVWNWQKGKIVSTNRGHTDRVFDCQFSPSD-PNLIVSCGVKHIKFWTLSGNSLSSKKGIFGKVGEIQTMFS--LAFGPGGTTYAATMAGDIYVWNGNNLERVLAKMHSGPAFCLTSCDAGFASGGKDGCVRLYDSQMQPLSVIRLADTPAGYPGIAVRSVDWRGSAVLAGTQDGEILEIGTEQLDRPAVLVQSHSEGELWALAPHPKKPVFATASDDQTLRIWHAGNRDCQQKARLDRKARSCAFNEDGSLIACGFIDGGFTVFRTRDLVELFSAKERKEVLHEMKFSPDGKFLAVGSNDNFVDIYDVQQKLKKVGECRGNSSFITHLDWSEDSQYIQTNSGAAEHLVFKAPAGKQVVRAAEIETIKWRTWTGVLGDCVKGIWEKYTDTNDVNAVDVNFEHEVLATGDDFGLVKLFRYPSTRKGSNFRRYVGHSAHVTNVRWLQDGCTLVSIGGADHAVFQWRLVSEGGDDVAGVGALTDGVGQSSAYLDSGSEGSDTDSSAAGGLDSDVEAEKQVNYDRFVDKAQLASGLKASLQAELPAGQKRKRAPDHGLKLDFAHGYRAYDCHRNLFYAQSGEILFNVAAIGVVHNKETNTQRFYTGHTDDILCLTVHPNADIVATGQVGKDPTIHVWEVESLKALSILKGQHERGVCTVAFSGDGRKLASVGLDDNHCIVVWDWRKGERLATTRAHKDRLFVIRWNPHDPNKLITVGVRLIRFWTVAGAGLTSSRGTFGSVAKLDTMLSACYGTDAE-TAYTCGASGLVYVWQGNVLSRTVKAHEGPCFALEFMPGPKPCFVTGGKDGNVCVFDDALERCARTFNLRNSNMGRGNLGVLLEDNPTVRSVMPGRNNTILAGTLNGEVVEIEKDGPMRVLVQGHRQGEVWGLAAHPTEPICVTASDDRSLRVWHLD--GRRMLACRVLPQPARCCDISHDGRLIGVGFRDGSFQVLNFDSLDPVVTLRHRKEEISDIKFSPNPGKYLAVASHDNFVDIYNVATQQRVGVCKGCSSYVTHIDWDANGKLLMVNSGAREQLFFEAPRGNRQVLPKADIERLPWHSWTCVLGDTCEGVWPPKCDITDVNATSLSHDRTLLATADDFGLVKLFEYPAKGKFAKYKQYVGHSAHVTNCRWSFDDSRLMSVGGADTALLIWRHCGQTVRRVAATAAAAAPLSGT-----AALP-SDDSDTDSEEEGGYDSDVEREKRMDYASKTYQISPLRERVGKRPTEQQQ----AGGDGLDALRPAVSRKTPKPPKVVRG-------VASGDKKR--------------PHHQHEEVADLQLEFVHGYRGFDCRSNLHYLNEAGDTIVYHAAGACIVHQVSAGTQSFFLGHDDDILCLMVNRVPKFAGVVASAQIGSADPPILVWSSRTLATLATLRGAHSVGVCSLDFSASGKHLVSVGLDSQHTIAVWRWQEGQLVTTCGGNSQRVFRAEFRPDSDSQFVSVGVKHVKFWTLAGSQLVHRRGQLSGYADGNLRMTTMLSIAFAHNGVTYTGAMSGDVFVWQEHRLIRLVEKAHQGPVFSLYTTLKDGLIVSGGKEKGGKSSGGLVKLWDQEMKRCREYNLN--------------LSDKTA-VIKSVCRVRGKILVGTKESEIIEVGEKDGALTQVARGHGEGELWGLAVHPGARQFATASDDGTCRIWDIGKKTMLHKLHSGPARSVAFSQNGEMLAAGLKNGSVLLLNTASLKLIGKRRDRGSVVSDVRFSPDSKLLAVGSAEGAVDFYQVGGPGG---------------LSRLGYCKGLEAAVLQTDFSADSAYLKVTSASYTAQVFTAPAGEPVTDPNFMENITWQTWTSIVGPEVLGIWPKSATKGDINCAHLCHCGAAMATGDDFGNVKLF-AFPV----TEPEAQHKTYFGHSAHVTNVRFTYDDSYLVSVGGDDCCVFVWKC 1991          

HSP 2 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 508/1347 (37.71%), Postives = 740/1347 (54.94%), Query Frame = 3
Query:  171 KLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG---YVTGGKDSCVVLHDPEFQPMTR-IDLKLTNIGYPNL--------IVRSVHWLSNNA-LVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAP-GGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR--------------LTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYT----------RLVSKDEVNQLQ---------------------KVTKSDIEDGKKRKKAPSQ---GLQLEWVHGYRGYDCRNNIFYL-QSGE-IVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLH---PLKDLIATGEVGR-EPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWT----QVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAV-MMHEGGCYAI-DALDKGF-VTGGKD-------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISH---QRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            K AP+  L LD+ +GYR + CH NLFY  S +I++ VA IG+V++ +   Q +Y  H DDI+ + +  + ++VATGQVGK P I +W   SL+  SILK QH  G+ +VAFS  G  L SVGLD N  + VWDW+KG+ L++TRAH DR+F  R+   D P K +T G++ I+FW++ G  L+S +G +G   ++ T+L+ C   +D    Y+   +G VY+W+ N L R +   H G  +++E        +VTGGKD  V + D   +   R  +L+ +N+G  NL         VRSV    NN  L GT   +++EI    P   + L+ GH  GE+W L  HP + I  T SDD SLR+W ++ R  L    + +  R C  +HDG LI +G  DGSF V+    +  V   + RKE + ++KFSP+ G +LAV S+DNFVDIY+  A+ +R GVCKG SS++TH+DW  +   +  NSGA E L F+AP G   +     +  + W  +T VLG   +G+W    D  D+NA  ++ +  L+AT DDFGLVKLF YP+  K A +++Y GHSAHVTN RWSFD   L+S+GG D ++  WR                  +SG+  +       +D SD+   + G  +S++E+E + +Y             V K    Q Q                     KV +      KKR     +    LQLE+VHGYRG+DCR+N+ YL ++G+ IV+H A   IV  +++ TQ F+  H+DDILCL ++       ++A+ ++G  +P I VW ++T+ +++ L+G H  GVC++DFS+ GK L SVGLD  H + VW W++G+ + +   +  ++F  ++ P +++Q V+VG+K ++FWT    Q+        G      ++ T L  A+  N  GV YTG+ SG V++W+++ L   V   H+G  +++   L  G  V+GGK+       G +KL D+   +  + Y L+         LS     I+SV   +GKIL  T   EI+E+   DG +  + +GHGEGELWGLAVHP     AT SDD    IW++     K +  K   GPAR    S +G  +A G K+GS L+L+  SL  I     R   +SD++FSP   K LAVGS +  VD Y         RL  CKG  + +   D+S D   L V S +     F AP G   +     +E I W +W+ ++G   +GIWP      D+N   L   G  +ATGDDFG VKLF +P     A+ K Y GHSAHVTNVR+ ++D YL+SVGG D  + VWK
Sbjct:  673 KRAPDHGLKLDFAHGYRAYDCHRNLFYAQSGEILFNVAAIGVVHNKETNTQRFYTGHTDDILCLTVHPNADIVATGQVGKDPTIHVWEVESLKALSILKGQHERGVCTVAFSGDGRKLASVGLDDNHCIVVWDWRKGERLATTRAHKDRLFVIRWNPHD-PNKLITVGVRLIRFWTVAGAGLTSSRGTFGSVAKLDTMLSACYG-TDAETAYTCGASGLVYVWQGNVLSRTV-KAHEGPCFALEFMPGPKPCFVTGGKDGNVCVFDDALERCARTFNLRNSNMGRGNLGVLLEDNPTVRSVMPGRNNTILAGTLNGEVVEIEKDGPM--RVLVQGHRQGEVWGLAAHPTEPICVTASDDRSLRVWHLDGRRMLACRVLPQPARCCDISHDGRLIGVGFRDGSFQVLNFDSLDPVVTLRHRKEEISDIKFSPNPGKYLAVASHDNFVDIYN-VATQQRVGVCKGCSSYVTHIDWDANGKLLMVNSGAREQLFFEAPRGNRQVLPKADIERLPWHSWTCVLGDTCEGVWPPKCDITDVNATSLSHDRTLLATADDFGLVKLFEYPAKGKFAKYKQYVGHSAHVTNCRWSFDDSRLMSVGGADTALLIWRHCGQTVRRVAATAAAAAPLSGTAALP------SDDSDTDSEEEGGYDSDVEREKRMDYASKTYQISPLRERVGKRPTEQQQAGGDGLDALRPAVSRKTPKPPKVVRGVASGDKKRPHHQHEEVADLQLEFVHGYRGFDCRSNLHYLNEAGDTIVYHAAGACIVHQVSAGTQSFFLGHDDDILCLMVNRVPKFAGVVASAQIGSADPPILVWSSRTLATLATLRGAHSVGVCSLDFSASGKHLVSVGLDSQHTIAVWRWQEGQLVTTCGGNSQRVFRAEFRPDSDSQFVSVGVKHVKFWTLAGSQLVHRRGQLSGYADGNLRMTTMLSIAFAHN--GVTYTGAMSGDVFVWQEHRLIRLVEKAHQGPVFSLYTTLKDGLIVSGGKEKGGKSSGGLVKLWDQEMKRC-REYNLN---------LSDKTAVIKSVCRVRGKILVGTKESEIIEVGEKDGALTQVARGHGEGELWGLAVHPGARQFATASDDGTCRIWDI---GKKTMLHKLHSGPARSVAFSQNGEMLAAGLKNGSVLLLNTASLKLIGKRRDRGSVVSDVRFSP-DSKLLAVGSAEGAVDFYQVGGPGGLSRLGYCKGLEAAVLQTDFSADSAYLKVTSASYTAQVFTAPAG-EPVTDPNFMENITWQTWTSIVGPEVLGIWPKSATKGDINCAHLCHCGAAMATGDDFGNVKLFAFPVTEPEAQHKTYFGHSAHVTNVRFTYDDSYLVSVGGDDCCVFVWK 1990          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A210QCE4 (Echinoderm microtubule-associated protein-like 6 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09691 PE=4 SV=1)

HSP 1 Score: 2119.35 bits (5490), Expect = 0.000e+0
Identity = 1073/2032 (52.81%), Postives = 1411/2032 (69.44%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISG-SGDI----NHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIP---SDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKE-KGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDC 6224
            M+ K AP SQL L+WVYGYRGHQC NNLFY  S+ I+YF AGIGIVY+ +  KQ +Y  H+DDI+ + L  D  +VATGQ GKSPFIC+W+SN++ET SILKD H +G+++VAF + G  L+SVGLD  +T+NVWDWK+GK+L++ R HSDRVFD +F   +     V+CG+KHIKFW+LCGN+L+SKKG++GK GEIQTI+ +  S SDN V YSGT++GD+YIW+ NNL+ V+   H  A+Y+I+    G+ TGGKD CV L D +F+P+T I L  T++GY  L VRSV W   + L GTQ S+I E+ V   +KPK L+ GHA GELWAL +HP+K IFATGSDD +LR+W MN  E L+   +D+KIRSC F+++G+ IA+G+MDGSF V++  D  EV + +DRKEV+HE+KFSP G +LAV SNDNFVD+Y     +K+ G+CKG+SSFITH+DWS DS +++TNSGAAE L +K P G+ +T  + + +I+W  FTGVLG+++ GIW KYTDTND+NA D N  A  I TGDDFGLVKLF +P   KGA FRKY GHSAHVTNVR+S DK  +IS GG D S+FQWR   A    +GD+    +  +DS ++ SDS +SDIG  +S+LE+E Q  Y R + K++   ++K  KS++  G+KRKK P  GLQLE++HGYRGYDCRNN+FY Q+GE+V+HVAA GIV N  + TQRFY  H DDILCL +HPLKDL+ATG+VGR+P +HVWDT+++K+VS+LKG+H+RGVCAVDFS DGK+LAS+GLDDNH +VVWDWRKGEKLA+TR HKDKIF+IKW+P   N+L+ VG+K I+FWTQ GGGFT+ RGTFGNVAKL   LC  +      + Y+G   G V++W+D  LQ  V  HEG  +A+ +LDKGFVTGGKDG + L D+ F +  K+Y L   ++      ML +  P+IR++VLG GKIL  T +GE++E+   G + +L QGH EGELWGL VHP K +CATVSDD  L IW+++  +HK+I  K LK   RC D S DG  +AVG KDGSF+V++  ++ EI + HHRKEEISDIKFSP P KYLAV SHDNFVDIY+ ++ +R+  CKG SSYITH+DW   GK+LMVNSGAKEQLFFEAPRG R  +   EIEK+ W +W+ VLG +C G+WPPK D+TDVN+V ++SD  V+AT DDFG VKLF+YP K KFAK K+Y+GHSAHVTNVR+  +D  L+S GGADTA MVW++     P E       +    SD SDTDSEEE G+DSDVEREK++DY +K+Y + + +++   +KP L  Q  +    K    R+     KV              +RS +    + R+  +        +VT L+L +V GYRGFD RNNLHY++ +G+ I++H A  GIV NL SG QSF+LEH DDI+CL VN++PK++NV+A+GQIG +P+IHVW++      S L G H  G+C++DFS +G  LLSVG+++DH + VW+W+ G+ +    GH+QRIF AEFRPDSDS FV VGVKHVKFWT+AG EL  KRG +    +D     +M TMLS+AF  N+ TYTGAM+G V+VWK   L R+V+KAHSGPVF +FTTL DGLIV+GGKE   +++G +KLWDQEM R + F + E           KP       V++S+ R KGKIL+GT+DN ++E+ EK GT   L+  H EG + GL VHP  P + +AS DGTVR WDL  K  +  L  G A    +S +G  L +GLK+G F VL+    +L  +++DR   I D++FSP+  ++AVGS D  VD Y L S G               +L R  YCK + +  +Q+DFS D  +IR     Y  ++++   G +V +    +KI W SW+S +G EV GIWP  S   D+N + +SH  NA  TGDD+G VKL+  FP P         +  F GHS++VTNVRF+ DD  L+STGG+DC
Sbjct:    1 MATKTAPTSQLRLEWVYGYRGHQCRNNLFYNASKNIIYFAAGIGIVYNDRNHKQRFYLGHDDDILCLNLHPDRSMVATGQTGKSPFICVWDSNTMETVSILKDGHQNGVAAVAFDREGTRLVSVGLDQQSTINVWDWKRGKILATVRGHSDRVFDVQFQPFNNNT-IVSCGVKHIKFWTLCGNSLTSKKGVFGKTGEIQTIMCMAFSTSDN-VTYSGTMSGDIYIWKGNNLDSVVQEAHKAAIYAIDHADEGFATGGKDGCVRLWDSDFKPITTISLVNTHLGYKGLCVRSVCWRGESVLCGTQDSEIFELSVRERDKPKCLVQGHAEGELWALAIHPRKPIFATGSDDQTLRLWNMNNFEILSRTSLDQKIRSCAFDNEGNHIAVGLMDGSFLVLKAGDFAEVVHIKDRKEVIHEMKFSPCGKFLAVASNDNFVDVYSVEQRYKQVGLCKGSSSFITHIDWSEDSKFLQTNSGAAERLFYKMPVGKQVTNREEIVNIRWHTFTGVLGSEVNGIWEKYTDTNDVNAVDANFPAETIVTGDDFGLVKLFKFPCLRKGAKFRKYIGHSAHVTNVRFSQDKSRVISTGGADHSVFQWRFIGADGADTGDLVDPQSGYMDSNSEASDSDMSDIGEVDSDLEQEKQIKYDRALYKEDAKTIRKKIKSELGSGQKRKKGPDVGLQLEYIHGYRGYDCRNNLFYTQNGEVVYHVAAAGIVYNRDNNTQRFYTEHTDDILCLCIHPLKDLVATGQVGRDPEVHVWDTESLKTVSVLKGQHQRGVCAVDFSGDGKRLASIGLDDNHCIVVWDWRKGEKLATTRGHKDKIFVIKWNPFEPNKLITVGVKHIKFWTQTGGGFTSSRGTFGNVAKLCDMLCITFG-KAADLFYSGGSDGCVFVWQDTKLQRTVKAHEGPVFAMHSLDKGFVTGGKDGVVGLWDDQFERCLKTYSLKQASISQTSRGMLITESPSIRAIVLGHGKILVGTRNGEVLEIDKSGPVTLLTQGHMEGELWGLVVHPRKKVCATVSDDKTLRIWDLK--DHKMINYKLLKQAGRCVDFSADGKFLAVGLKDGSFMVINSDTMDEILTFHHRKEEISDIKFSPDPVKYLAVASHDNFVDIYNVLNQKRVGTCKGASSYITHVDWERKGKVLMVNSGAKEQLFFEAPRGNRVTLRHAEIEKLDWVTWTSVLGHTCEGVWPPKSDVTDVNAVCVSSDKSVIATADDFGFVKLFQYPVKEKFAKHKKYVGHSAHVTNVRFTCDDNLLVSTGGADTATMVWRYGN---PTEAG----PVTCGDSDDSDTDSEEEGGYDSDVEREKNLDYASKSYVDPIRERK--GVKPHL--QDGAGLQKKPGFQRKPPQPPKV--------------KRSEAPSAGSKRKKAT--------QVTDLQLDYVFGYRGFDSRNNLHYIN-DGADIIFHTAGAGIVQNLSSGHQSFYLEHTDDIICLAVNQNPKFKNVMASGQIGTVPTIHVWDASTKETKSILSGGHSKGVCAVDFSCSGKYLLSVGLEDDHNVIVWRWQEGSKVGTVPGHSQRIFQAEFRPDSDSQFVTVGVKHVKFWTVAGCELRGKRGILTIAGTDHGTTVKMQTMLSLAFGANNMTYTGAMSGDVYVWKDTTLVRLVQKAHSGPVFTMFTTLRDGLIVTGGKEPDSRESGPVKLWDQEMKRCRAFSVQEG--------NLKP------SVVKSVCRTKGKILVGTKDNTVIEVAEKSGTNSVLVGGHAEGEVWGLDVHPTSPCFVTASFDGTVRYWDLSKKATVARLDIGAARSTAFSVDGEMLAVGLKNGEFVVLTTNGLKLWGKRRDRAGAINDVRFSPDGKILAVGSEDCCVDFYDL-SKGK--------------SLQRAGYCKGIPTFVIQMDFSADSQYIRVSTGAYIRQVFTVPGGALVEDHNITDKITWASWTSTLGNEVLGIWPKDSSGGDINCSHLSHLGNALATGDDFGFVKLF-EFPCPE----KQAQHKSFVGHSAHVTNVRFMFDDKFLISTGGDDC 1959          

HSP 2 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 537/1372 (39.14%), Postives = 764/1372 (55.69%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTD--GTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKH-RRDPVPLEDSINNKKINM-PQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFC-TNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL-ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVN-EPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            K AP+  L+LEWV+GYRG+ CRNN+FY  S  I++  A +GIV N  +  QRFY  H+DDILCL LHP + ++ATG+ G+ P I VWD+ TM++VSILK  H+ GV AV F  +G +L SVGLD    + VWDW++G+ LA+ R H D++F +++ P NNN +V+ G+K I+FWT  G   T+K+G FG   ++ T +C A++ +   V Y+G+ SG +YIWK N L S V   H+   YAID  D+GF TGGKDG ++L D  F  +     +S  N      L      +RSV      +L  T   EI ELS         LVQGH EGELW LA+HP K I AT SDD  L +W +  +N +++    L    R C    +G+ +AVG  DGSFLVL      E+     RKE I ++KFSP  GK+LAV S+DNFVD+YS    ++++ +CKG SS+ITH+DWS D K L  NSGA E+LF++ P G +Q+  + EI  I W +++ VLG    GIW    D  DVN+V      + + TGDDFG VKLF++P   K AKF++Y+GHSAHVTNVR+  +   ++S GGAD ++  W+    D     D ++ +   M   S+ SD+D  +    DSD+E+EK + Y                                                AL  +D+  I ++ +S   +  +R       P +     L+L+++HGYRG+DCRNNL Y   +   +VYH AA GIV+N  +  Q F+ EH DDILCL +  HP  +++VATGQ+G  P +HVW++     +S LKG H  G+C++DFS  G  L S+G+D++H I VW W  G  LA   GH  +IF+ ++ P   +  + VGVKH+KFWT  G    + RG     F N  ++  ML + F    D  Y+G  +G V+VW+   L R V KAH GPVF + +  +D   V+GGK+     G + LWD +  R    Y  +  ++   S+T++ +       IR+I    GKIL+GT++ ++LEI +K G V  L Q H EG L GL VHP     ++ S+D T+RIWDL + KM+   L      CVD+S +G +L +GLK G+F V+++ +   ++    R ++I+DIKFSP+    +AV S+DN VDIY                  +V+   R   CK   S    +D+   G  +       +   +    G  V     +IEK+ W++W+SV+G    G+WP KSD  DVN   VS   +   T DD+G VKL+  +PV          +  + GHS++VTNVRF  DD+ LVSTGG D    VW+
Sbjct:    4 KTAPTSQLRLEWVYGYRGHQCRNNLFYNASKNIIYFAAGIGIVYNDRNHKQRFYLGHDDDILCLNLHPDRSMVATGQTGKSPFICVWDSNTMETVSILKDGHQNGVAAVAFDREGTRLVSVGLDQQSTINVWDWKRGKILATVRGHSDRVFDVQFQPFNNNTIVSCGVKHIKFWTLCGNSLTSKKGVFGKTGEIQTIMCMAFSTSD-NVTYSGTMSGDIYIWKGNNLDSVVQEAHKAAIYAIDHADEGFATGGKDGCVRLWDSDFKPI---TTISLVNTH----LGYKGLCVRSVCWRGESVLCGTQDSEIFELSVRERDKPKCLVQGHAEGELWALAIHPRKPIFATGSDDQTLRLWNM--NNFEILSRTSLDQKIRSCAFDNEGNHIAVGLMDGSFLVLKAGDFAEVVHIKDRKEVIHEMKFSPC-GKFLAVASNDNFVDVYSVEQRYKQVGLCKGSSSFITHIDWSEDSKFLQTNSGAAERLFYKMPVG-KQVTNREEIVNIRWHTFTGVLGSEVNGIWEKYTDTNDVNAVDANFPAETIVTGDDFGLVKLFKFPCLRKGAKFRKYIGHSAHVTNVRFSQDKSRVISTGGADHSVFQWRFIGADGADTGDLVDPQSGYMDSNSEASDSDMSDIGEVDSDLEQEKQIKY----------------------------------------------DRALYKEDAKTIRKKIKSELGSGQKR----KKGPDV----GLQLEYIHGYRGYDCRNNLFY--TQNGEVVYHVAAAGIVYNRDNNTQRFYTEHTDDILCLCI--HP-LKDLVATGQVGRDPEVHVWDTESLKTVSVLKGQHQRGVCAVDFSGDGKRLASIGLDDNHCIVVWDWRKGEKLATTRGHKDKIFVIKWNPFEPNKLITVGVKHIKFWTQTGGGFTSSRGT----FGNVAKLCDMLCITFGKAADLFYSGGSDGCVFVWQDTKLQRTV-KAHEGPVFAMHS--LDKGFVTGGKD-----GVVGLWDDQFERCLKTYSLKQASI---SQTSRGMLITESPSIRAIVLGHGKILVGTRNGEVLEI-DKSGPVTLLTQGHMEGELWGLVVHPRKKVCATVSDDKTLRIWDLKDHKMINYKLLKQAGRCVDFSADGKFLAVGLKDGSFMVINSDTMDEILTFHHRKEEISDIKFSPDPVKYLAVASHDNFVDIY------------------NVLNQKRVGTCKGASSYITHVDWERKGKVLMVNSGAKEQLFFEAPRGNRVTLRHAEIEKLDWVTWTSVLGHTCEGVWPPKSDVTDVNAVCVSSDKSVIATADDFGFVKLFQ-YPV----KEKFAKHKKYVGHSAHVTNVRFTCDDNLLVSTGGADTATMVWR 1265          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: R7U6W8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_153818 PE=4 SV=1)

HSP 1 Score: 2117.81 bits (5486), Expect = 0.000e+0
Identity = 1082/2042 (52.99%), Postives = 1422/2042 (69.64%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIK---FVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-LTDAISGSGDINHQ---VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQP--PQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIP--SDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK---GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            MS K AP SQL L+WVYGYRGHQC NNL YT+S ++VYFVAG+ +V+ +++ +Q ++  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S S+ T SILKD H  G+ ++AF  TG  L+SVGLD +AT+NVWDW+KGK++S+ R HSDRVFD +F     P K    V+CG+KHIKFW+L GNTLS+KKG++GK GEIQT+L  C++   N   YSGTL GDVY+W+ + L RVI   H G++++++    G+ +GGKD CV L D +F+P+T++DL  +  GY  L VRSV W  +  LVG+Q S++ EI VS   KPK LM GHA GELWAL  HPKK +FATGSDD ++R+W M  +  L+   +D+ IRSCGF+ DG+ +A+G+ DGS+ V+RT+D+ E+ + +DRKEV+HELK+SPDG  LAVGSNDNFVDIY  +  +KR G C G+SSFITHLDWS DS +I+TNSGAAE L FK PGG+ +T    +  + WA +TGVLG +  GIW KYTDTNDINA D N  + +I TGDDFGLVKLF +PS  KGA FRKY GHSAHVTN R+S D+  +++ GG D ++FQWR + + +    DI  Q   VDS ++ SDS +SD+   +S++E E Q +Y R V K+++  L+K  K ++ +G KR KAPSQGL+L++VHGYRGYDC NN+FYLQSGEI +HVA VGI+ N  + TQRFYA+H DDIL L +HPLKD++ATG+VGR+PTIHVWD   +K++SILKG H+RGVCAVDFS+DGK+LASVGLDDNH +V+WDWRKGEKLA+TR HKDKIF+IKW+P    +LV VG+K I+FWTQ GGGFT+ RGTFGNVAK+D+ +C +Y    P +CYTG  +G +Y+W    L   +  H+G C+A+ ALDKGFVTGGKDG + L DE F +  K+Y +    L      +L +  P IRSVVLG G IL  T + +++E++ +G +NILVQGH EGE+WGLA HP K + ATVSDD  L +W++  S H++I  K LK P RC   S DG A+AVG KDGSF+V++  +L +I   HHRK+EISDI+FSP PGKYLAVGSHDN VDIY+ +S +R+  CKG SSYITH+DW + GKLLM NSGAKEQLFFEAPRG RQ +   E+EKI WASW+ VLG++C G+WPP  D+TDVN+ SL+ D +VLATGDDFG VKLF+YP K K AKFK+Y+GHSAHVTNVRW  ND +L+SVGG DT++M W+H          +   +     SD SDTDSEEE G+DSDV REKS+DY AKTYS  +  + T  +KP    Q   +++ K           K +  A  +  S E  +R         +RL  D           L+L  V G+RGFDCRNNL YL+ +G+ IVYHAA  GIV N+ S  Q+F+ EH DDI+CL VN HPK++ V+ATGQIGA P ++VW +     LS +KG H  G+C+++FS +G LLL+VG+++DH +AVW+W+ GT +A + GH+QRIF A FRPDSD+ FV VGVKH+KFW++AG EL+ KRG I    D    PRM T+LS+AF  N  TY+GAMNG V+VWK  +L+R+V++AH+GP+F ++TTL DGL+V+G KE+    KD G +KLWDQEM R + F L       G  E        S++V++S+ R KGKIL+GT+++  +E+ EK    K +   HGEG L GLA HP   ++ +ASEDGTVR+WD+  K +I SL  G A     SP+G    +GLK+G F V++  ++R   +++DRG  I DI+FSP+   +AVG  +  VD Y L            + P     L R  YCK +     Q+DFS D  +I+ G   Y  +IYS   G+ V + E + K+ + SW+SV+G EV GIWP  ++KADVN A VSH  NA  TGDDYGLVKL+ SFP    ++    P+  F GHS++VTNVRF   D +L+S GG+DCC+FVWKC
Sbjct:    1 MSTKAAPKSQLRLEWVYGYRGHQCRNNLAYTSSRELVYFVAGVAVVHSVREHRQRFFLGHDDDIISLALHPEKLLVATGQVGKEPYICVWDSLSVSTVSILKDGHQQGVGALAFDSTGNRLVSVGLDQHATINVWDWRKGKIISTVRGHSDRVFDVQFH----PYKENTLVSCGVKHIKFWTLSGNTLSAKKGVFGKVGEIQTML--CLAFGSNESTYSGTLGGDVYVWKGSQLNRVIQGAHQGSIFTLDFTDDGFASGGKDGCVRLWDTDFKPITKVDLTQSEDGYKGLSVRSVCWRGDRVLVGSQDSEVFEIVVSEREKPKCLMQGHAEGELWALASHPKKPVFATGSDDHTVRLWNMQNKTILSKTTLDQPIRSCGFSPDGASLAVGMADGSYMVLRTKDLQEIVHIKDRKEVIHELKYSPDGTLLAVGSNDNFVDIYSVSQRYKRVGQCTGSSSFITHLDWSQDSKHIQTNSGAAERLFFKMPGGKQLTNKDEIRGLHWATWTGVLGPEANGIWEKYTDTNDINATDANFGSEVIVTGDDFGLVKLFTFPSLKKGAKFRKYVGHSAHVTNCRFSSDRMHVVTTGGADHAVFQWRFIAEGVGIDEDIPDQHAYVDSNSEDSDSDMSDVAEIDSDIEAEKQKSYDRAVYKEDMAVLKKSAKQNVANGAKRNKAPSQGLKLQFVHGYRGYDCHNNLFYLQSGEIAYHVAGVGILYNRENHTQRFYANHTDDILSLCIHPLKDILATGQVGRDPTIHVWDADNLKTLSILKGNHQRGVCAVDFSADGKRLASVGLDDNHCIVIWDWRKGEKLATTRGHKDKIFVIKWNPFEQQKLVTVGVKHIKFWTQTGGGFTSNRGTFGNVAKVDSMMCVSYGKT-PDLCYTGGGNGSIYVWVGLSLSKCIKAHDGPCFAMHALDKGFVTGGKDGVVCLWDEQFERSLKNYSIKRSALVAGTKGVLVNDNPAIRSVVLGHGHILVGTKTSDLLEINKEGAMNILVQGHREGEVWGLATHPRKLVSATVSDDRTLRVWDM--SEHQMINCKILKQPGRCVCFSPDGKAIAVGLKDGSFIVVNSDTLEDIVQFHHRKQEISDIRFSPDPGKYLAVGSHDNMVDIYNVLSSKRVGTCKGSSSYITHIDWDSAGKLLMTNSGAKEQLFFEAPRGKRQALRSAEVEKINWASWTSVLGNTCEGVWPPGSDVTDVNTSSLSDDRQVLATGDDFGFVKLFDYPVKGKHAKFKKYMGHSAHVTNVRWTANDTHLVSVGGGDTSVMQWQHL--------GVGETR---GDSDDSDTDSEEEGGYDSDVAREKSIDYSAKTYSNPI--RSTSGVKP--YQQDYEDDDEK-----------KTKVLAAEVAPSAEKSKR---------KRLTQD-----------LDLDLVMGFRGFDCRNNLQYLN-DGTDIVYHAAGAGIVLNISSAHQTFYTEHTDDIICLAVNEHPKFKGVIATGQIGATPEVNVWEASSKRTLSIIKGHHRKGVCAVNFSCSGKLLLTVGLEDDHQVAVWRWQEGTKVASSAGHSQRIFHAAFRPDSDTQFVTVGVKHIKFWSIAGGELVGKRGIINPLPDLPEAPRMQTLLSLAFGANHVTYSGAMNGDVYVWKENILSRVVQRAHTGPIFSMYTTLRDGLVVTGAKERPSNAKDGGPVKLWDQEMKRCRAFNL-------GLQE--------SVDVVKSVCRSKGKILVGTKESQFVELNEKTAETKMITCGHGEGELWGLATHPSTERFITASEDGTVRMWDIVNKKMINSLKVGAARSAAISPDGELAAVGLKNGGFVVITVATFRPWGQRRDRGDIINDIRFSPSGQYLAVGCQEGTVDFYDLR-----------KGPQ----LQREGYCKGIQGFVAQMDFSADSKYIKIGTGSYVSQIYSVPNGKEVKDKEMLSKVTYASWTSVLGSEVVGIWPRNAEKADVNCADVSHSGNAIATGDDYGLVKLF-SFP----SSEKYAPHKTFTGHSAHVTNVRFTYSDRYLLSAGGDDCCIFVWKC 1951          

HSP 2 Score: 423.32 bits (1087), Expect = 2.672e-116
Identity = 234/618 (37.86%), Postives = 353/618 (57.12%), Query Frame = 3
Query:  159 EMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG------KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD--------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATA--SFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
            E S +      L LD V G+RG  C NNL Y N    IVY  AG GIV +I    Q +Y EH DDII +A+    +   ++ATGQ+G +P + +W ++S  T SI+K  H  G+ +V FS +G  LL+VGL+ +  + VW W++G  ++S+  HS R+F A F   D   +FVT G+KHIKFWS+ G  L  K+GI        +   +QT+L+  ++   N V YSG +NGDVY+W+EN L RV+   H+G ++S+ +       VTG K+          V L D E +     +L L        +V+SV       LVGT+ S  +E+   T  + K +  GH  GELW L  HP    F T S+D ++R+W +  ++ + +L++    RS   + DG L A+G+ +G F VI           +DR +++++++FSP G +LAVG  +  VD YD       +R G CKG   F+  +D+S DS YI+  +G+    I+  P G+ +   ++L+ + +A +T VLG+++ GIW +  +  D+N ADV+ + N IATGDD+GLVKLF++PS  K A  + +TGHSAHVTNVR+++  ++L+S GG D  IF W+
Sbjct: 1341 EKSKRKRLTQDLDLDLVMGFRGFDCRNNLQYLNDGTDIVYHAAGAGIVLNISSAHQTFYTEHTDDIICLAVNEHPKFKGVIATGQIGATPEVNVWEASSKRTLSIIKGHHRKGVCAVNFSCSGKLLLTVGLEDDHQVAVWRWQEGTKVASSAGHSQRIFHAAFR-PDSDTQFVTVGVKHIKFWSIAGGELVGKRGIINPLPDLPEAPRMQTLLS--LAFGANHVTYSGAMNGDVYVWKENILSRVVQRAHTGPIFSMYTTLRDGLVVTGAKERPSNAKDGGPVKLWDQEMKRCRAFNLGLQE---SVDVVKSVCRSKGKILVGTKESQFVELNEKTA-ETKMITCGHGEGELWGLATHPSTERFITASEDGTVRMWDIVNKKMINSLKVGAA-RSAAISPDGELAAVGLKNGGFVVITVATFRPWGQRRDRGDIINDIRFSPSGQYLAVGCQEGTVDFYDLRKGPQLQREGYCKGIQGFVAQMDFSADSKYIKIGTGSYVSQIYSVPNGKEVKDKEMLSKVTYASWTSVLGSEVVGIWPRNAEKADVNCADVSHSGNAIATGDDYGLVKLFSFPSSEKYAPHKTFTGHSAHVTNVRFTYSDRYLLSAGGDDCCIFVWK 1950          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:103028254])

HSP 1 Score: 1997.25 bits (5173), Expect = 0.000e+0
Identity = 1005/2040 (49.26%), Postives = 1389/2040 (68.09%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDAR---FMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQV-----DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M++K AP  QL L+W++GYRGHQC NNLFYT  ++IVYFVAG+G+VY+ ++  Q +Y  HNDDIIS+AL  D   VATGQVGK P+IC+W+S +L T SIL+D HTHG++ +AF   G  L+SVGLD   T++VWDWKKG+VL++   HSDR+FD     F+    P + V+CG+KHIKFW+LCGN L+ K+GI+GK G++QTIL  C++ +   V YSG LNGD+Y+W+  NL R +   H   ++S+ +C  G+ TGG+D CV L D +F+P+T+IDL+    GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH+ GELWAL +HPK+ I  TGSDD S+R+W + +   +    +++ +RS  FN+DGS +A+G+ DGSF+V+R RDM EV + +DRKEV+HELKFSPDG +LAVGSND  VDIY     +K+ G C  ++ FITHLDWS+DS +++TN GA E   ++ P G+ + + +    I W  +T VLG ++ GIW KY++ NDIN+ D N ++ ++ TGDDFGLVKLF +P   K A F+KY GHSAHVTNVRWS D ++++S GG D S+FQWR       +G +   +     DS +  SDS LSD+   +S++E+EAQ NY R V K+++ QL+K     +    KR+KAP +GL+L++VHGYRG DCRNN+FY Q+GE+V+HVAAVG+V N    TQRFY  H+DDIL L  HPLKD +ATG+VGR+P IHVWD QT+K +S+L+G+H+RGVCA++F++DGK L SVG+D+ H +V+WDW+KGEKLA  R HKDKIF++K +P   ++LV VG+K I+FW   GGG T KRG FGN+ K +T + A Y  ++  + ++G+ +G VYIWKD  L   +  H+G  +A+ +LDKGFVTGGKDG ++L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L IWE+  +NH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ + HHRKE ISD+KFS   GKYLAV SHD+FVDIY+ ++ +R+ +CKG +SYITH+DW T GKLL +N+GAKEQLFFEAPRG RQ I+  E EK+ WA+W+ VLG +C GIWP    ++ VN+ SLT D K+LATGDDFG +KLF +P K +FAKFK+Y+GHSA+VTNVRW ++D  LLSVGGAD ALM+W          + I  ++     S+ SD D+EE+ G+DSDV REK+MDY  K Y+  ++ ++   +KP                          Q   +L+ +   + R +       P +L+ +      + V +L L HV GYRGFDCRNNLHYL+ +G+ I++H AA  ++ NL +G QSF+LEH DDILCLTVN+HPKY+N++ATGQIG  PSIHVW+++    LS L+  H  G+  ++FS+TG LLLSVG+D +HTI VW+W+ G+ ++   GH+ RIF+ EFRPDSD+ FV+VG+KH+KFWTL G  L+ K+G I +  V + RM TMLSVAF  N+ T+TGA+NG V+VW+   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET  P+E      +RS+ R KGKIL+GT+D +I+E+ EK      ++  H +G + GL+ HP    + SAS+DGT+RIWDL  K L+  ++ G PA C  +SPNG+ + IG+++G F VL   S  +  +K+DR   I DI+FSP++ L+AVGS ++ VD Y L        PS          L+R  YCKD+    +Q+DFS D  FI     +YK +++   +G++V E   +++I W +W+SV+G+EV G+WP  +DKADVN A VSH     VTGDD+GLVKL+  FP P         +  + GHS++VTN+RF  DD +++S GG DC VFVW+C
Sbjct:    1 MADKTAPRCQLRLEWIHGYRGHQCRNNLFYTAGKEIVYFVAGVGVVYNTREHSQKFYLGHNDDIISLALHPDKIQVATGQVGKDPYICVWDSYTLITVSILRDVHTHGVACLAFDADGQRLVSVGLDAKNTVSVWDWKKGRVLATATGHSDRIFDISWDPFL----PHRLVSCGVKHIKFWTLCGNALTPKRGIFGKTGDLQTIL--CLATAKEEVTYSGALNGDIYVWKGLNLVRTVQAAHGAGIFSMHACEEGFATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWKADRILAGTQDSEIFEVMVRDRDKPLLVMQGHSEGELWALDLHPKQPIAVTGSDDRSVRLWSLADHTLIARCNMEEAVRSVSFNNDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHELKFSPDGSYLAVGSNDGLVDIYAVAQRYKKVGECNKSACFITHLDWSVDSRFLQTNDGAGERFFYRMPAGKFLPKEEA-KGIHWMTWTSVLGPEVNGIWPKYSNVNDINSVDANYSSAVLVTGDDFGLVKLFRFPCLKKAAKFKKYIGHSAHVTNVRWSHDLQWVVSTGGADHSVFQWRFLPEGVMNGVLEPLLQEGYADSNSGESDSDLSDVPELDSDIEQEAQMNYERQVYKEDLPQLKKKLVGSL----KRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQTGEVVYHVAAVGVVYNRQQHTQRFYLGHDDDILSLTAHPLKDYVATGQVGRDPAIHVWDIQTLKCLSLLRGQHQRGVCALEFTADGKSLVSVGIDEGHSIVMWDWKKGEKLAKARGHKDKIFVVKGNPFRMDKLVTVGIKHIKFWQHTGGGLTFKRGIFGNLGKQETMMSACYGRSED-LVFSGATTGDVYIWKDTSLIKTIKAHDGPVFAMCSLDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAALSPSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELS-ANHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRKEIISDLKFSQDAGKYLAVASHDSFVDIYNVLTSKRVGICKGATSYITHIDWDTRGKLLQLNTGAKEQLFFEAPRGRRQNISAAEFEKVEWATWTSVLGSTCEGIWPT---LSFVNASSLTKDRKLLATGDDFGFIKLFSFPCKGQFAKFKKYVGHSANVTNVRWSNDDAMLLSVGGADMALMIWA--------REGIGPRESKAVDSEESDDDAEEDGGYDSDVAREKNMDYTTKIYA--VSIREMTGVKP------------------------HQQQKEILVDERPPVSRAA-----PLPEKLLKNNVTKKKKLVEELALDHVFGYRGFDCRNNLHYLN-DGADIIFHTAAAAVIQNLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQIGLAPSIHVWDAMSKQTLSVLRCSHAKGVGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSKVSSKAGHSDRIFVVEFRPDSDTQFVSVGIKHIKFWTLVGGSLLYKKGVIGA--VEEGRMQTMLSVAFGANNLTFTGAINGDVYVWRDHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMRRCRAFQL----------ETGLPVES-----VRSVCRGKGKILVGTKDGEIIEVGEKNAASNTMINGHTQGRIWGLSTHPSKDIFISASDDGTIRIWDLADKKLLNKVSLGHPAKCTAFSPNGDMVSIGMENGEFIVLLVNSLTVWGKKRDRSVAIQDIRFSPDNRLLAVGSVESAVDFYDL-----TLGPS----------LNRIGYCKDIPGFVIQLDFSADSKFIAVSTGNYKRQMHEVPSGKVVTEQFIMDRITWATWTSVLGDEVLGVWPRNADKADVNCACVSHAGLNVVTGDDFGLVKLF-DFPCP----EKFAKHKRYFGHSAHVTNIRFSYDDKYVISVGGNDCSVFVWRC 1947          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: ENSAMXT00000009461.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:19953646:20019083:-1 gene:ENSAMXG00000009201.2 transcript:ENSAMXT00000009461.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1964.5 bits (5088), Expect = 0.000e+0
Identity = 988/2038 (48.48%), Postives = 1373/2038 (67.37%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQ-TNYTRLVSKDEVNQLQKVTKSDIED--GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ AP  +L L+W+YGYRGHQC NNLFYT  +++VYFVAG+G+VY+ ++  Q +Y  H DDIIS+AL  +  LVATGQVGK P+IC+W++ +++T SILKD H+HG++ +AFS+    L+SVGLD   T+ VWDWK+GKV+++   HSDR+FD    ++  P    + V+CG+KHIKFWS+CGN L+ K+GI+GK G++QTIL  C+S + + + YSG LNGD+Y+W+  NL R +   H   ++S+ SC  G+ TGG+D C+ L D EF+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH+ GELWALGVHPKK +  TGSDD S+R+W + +   +    +++ +RS  F+HDGS +++G+ DGSF+V+R RDM E+ + +DRKEV+HELK+SPDG +LAVGSND  VD+Y     +K+ G C  + SFITHLDWS+D  +++TN GA E   ++ P G+H+T  + +  I W  +T V+G ++ GIW KYT+  DIN+ D N ++ ++ TGDDFGLVKLF +P   KGA F+KY GHSAHVTNVRWS D +++++ GG D S+FQWR                             G+ N  +E   Q T +   ++ +++ QL++ ++  ++     KR++ P   L+L++VHGYRGYDCRNN+FY Q+GE+V+HVAAVGIV N    TQRFY  H+DDI+ L +HP+KD  ATG+VGR+P +HVWD Q++K +S+L+G H+RGVCA+DFS+DGK L SVG+DDNH ++VWDW+KGEKLA+ R HKDK+F++K  P   ++LV VGMK IRFW   GGG T KRG FGN+ + +T +   +  +   + ++G+ +G +YIWK+  L   +  H+G  +A+ +L+KGFVTGGKDG ++L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GE++E+   G I +LVQGH EGE+WGLA HP + +CATVSDD  L IWE   +NH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ S HHRKE ISDIKFS   GKYLAV SHD+FVDIY+ +S +R+ +CKG + YITH+DW T GKLL VNSGAKEQLFFEAPRG RQ I  TEIEKI WA+W+ VLG +C GIW     ITD+N+ SLTSD K+LATGDDFG +KL+ YP   + A+FK+Y+GHSAHVTNVRW  +D  LL+VGGADTALM+W          DS  N++     S+ S+ D+EE+ G+DSDV REK +DY  K  +  + +          ++ T  +  LK + + E     +          +  +  + + N  +  ++L+ D           L L HV G+RGFDCRNNLHYL+ +G+ I++H AA  +V +L  G QSF+LEH DDILCLTVN+HPKY+N++ATGQIG  PSIHVW+++    LS L+  H  G+  ++FS+TG LL+SVGI+++HTI VW+W+ GT +    GH  RIF+ EFRPDSDS FV+VG+KHVKFWTLAG+ L+ K+G + S  V   RM TMLSVAF  N+ T+TGA+NG V+VW+   L R+V KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQEM R + F L          ET + L     + +RS+ R KGKIL+GT+D +I+E+ EK      L+ +H +G + GLA HP    + +AS+DGT+RIWDL  K L+  ++ G  A C  YSP+G  + IG+K+G F +L   S ++  +K+DR   I DI+FSP+  L+AVGS +  VD+Y L  +                 L+R +YCKD+ S  +Q+DFS D  F++     YK +I+   +G+IV E   IE+I W SW+S +G+EV G+WP  SDKADV  + VSH     VTGDD+GLVKL+  FP P         +  F GHS++VTN+RF  DD ++VSTGG+DC VF+WKC
Sbjct:    1 MADRTAPRCRLRLEWIYGYRGHQCRNNLFYTAGKEVVYFVAGVGVVYNTREHTQRFYLAHTDDIISLALHPERSLVATGQVGKDPYICVWDTFNIQTVSILKDAHSHGVACLAFSR----LVSVGLDAKNTVCVWDWKRGKVIATATGHSDRIFD----ITWDPFQQNRMVSCGVKHIKFWSMCGNALTPKRGIFGKTGDLQTIL--CVSAAKDEITYSGALNGDIYVWKGLNLIRTVQGAHGAGIFSMYSCEEGFATGGRDGCIRLWDSEFKPITKIDLRETEQGYKGLSIRSVCWRADRILAGTQDSEIFEVMVRERDKPLLIMQGHSEGELWALGVHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSHDGSQLSLGMKDGSFTVLRVRDMTEIVHIKDRKEVIHELKYSPDGAYLAVGSNDGLVDVYAVAQRYKKVGECSRSCSFITHLDWSIDGKFLQTNDGAGERFFYRMPTGKHLTSKEEIKGIHWVSWTCVIGPEVSGIWPKYTNLADINSLDANYSSAVLVTGDDFGLVKLFRFPCLKKGAKFKKYVGHSAHVTNVRWSHDHQWVLTTGGADHSLFQWRFLPE-------------------------GSVNGVIEPVFQETVWKSDLNPEDLPQLKQQSRGRMQQVGSLKRQQPPDAALRLQFVHGYRGYDCRNNLFYTQTGEVVYHVAAVGIVYNRQQHTQRFYLGHDDDIISLTVHPIKDYAATGQVGRDPAVHVWDVQSLKCLSLLRGFHQRGVCALDFSADGKSLVSVGVDDNHTIIVWDWKKGEKLATARGHKDKLFVVKCSPFLMDKLVTVGMKHIRFWQLAGGGLTFKRGVFGNLGRPETMMSVCFG-HAHDLVFSGAANGDIYIWKEPTLLKTIKAHDGPVFAMFSLEKGFVTGGKDGVVELWDDTFERCLKTYAIKRSTLSPGSKGLLLEDNPSIRAITLGHGHILVGTKNGEVLEIDKSGPITLLVQGHMEGEVWGLAAHPLQPVCATVSDDRTLRIWETS-TNHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVSFHHRKELISDIKFSRDAGKYLAVASHDHFVDIYNVLSSKRVGICKGATGYITHIDWDTRGKLLQVNSGAKEQLFFEAPRGKRQTIRTTEIEKIEWATWTSVLGPTCEGIWQIDSSITDINATSLTSDRKLLATGDDFGFLKLYSYPVNGQCARFKRYVGHSAHVTNVRWAQDDVTLLTVGGADTALMIWT--------LDSSTNQESRPVDSEESEEDTEEDGGYDSDVAREKVIDYTTKVCAVSIRE----------MAGTKPHQQLKEASAEERPPVSR----------AVPLPEKLQKNNVSKKKKLVED-----------LVLDHVFGFRGFDCRNNLHYLN-DGTDIIFHTAATAVVQSLTLGTQSFYLEHTDDILCLTVNQHPKYKNIIATGQIGTTPSIHVWDAMSKQTLSILRCCHAKGVGYVNFSATGKLLVSVGIESEHTITVWRWQEGTKVTSKGGHPDRIFVVEFRPDSDSQFVSVGIKHVKFWTLAGNSLVYKKGVVGS--VEDARMQTMLSVAFGANNLTFTGAINGDVYVWRDHFLLRMVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQL----------ETGQVL-----DCVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILINSHMQGEIWGLATHPAKDVFITASDDGTIRIWDLVDKKLLNKVSLGHSAKCASYSPDGEMVGIGMKNGEFVILLTNSLKMWGKKRDRSSAIQDIRFSPDKHLLAVGSAECTVDLYDLTQSSA---------------LNRISYCKDIPSFIIQMDFSADSRFLQVSTGAYKRQIHEVPSGKIVTEMSVIERITWASWTSALGDEVLGVWPRNSDKADVICSCVSHAGLNVVTGDDFGLVKLF-DFPCP----EKFAKHKRFFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFIWKC 1924          

HSP 2 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 506/1327 (38.13%), Postives = 778/1327 (58.63%), Query Frame = 3
Query:  150 QIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTR---IDLKLTNIGYPNLI------VRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT---RDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHIT-QTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQL------QKVTKSDIED-----------------GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSG-EIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDN-ILQSAVMMHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIY---SAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            Q+  +  +  P++ L L +V+GYRG+ C NNLFYT + ++VY VA +GIVY+ +Q  Q +Y  H+DDIIS+ +    +  ATGQVG+ P + +W+  SL+  S+L+  H  G+ ++ FS  G  L+SVG+D N T+ VWDWKKG+ L++ R H D++    F+V   P    K VT G+KHI+FW L G  L+ K+G++G  G  +T+++VC   + + V +SG  NGD+YIW+E  L + I   H G ++++ S   G+VTGGKD  V L D  F+   +   I     + G   L+      +R++     + LVGT+  +++EI  S P     L+ GH  GE+W L  HP + + AT SDD +LRIW+ +    +  +R + K  R C F+ DG  +A+G+ DGSF V+      DM+  H+   RKE++ ++KFS D G +LAV S+D+FVDIY+  +S KR G+CKG + +ITH+DW      ++ NSGA E L F+AP G+  T +T  +  I+WA +T VLG   +GIW   +   DINA  +  +  L+ATGDDFG +KL++YP   + A F++Y GHSAHVTNVRW+ D   L+++GG D ++  W L  + +            ++ S+    + G  +S++ +E   +YT  V    + ++      Q++ ++  E+                    +KK   + L L+ V G+RG+DCRNN+ YL  G +I+FH AA  +V ++   TQ FY  H DDILCL +  HP  K++IATG++G  P+IHVWD  + +++SIL+  H +GV  V+FS+ GK L SVG++  H + VW W++G K+ S   H D+IF++++ P +++Q V+VG+K ++FWT  G     K+G  G+V  A++ T L  A+  N   + +TG+ +G VY+W+D+ +L+     H G  + +     D   VTGGK+      G +KL D+   +  ++++     L+  Q+L      +RSV  GKGKIL  T  GEI+E+   +   NIL+  H +GE+WGLA HP+K++  T SDD  + IW++   + KL+    L   A+C   S DG  V +G K+G F++L   SL        R   I DI+FSP     LAVGS +  VD+Y    + +  R+S CK   S+I  +D+S D + L V++GA ++   E P G + +   + IE+I WASW+  LGD  +G+WP   D  DV    ++  G  + TGDDFG VKLF++P   KFAK K++ GHSAHVTN+R+ ++D+Y++S GG D ++ +WK
Sbjct:  630 QVGSLKRQQPPDAALRLQFVHGYRGYDCRNNLFYTQTGEVVYHVAAVGIVYNRQQHTQRFYLGHDDDIISLTVHPIKDYAATGQVGRDPAVHVWDVQSLKCLSLLRGFHQRGVCALDFSADGKSLVSVGVDDNHTIIVWDWKKGEKLATARGHKDKL----FVVKCSPFLMDKLVTVGMKHIRFWQLAGGGLTFKRGVFGNLGRPETMMSVCFGHAHDLV-FSGAANGDIYIWKEPTLLKTIKA-HDGPVFAMFSLEKGFVTGGKDGVVELWDDTFERCLKTYAIKRSTLSPGSKGLLLEDNPSIRAITLGHGHILVGTKNGEVLEIDKSGP--ITLLVQGHMEGEVWGLAAHPLQPVCATVSDDRTLRIWETSTNHRMVAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVSFHH---RKELISDIKFSRDAGKYLAVASHDHFVDIYNVLSS-KRVGICKGATGYITHIDWDTRGKLLQVNSGAKEQLFFEAPRGKRQTIRTTEIEKIEWATWTSVLGPTCEGIWQIDSSITDINATSLTSDRKLLATGDDFGFLKLYSYPVNGQCARFKRYVGHSAHVTNVRWAQDDVTLLTVGGADTALMIWTLDSSTN-----QESRPVDSEESEEDTEEDGGYDSDVAREKVIDYTTKVCAVSIREMAGTKPHQQLKEASAEERPPVSRAVPLPEKLQKNNVSKKKKLVEDLVLDHVFGFRGFDCRNNLHYLNDGTDIIFHTAATAVVQSLTLGTQSFYLEHTDDILCLTVNQHPKYKNIIATGQIGTTPSIHVWDAMSKQTLSILRCCHAKGVGYVNFSATGKLLVSVGIESEHTITVWRWQEGTKVTSKGGHPDRIFVVEFRPDSDSQFVSVGIKHVKFWTLAGNSLVYKKGVVGSVEDARMQTMLSVAFGANN--LTFTGAINGDVYVWRDHFLLRMVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRC-RAFQ-----LETGQVLDC----VRSVCRGKGKILVGTKDGEIIEVGEKNAASNILINSHMQGEIWGLATHPAKDVFITASDDGTIRIWDL--VDKKLLNKVSLGHSAKCASYSPDGEMVGIGMKNGEFVILLTNSLKMWGKKRDRSSAIQDIRFSPDK-HLLAVGSAECTVDLYDLTQSSALNRISYCKDIPSFIIQMDFSADSRFLQVSTGAYKRQIHEVPSG-KIVTEMSVIERITWASWTSALGDEVLGVWPRNSDKADVICSCVSHAGLNVVTGDDFGLVKLFDFPCPEKFAKHKRFFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFIWK 1923          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: si:dkey-1f12.3 (EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197])

HSP 1 Score: 1959.5 bits (5075), Expect = 0.000e+0
Identity = 989/2054 (48.15%), Postives = 1374/2054 (66.89%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAP-------GGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDIN-----HQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDG--KKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI--------PSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL++   H+DR+FD  + +     K V+CG+KHIKFWSLCGN L+ K+G++G+ GE+QTIL  C++ + + V YSG LNGD+Y+W+  NL R I   H   ++S+ +C  G+ TGG+D C+ L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V    KP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +++G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSNDN VDIY     +K+ G C G+ SFITH+DWS DS Y++TN G+ + L ++ P       GG+ +T  + L  ++W+ +T VLG ++ GIW KY+D NDIN+ D N ++ ++ T DD+GLVKL  YP   KGA F+KY GHSAH+TNVRWS D +++ISIGG D S+FQW+          ++        DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL++  K        KKR++AP+ G +L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+ +IHVW+T+ +K +S+LKG H+ GVC +DFS+DGK+LASVGLDDNH +V+WDWRKGEKL++ R  KDKIF++K +P+  ++L+  G+K ++FW + GGG   K+G   ++ K +T +CA Y   +  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KLK   RCC  S DG A+AVG  DGSFL+++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKG  +YITHLDW   GKLL VN+ AKEQLFFEAPRG +Q I  +E+EKI W++W+CVLG SC G+WP   ++T+V +  L++D +VLATGDD G VKLF YP K K+AKFK+Y+ HS HVTNVRW H+D  L+SVGGADT+LM+W H        +S   +++    S+ SD  SE++ G+DSDV RE  ++Y+ K  S   N +    +KP L  +  S +  +  V                        R   S     P +L ++        +  L L+ V GYRG DCRNN+HYL+ EG+ I+YH A+VG+V NL +G  SF++EH+DDILCLT+N+HPK+ NVVATGQ+G          PSIHVW++++   LS L+  H  GICS+ FS+TG LLLSVG+D +HTI +WKW+ G  +A  +GHTQRIF+AEFRPDSD+ FV+VG+KHV+FWTLAG  L++K+G + S  +   RM TMLSVAF  N+ T+TG ++G V VWK  +L RIV KAH+GPVF ++TTL DGLIV+GGKE+  K+ G++KLWDQE+ R + F L          ET + +     + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GL  HP    + SA+EDGTVR+WD+  + ++  +  G PA  V YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSP+S  +AVGS++N VD Y L       +  P         L+R   C+D+ S  +Q+DFS D  +++     YK  +Y   +G+ V E   I++I W +W+SV+G+EV GIW   +DKADV  A VSH     VTGDD+G+VKL+  FP P         +  F GHS++VTN+RF N D  ++S GG+D  +FVWKC
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDTHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRRGKVLAAAPGHTDRIFDISWDLYQQS-KLVSCGVKHIKFWSLCGNALTPKRGVFGRTGELQTIL--CVACARDEVTYSGALNGDIYVWKGVNLIRTIQGAHGSGIFSMNACEEGFATGGRDGCIRLWDLSFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLSLGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGSHLAVGSNDNSVDIYSVVQRYKKVGECVGSLSFITHMDWSTDSKYLQTNDGSGKRLFYRMPMLMFLYLGGKEVTNREELKLVQWSTWTCVLGPEVNGIWPKYSDINDINSLDANFSSQVLVTADDYGLVKLLRYPCIRKGAKFKKYLGHSAHITNVRWSHDYQWVISIGGADHSVFQWKFVPERKSKETLHIAPQEMLADSNSEESDSDQSDVPEMDSEIEQETQHTYRRQVYKEDLPQLKEQYKEKHRAAAMKKRERAPASGARLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHDDDILCLAIHPLKDYVATGQVGRDSSIHVWETEFLKPLSVLKGFHQFGVCTLDFSADGKRLASVGLDDNHTIVLWDWRKGEKLSAFRGSKDKIFVVKINPYMPDKLITAGVKHMKFWHKAGGGLIGKKG---SMGKTETMMCAVYGWTEEMV-FSGTCTGDICIWRDMFLVKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRSVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLIVNADTLEDLVSFHHRKDIISDIRFSPGAGKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNYITHLDWDKRGKLLQVNTAAKEQLFFEAPRGKKQTIPASEVEKIEWSTWTCVLGTSCEGVWPVVSEVTEVTAACLSNDRQVLATGDDLGYVKLFRYPVKGKYAKFKRYVAHSTHVTNVRWTHDDSLLVSVGGADTSLMIWSH--------ESEGCREVRQCDSEESDIQSEDDGGYDSDVTRENEINYVIKALST--NMRSMTGVKPHLQQKEPSVDERQGVV------------------------RPPVSRALPVPEKLQTNNVGKKKRPIEDLVLELVFGYRGNDCRNNVHYLN-EGADIIYHTASVGVVLNLTTGITSFYVEHSDDILCLTINQHPKFPNVVATGQVGIFSICLTATSPSIHVWDAMNKQTLSVLRCYHSRGICSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVASRSGHTQRIFVAEFRPDSDTQFVSVGIKHVRFWTLAGRALLSKKGVLSS--IEDARMQTMLSVAFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRL----------ETGQII-----DCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHMDGPIWGLGAHPTRDVFLSAAEDGTVRLWDIPERKMLNKVNLGHPARTVSYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRSPIQDIRFSPDSRYLAVGSSENAVDFYDL-------TLGP--------QLNRINCCRDIPSFVIQMDFSADSCYVQLSTGAYKRLVYEVPSGKQVTEQAVIDRITWATWTSVLGDEVVGIWSRNTDKADVTCACVSHSGLNIVTGDDFGMVKLF-DFPCP----EKFAKHKRFLGHSAHVTNIRFTNGDRFVISAGGDDRSLFVWKC 1974          

HSP 2 Score: 421.394 bits (1082), Expect = 4.034e-119
Identity = 226/633 (35.70%), Postives = 372/633 (58.77%), Query Frame = 3
Query:  135 IVNEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNS-EKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVG--------KSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDA 1958
            +  + Q   +  K  P   L L+ V+GYRG+ C NN+ Y N    I+Y  A +G+V ++      +Y EH+DDI+ + +    +   +VATGQVG         SP I +W++ + +T S+L+  H+ GI SV+FS TG  LLSVGLDP  T+ +W W++G  ++S   H+ R+F A F   D   +FV+ GIKH++FW+L G  L SKKG+    +   +QT+L+V  +   N + ++GT++GDV +W+E+ L R++A  H+G ++++ +       VTGGK+        + L D E +      L+   I      VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W LG HP + +F + ++D ++R+W + ER+ L  + +    R+  ++ +G ++AIG+ +G F ++    +      +DR+  + +++FSPD  +LAVGS++N VD YD T      R   C+   SF+  +D+S DS Y++ ++GA + L+++ P G+ +T+  ++  I WA +T VLG ++ GIW++ TD  D+  A V+ +   I TGDDFG+VKLF++P P K A  +++ GHSAHVTN+R++   +F+IS GG D+S+F W+   A
Sbjct: 1353 VPEKLQTNNVGKKKRPIEDLVLELVFGYRGNDCRNNVHYLNEGADIIYHTASVGVVLNLTTGITSFYVEHSDDILCLTINQHPKFPNVVATGQVGIFSICLTATSPSIHVWDAMNKQTLSVLRCYHSRGICSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVASRSGHTQRIFVAEFR-PDSDTQFVSVGIKHVRFWTLAGRALLSKKGVLSSIEDARMQTMLSV--AFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRLETGQI---IDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHMDGPIWGLGAHPTRDVFLSAAEDGTVRLWDIPERKMLNKVNLGHPARTVSYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRSPIQDIRFSPDSRYLAVGSSENAVDFYDLTLGPQLNRINCCRDIPSFVIQMDFSADSCYVQLSTGAYKRLVYEVPSGKQVTEQAVIDRITWATWTSVLGDEVVGIWSRNTDKADVTCACVSHSGLNIVTGDDFGMVKLFDFPCPEKFAKHKRFLGHSAHVTNIRFTNGDRFVISAGGDDRSLFVWKCVHA 1977          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 388.652 bits (997), Expect = 2.110e-117
Identity = 234/641 (36.51%), Postives = 362/641 (56.47%), Query Frame = 3
Query:   93 YGKFFSLAE*IQMIIVNEFQI-FEMSNKLA-PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQV------GK--SPFICIWNSNSLET-KSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT--RDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATAS---FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            Y + F     + M I ++ +  + + NK+A P  +L L WVYGYRG  C +NL+   + +IVYF A + ++Y++ +++Q +Y  HNDD+  +A+  D   +ATGQV      GK  +P + +W+S SL T  SI        ++ VAFSK+  G +L +V    +  L+VWDW+K K L+  +  +D V  A F   +  +  VTCG  H+ FW++ G+TL+ ++G++ K  + + +L  C++ ++N    +G  +G++YIW +  N + +V+A  H G ++S+     G +   GGKD  VVL D E+   + +++   +     L             VGT  + +++   S   KP  ++ GH   ELW L VHP    F T   D  + +W  +  +PL +  I+   RS GF+  G+++A+G M   + V+ T  RD+I +H   D  E++  +K+SPDG +LAVGS+DNFV IY  T +   + R G C G+SSF+THLDWS +S YI TNSG  E+L ++A  G+H+T   ++ +++WA  T VLG ++ GIW    D  DINA   + +  ++A GDDFG V LF+YP     A    Y GHS+HVTNV +  D   LIS GG D SI QW L
Sbjct:   18 YVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANL-IVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVL--CVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQSEMEVPEAHGPVRTLAEGK----QEELFVGTTRNAVLQGSFSGTLKP--IVQGHTD-ELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHT--DGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQWAL 646          

HSP 2 Score: 368.237 bits (944), Expect = 2.154e-110
Identity = 229/615 (37.24%), Postives = 338/615 (54.96%), Query Frame = 3
Query: 2166 PSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVG--------REPTIHVWDTQTMKSV-SILKGEHERGVCAVDFS--SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWK---DNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGK-ILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS----HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            P + L+L+WV+GYRG DCR+N++ L +GEIV+  A+V ++ N+  + QR Y  HNDD+ CL +HP    IATG+V           P + VWD+ ++ ++ SI  G  +R V  V FS  + G  L +V   ++H+L VWDW+K ++LA  +   D +    + P   N +V  G   + FWT  G   T ++G F    K    LC A+  N  G   TG  SG +YIW    + I Q     HEGG +++  L  G +   GGKD  + L D  + K  +S    PE   P          +R++  GK + +   T+   +++ S  GT+  +VQGH + ELWGL VHP  +   T   D  + +W+ +  +H+ +  K ++ P R       G+ +AVG     +LVL   +   I+      E IS IK+SP  G YLAVGSHDNFV IYS       + R+  C G SS++THLDWST+ + ++ NSG  E L++EA  G + + +   +  + WA+ +CVLG +  GIWP   D TD+N+V  ++D  VLA GDDFG+V LF YP     A    Y GHS+HVTNV +LH++ +L+S GG DT+++ W
Sbjct:   49 PERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAEN--GDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHK--QSEMEVPEAHGP----------VRTLAEGKQEELFVGTTRNAVLQGSFSGTLKPIVQGHTD-ELWGLDVHPGADQFVTCGQDKQVHLWDTD--SHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSP-DGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSG-KHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 644          

HSP 3 Score: 287.345 bits (734), Expect = 1.467e-82
Identity = 209/655 (31.91%), Postives = 326/655 (49.77%), Query Frame = 3
Query: 4326 NPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI--------PSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSG--VLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGK-ILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTT-GPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPV--PRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            N V     +L+L+ V+GYRG DCR+NL+ L      IVY  A+V +++N+   QQ  +L HNDD+ CL V  HP     +ATGQ+           P + VW+S+    L ++  GV    +  + FS +  G  L +V   NDH ++VW W+    LA        +  A F P   ++ V  G  H+ FWT+ GS L  ++G     F    +   +L VAF  N    TG  +G++++W  G   ++++V  AH G +F +   L DG +VSGG   GKD   + LWD E  +               SE   P   ++   +R+++  K + + +GT  N +L+     GT+K ++Q H +  L GL VHP   Q+ +  +D  V +WD ++   + S T   P   V + P+G  L +G  +  + VL   +  L+    D  + I+ IK+SP+ + +AVGS+DN V IY +   G                 SR   C    S    +D+ST+  +I     DY++  +  S+G+ V   + +  + W + + V+G  V GIWPD +D  D+N    S+       GDD+G V L+S +P   PR       P+ V+ GHSS+VTNV F++D+SHL+STGG+D  +  W
Sbjct:   44 NKVALPERKLKLQWVYGYRGRDCRSNLYLLPT--GEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAV--HPDMV-TIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGL----FEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSV-CVLKDGRLVSGG---GKDR-KVVLWDHEYHKQ--------------SEMEVP---EAHGPVRTLAEGKQEELFVGTTRNAVLQ-GSFSGTLKPIVQGHTD-ELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENG--------------RKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFS-YPCSQPRA------PSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 644          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 392.119 bits (1006), Expect = 6.588e-117
Identity = 235/641 (36.66%), Postives = 363/641 (56.63%), Query Frame = 3
Query:   93 YGKFFSLAE*IQMIIVNEFQI-FEMSNKLA-PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQV------GK--SPFICIWNSNSLET-KSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT--RDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATAS---FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            Y + F     + M I ++ +  + + NK+A P  +L L WVYGYRG  C +NL+   + +IVYF A + ++Y++ +++Q +Y  HNDD+  +A+  D   +ATGQV      GK  +P + +W+S SL T  SI        ++ VAFSK+  G +L +V    +  L+VWDW+K K L+  +  +D V  A F   +  +  VTCG  H+ FW++ G+TL+ ++G++ K  + + +L  C++ ++N    +G  +G++YIW +  N + +V+A  H G ++S+     G +   GGKD  VVL D E+   + +++   +     L       L     VGT  + +++   S   KP  ++ GH   ELW L VHP    F T   D  + +W  +  +PL +  I+   RS GF+  G+++A+G M   + V+ T  RD+I +H   D  E++  +K+SPDG +LAVGS+DNFV IY  T +   + R G C G+SSF+THLDWS +S YI TNSG  E+L ++A  G+H+T   ++ +++WA  T VLG ++ GIW    D  DINA   + +  ++A GDDFG V LF+YP     A    Y GHS+HVTNV +  D   LIS GG D SI QW L
Sbjct:  155 YVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANL-IVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVL--CVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQSEMEVPEAHGPVRTLAEGKQEEL----FVGTTRNAVLQGSFSGTLKP--IVQGHT-DELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHT--DGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQWAL 783          

HSP 2 Score: 370.163 bits (949), Expect = 1.808e-109
Identity = 229/616 (37.18%), Postives = 338/616 (54.87%), Query Frame = 3
Query: 2166 PSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVG--------REPTIHVWDTQTMKSV-SILKGEHERGVCAVDFSSD--GKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWK---DNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCDETFTKVHKSYKLS-PENLQPPQMLSSACPTIRSVVLGKGK-ILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS----HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            P + L+L+WV+GYRG DCR+N++ L +GEIV+  A+V ++ N+  + QR Y  HNDD+ CL +HP    IATG+V           P + VWD+ ++ ++ SI  G  +R V  V FS    G  L +V   ++H+L VWDW+K ++LA  +   D +    + P   N +V  G   + FWT  G   T ++G F    K    LC A+  N  G   TG  SG +YIW    + I Q     HEGG +++  L  G +   GGKD  + L D  +   HK  ++  PE   P          +R++  GK + +   T+   +++ S  GT+  +VQGH + ELWGL VHP  +   T   D  + +W+ +  +H+ +  K ++ P R       G+ +AVG     +LVL   +   I+      E IS IK+SP  G YLAVGSHDNFV IYS       + R+  C G SS++THLDWST+ + ++ NSG  E L++EA  G + + +   +  + WA+ +CVLG +  GIWP   D TD+N+V  ++D  VLA GDDFG+V LF YP     A    Y GHS+HVTNV +LH++ +L+S GG DT+++ W
Sbjct:  186 PERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAEN--GDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEY---HKQSEMEVPEAHGP----------VRTLAEGKQEELFVGTTRNAVLQGSFSGTLKPIVQGHTD-ELWGLDVHPGADQFVTCGQDKQVHLWDTD--SHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSP-DGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSG-KHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 781          

HSP 3 Score: 288.5 bits (737), Expect = 1.211e-81
Identity = 207/654 (31.65%), Postives = 323/654 (49.39%), Query Frame = 3
Query: 4326 NPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAI--------PSIHVWNSLDCTKLSTL-KGVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSG--VLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLT-TGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPV--PRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            N V     +L+L+ V+GYRG DCR+NL+ L      IVY  A+V +++N+   QQ  +L HNDD+ CL V  HP     +ATGQ+           P + VW+S+    L ++  GV    +  + FS +  G  L +V   NDH ++VW W+    LA        +  A F P   ++ V  G  H+ FWT+ GS L  ++G     F    +   +L VAF  N    TG  +G++++W  G   ++++V  AH G +F +   L DG +VSGG   GKD   + LWD E      ++   ++ V       + L +   E          ++ +GT  N +L+     GT+K ++Q H +  L GL VHP   Q+ +  +D  V +WD ++   + S T   P   V + P+G  L +G  +  + VL   +  L+    D  + I+ IK+SP+ + +AVGS+DN V IY +   G                 SR   C    S    +D+ST+  +I     DY++  +  S+G+ V   + +  + W + + V+G  V GIWPD +D  D+N    S+       GDD+G V L+S +P   PR       P+ V+ GHSS+VTNV F++D+SHL+STGG+D  +  W
Sbjct:  181 NKVALPERKLKLQWVYGYRGRDCRSNLYLLPT--GEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAV--HPDMV-TIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGL----FEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSV-CVLKDGRLVSGG---GKDR-KVVLWDHE------YHKQSEMEVPEAHGPVRTLAEGKQE----------ELFVGTTRNAVLQ-GSFSGTLKPIVQGHTD-ELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENG--------------RKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFS-YPCSQPRA------PSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 781          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006396.1 (pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene:ENSPMAG00000005778.1 transcript:ENSPMAT00000006396.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.872 bits (847), Expect = 4.668e-103
Identity = 154/282 (54.61%), Postives = 201/282 (71.28%), Query Frame = 3
Query: 3108 TINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKH 3953
            ++N   QGH + E+WGLA HP   ICA+VSDD  L +W++   NH ++ ++KL    RCC  S DG A+AVG  DGSFLV++  +L ++ S  HR+E I+DIKFSP PGKYLAV SHD FVD+Y  +S +R+  CKG S  +THLDW T GKL+ VN+ A+EQLF+EAPRG RQ I   E E++ +ASW+CVLG +C G+W    D  DVN+ SL+ D  +LAT DDFG +KLF+YP K  +A+ KQY+GHS  V NVRW ++D  LLSVGGADTAL++W H
Sbjct:    1 SLNTGPQGHMQSEVWGLAAHPHLPICASVSDDKTLRVWDLS-DNHCMLAVRKLNDSGRCCCFSSDGKALAVGLNDGSFLVVNANTLEDMLSFQHRREMITDIKFSPDPGKYLAVASHDGFVDVYRVLSSKRVGTCKGASGCVTHLDWDTKGKLIQVNTSAREQLFYEAPRGKRQNIHPHEAERLEFASWTCVLGPTCEGVWAAHSDGADVNAASLSRDRSILATADDFGFIKLFQYPVKGAYARCKQYVGHSGQVANVRWAYDDSLLLSVGGADTALVLWSH 281          

HSP 2 Score: 222.246 bits (565), Expect = 3.502e-65
Identity = 110/276 (39.86%), Postives = 167/276 (60.51%), Query Frame = 3
Query: 1134 GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGE----HITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW 1943
            GH   E+W L  HP   I A+ SDD +LR+W +++   +  +R ++   R C F+ DG  +A+G+ DGSF V+    + ++ + Q R+E++ ++KFSPD G +LAV S+D FVD+Y   +S KR G CKG S  +THLDW      I+ N+ A E L ++AP G+    H  + + L    W   T VLG   +G+WA ++D  D+NAA ++ + +++AT DDFG +KLF YP     A  ++Y GHS  V NVRW++D   L+S+GG D ++  W
Sbjct:    8 GHMQSEVWGLAAHPHLPICASVSDDKTLRVWDLSDNHCMLAVRKLNDSGRCCCFSSDGKALAVGLNDGSFLVVNANTLEDMLSFQHRREMITDIKFSPDPGKYLAVASHDGFVDVYRVLSS-KRVGTCKGASGCVTHLDWDTKGKLIQVNTSAREQLFYEAPRGKRQNIHPHEAERLEFASW---TCVLGPTCEGVWAAHSDGADVNAASLSRDRSILATADDFGFIKLFQYPVKGAYARCKQYVGHSGQVANVRWAYDDSLLLSVGGADTALVLW 279          

HSP 3 Score: 142.895 bits (359), Expect = 9.664e-38
Identity = 97/296 (32.77%), Postives = 144/296 (48.65%), Query Frame = 3
Query: 5364 QAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK--MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPN-SSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVN-EPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            Q H +  + GLA HP LP  +S S+D T+R+WDL     ML          C  +S +G  L +GL  G+F V++A +   ++  + R + ITDIKFSP+    +AV S+D  VD+Y+                  V++  R   CK        +D+ T G  I+      +   Y    G+  N  P + E++ + SW+ V+G    G+W   SD ADVN A +S   +   T DD+G +KL+  +PV      A      + GHS  V NVR+  DDS L+S GG D  + +W
Sbjct:    7 QGHMQSEVWGLAAHPHLPICASVSDDKTLRVWDLSDNHCMLAVRKLNDSGRCCCFSSDGKALAVGLNDGSFLVVNANTLEDMLSFQHRREMITDIKFSPDPGKYLAVASHDGFVDVYR------------------VLSSKRVGTCKGASGCVTHLDWDTKGKLIQVNTSAREQLFYEAPRGKRQNIHPHEAERLEFASWTCVLGPTCEGVWAAHSDGADVNAASLSRDRSILATADDFGFIKLF-QYPV----KGAYARCKQYVGHSGQVANVRWAYDDSLLLSVGGADTALVLW 279          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 337.035 bits (863), Expect = 2.662e-100
Identity = 208/616 (33.77%), Postives = 330/616 (53.57%), Query Frame = 3
Query: 2166 PSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEV------GREPTIH--VWDTQTMKSVSILKGE-HERGVCAVDFSSDGKKLASVGLDDNH--LLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD----NILQSAVMMHEGGCYAI-DALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK-GKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS----HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            P++ L LEW +GYRG DCR N+  L SGE+VF VAAVG++ ++ S  QR Y  H+DDI C+ +HP K ++ATG+V      G+    H  VW + +++++ ++ G   +RGV  + FS  G       +DD +  ++ VW+W+K  K+  ++   + ++   + P   N +V  G   I FW   G   + K+G F    K    LC  Y  N   V  +G  SG +Y+W       I ++   +H  G  A+ +  D  F++GG+DG +   D    K  +S        + P+ L     T+RS+  G  G     T+   I++ S  G  + +VQGH + ELWGLAVH +++   T + D   ++W    + H+   +K LK P +  D    G  VA+G +  S+LVL L +  E+       E+I+ +++SP  G +LAVGS+DNF+ +YS       +  +  C G SS++THLDWST+G+ LM NSG  E L++  P   +Q+ A   +  + WA+ +CVLG S  G+W    D TD+N++  +  GK+   GDDFG+V+LF   +    +    Y GH +HVTNV +  +D ++ + GG D  ++ W+
Sbjct:   50 PAEKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAVHPDKVIVATGQVVGKSKDGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFWALDGRNLSKKQGIFEKHEKPKHVLCLIYLDNGDAV--SGDSSGNIYVWGKAGGYRITRAITGVHASGVMALCERADGTFISGGRDGHVVFWDSKMEKTGES--------RIPKDLG----TVRSLADGADGSFWVGTTENGILQGSAHGEFSPVVQGHTD-ELWGLAVHQNQDAFLTCAQDKQAILW--NSATHRPTWIKTLKDPLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQIAVMRYSP-DGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYW-TPANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWR 646          

HSP 2 Score: 309.301 bits (791), Expect = 7.708e-91
Identity = 199/620 (32.10%), Postives = 320/620 (51.61%), Query Frame = 3
Query:  156 FEMSNKLA-PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQV-GKS-------PFICIWNSNSLETKSILKDQ-HTHGISSVAFSKTGMYLLSVGLDP--NATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENN---LERVIATVH-SGALYSIESCASGYVTGGKDSCVVLHDPEFQPM--TRIDLKLTNIGYPNLIVRSVHWLSNNAL-VGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATAS---FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            +++  KL  P  +L+L+W YGYRG  C  N+    S ++V+FVA +G++  ++   Q +Y  H+DDI  +A+  D  +VATGQV GKS         + +W+S SLET  ++       G+  ++FS+ G   L   +D      ++VW+WKK   ++ ++  ++ V+ A F   +  +  VTCG  +I FW+L G  LS K+GI+ K  + + +L  C+   DN    SG  +G++Y+W +     + R I  VH SG +   E     +++GG+D  VV  D + +    +RI   L         VRS+   ++ +  VGT  + I++        P  ++ GH   ELW L VH  +  F T + D    +W      P     +   ++S  F+  G ++AIG    S+ V+  +   E+H+     E +  +++SPDG  LAVGSNDNF+ +Y  +     +   G C G+SSF+THLDWS +  ++ +NSG  E L +     + +T    +  ++WA  T VLG    G+W++  D  DINA   + +  L   GDDFG V+LF   +    +    Y GH +HVTNV +S D  F+ + GG D  + QWR+
Sbjct:   41 YKIGAKLELPAEKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAVHPDKVIVATGQVVGKSKDGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENV-IVTCGKNNINFWALDGRNLSKKQGIFEKHEKPKHVL--CLIYLDNGDAVSGDSSGNIYVWGKAGGYRITRAITGVHASGVMALCERADGTFISGGRDGHVVFWDSKMEKTGESRIPKDLGT-------VRSLADGADGSFWVGTTENGILQGSAHGEFSP--VVQGHTD-ELWGLAVHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKDPLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQIAVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYWTPANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWRV 647          

HSP 3 Score: 240.35 bits (612), Expect = 2.604e-67
Identity = 185/649 (28.51%), Postives = 315/649 (48.54%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQI-------GAIPS-IHVWNSLDCTKLSTLKG-VHINGICSLDFSSTGT--LLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW-KSG--VLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK--MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTG-GITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLY-SSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            +L L+  +GYRG DCR N+  L +    +V+  AAVG++ +++SG Q  +L H+DDI C+ V  HP  + +VATGQ+         +P+ + VW+S     L  + G V   G+  + FS  G   LL +V   N+  I+VW W+  T +  +    + ++ A+F P  +++ V  G  ++ FW L G  L  K+G     F    +   +L + +  N    +G  +G+++VW K+G   +TR +   H+  V  L     DG  +SGG++     G +  WD +M +     + +D+       T + L D +           G   +GT +N IL+     G    ++Q H +  L GLAVH     + + ++D    +W+  T     I++L   P    D+ P+G  + IG ++ ++ VL  ++ + L  +    +QI  +++SP+ S +AVGSNDN + +Y +   G    +   C   +S VT                +D+ST+G F+     DY+   ++ +  + V     +  + W + + V+G    G+W + +D  D+N    S      V GDD+G V+L+ SS   PR       P+  + GH S+VTNV F +DDS + +TGG+D  V  W+
Sbjct:   53 KLSLEWAYGYRGKDCRANVELLPS--GELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAV--HPD-KVIVATGQVVGKSKDGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFWALDGRNLSKKQGI----FEKHEKPKHVLCLIYLDNGDAVSGDSSGNIYVWGKAGGYRITRAITGVHASGVMAL-CERADGTFISGGRD-----GHVVFWDSKMEKTGESRIPKDLG------TVRSLADGA----------DGSFWVGTTENGILQ-GSAHGEFSPVVQGHTD-ELWGLAVHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKD-PLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQIAVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVT---------------HLDWSTNGEFLMSNSGDYETLYWTPANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRS------PSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWR 646          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002683.1 (pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene:ENSPMAG00000002451.1 transcript:ENSPMAT00000002683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 2.345e-50
Identity = 114/322 (35.40%), Postives = 165/322 (51.24%), Query Frame = 3
Query: 3129 GHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKG-----------------------------------------PARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS----HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSC---IGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            GH + ELWGL  HPS++   T S D  + +W+V   +H+LI  K ++                                           A+  D    G+ VAVG + G + VL   +   +       E +S +++SP  G  LA+GSH+NF+ +++       + RL  C G SS+ITHLDWS DG+ L+ NSG  E L++   R  RQ +    I  I WA+++CVLG      +G+WP   D TD+N+V    +  V+A  DDFG+V +F YP        + Y GHS+HVTNV +LH+D YLLS GG+DT++M WK
Sbjct:    1 GHTD-ELWGLECHPSRDRFFTCSYDKRVSMWDVH--SHRLIWSKSVEAVHLSALSPTSLHSSTCYNAAAHTLTCDKNIQTTHQREPPVEAAQSADFHPTGTVVAVGMQKGKWAVLDAETSDLVTLHTDGAELLSVMRYSP-DGSMLAIGSHENFIFLHAVSEDGRRYTRLGKCTGHSSFITHLDWSVDGEFLVSNSGDYEILYWN--RNCRQQLMADTIRDIEWATYTCVLGFHIYVHVGVWPDGSDGTDINAVCRAHNRAVVAVADDFGKVHIFVYPCSQPKVPSRIYSGHSSHVTNVAFLHDDSYLLSTGGSDTSVMQWK 316          

HSP 2 Score: 167.548 bits (423), Expect = 9.807e-46
Identity = 104/316 (32.91%), Postives = 160/316 (50.63%), Query Frame = 3
Query: 1149 ELWALGVHPKKSIFATGSDDCSLRIWQMNERE----------------PLT------------TLRIDKKIR-------------SCGFNHDGSLIAIGIMDGSFSVI--RTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATAS---FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQ---GIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            ELW L  HP +  F T S D  + +W ++                   P +            TL  DK I+             S  F+  G+++A+G+  G ++V+   T D++ +H   D  E+L  +++SPDG  LA+GS++NF+ ++  +     + R G C G+SSFITHLDWS+D  ++ +NSG  E+L +     + +     +  I+WA +T VLG  I    G+W   +D  DINA     N  ++A  DDFG V +F YP        R Y+GHS+HVTNV +  D  +L+S GG D S+ QW++
Sbjct:    5 ELWGLECHPSRDRFFTCSYDKRVSMWDVHSHRLIWSKSVEAVHLSALSPTSLHSSTCYNAAAHTLTCDKNIQTTHQREPPVEAAQSADFHPTGTVVAVGMQKGKWAVLDAETSDLVTLHT--DGAELLSVMRYSPDGSMLAIGSHENFIFLHAVSEDGRRYTRLGKCTGHSSFITHLDWSVDGEFLVSNSGDYEILYWNRNCRQQL-MADTIRDIEWATYTCVLGFHIYVHVGVWPDGSDGTDINAVCRAHNRAVVAVADDFGKVHIFVYPCSQPKVPSRIYSGHSSHVTNVAFLHDDSYLLSTGGSDTSVMQWKV 317          

HSP 3 Score: 117.857 bits (294), Expect = 9.528e-29
Identity = 87/332 (26.20%), Postives = 154/332 (46.39%), Query Frame = 3
Query: 5385 LCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQS-------------LTTGPATC-----------------------------VDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGG-ITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEV---AGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            L GL  HP   ++ + S D  V +WD+ +  LI S              +   +TC                              D+ P G  + +G++ G +AVL A++  L+    D  + ++ +++SP+ S++A+GS++N + ++ +   G   T    C   +S +T                +D+S DG F+     DY++  ++ +  Q +   + I  I W +++ V+G  +    G+WPD SD  D+N    +H        DD+G V ++  +P  +      +P+ ++ GHSS+VTNV F++DDS+L+STGG D  V  WK
Sbjct:    6 LWGLECHPSRDRFFTCSYDKRVSMWDVHSHRLIWSKSVEAVHLSALSPTSLHSSTCYNAAAHTLTCDKNIQTTHQREPPVEAAQSADFHPTGTVVAVGMQKGKWAVLDAETSDLVTLHTDGAELLSVMRYSPDGSMLAIGSHENFIFLHAVSEDGRRYTRLGKCTGHSSFIT---------------HLDWSVDGEFLVSNSGDYEILYWNRNCRQQL-MADTIRDIEWATYTCVLGFHIYVHVGVWPDGSDGTDINAVCRAHNRAVVAVADDFGKVHIFV-YPCSQ----PKVPSRIYSGHSSHVTNVAFLHDDSYLLSTGGSDTSVMQWK 316          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006636.1 (pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1 gene:ENSPMAG00000005975.1 transcript:ENSPMAT00000006636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 1.422e-40
Identity = 91/262 (34.73%), Postives = 150/262 (57.25%), Query Frame = 3
Query:   93 YGKFFSLAE*IQMIIVNEF-QIFEMSNKLAPNSQ-LTLDWVY-GYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASD------GELVATGQVGKS--PFICIWNSNSLETKSIL-KDQHTHGISSVAFSKTGMYLLSVGLDPNA-TLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW 839
            Y K +     I M +  +  + + +  KL P ++ L L+WVY GYRG  C NNL+   + ++VYF+A + ++Y  ++  Q +Y EHNDD+  +A+  D      G++V TG+ GK+    + +W+S SL+T  ++       GI  +AFSKT   LL    D N   L+VWDW++G  L+  +  ++ VF A F   D P   VTCG  H+ FW+L GN+LS K+GI+ K  + + +L  C++ ++N    +G  +G++++W
Sbjct:  179 YVKMYLRGRPITMYLPQDMVEDYRLDTKLEPPAEKLKLNWVYYGYRGKDCRNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAIHPDRITIATGQVVGTGKDGKTLPAHVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCGLLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMD-PRAIVTCGKSHVHFWTLEGNSLSKKQGIFEKHDKPKYVL--CVTFAENGDAITGDSSGNIFVW 437          

HSP 2 Score: 138.272 bits (347), Expect = 1.191e-34
Identity = 81/232 (34.91%), Postives = 130/232 (56.03%), Query Frame = 3
Query: 2160 KAPSQGLQLEWVH-GYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEV------GREPTIH--VWDTQTMKSVSIL-KGEHERGVCAVDFS-SDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIW 2822
            + P++ L+L WV+ GYRG DCRNN++ L +GE+V+ +A+V ++ +     QR Y  HNDD+ CL +HP +  IATG+V      G+    H  VWD+ ++K++ ++  G  ERG+  + FS ++   L +V   + H+L VWDW++G KLA  +   + +F   + P +   +V  G   + FWT  G   + K+G F    K    LC  +  N  G   TG  SG +++W
Sbjct:  208 EPPAEKLKLNWVYYGYRGKDCRNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAIHPDRITIATGQVVGTGKDGKTLPAHVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCGLLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFWTLEGNSLSKKQGIFEKHDKPKYVLCVTFAEN--GDAITGDSSGNIFVW 437          

HSP 3 Score: 137.117 bits (344), Expect = 3.742e-34
Identity = 83/229 (36.24%), Postives = 119/229 (51.97%), Query Frame = 3
Query: 4371 HGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQI-------GAIPS-IHVWNSLDCTKLSTL-KGVHINGICSLDFSSTGT-LLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSG 5027
            +GYRG DCRNNL+ L      +VY  A+V ++++ + G Q  +LEHNDD+ CL +  HP  R  +ATGQ+         +P+ + VW+S+    L  +  GV   GI  L FS T   LL +V   N+H ++VW W+ G  LA      + +F A+F P      V  G  HV FWTL G+ L  K+G     F    +   +L V F  N    TG  +G+++VW  G
Sbjct:  221 YGYRGKDCRNNLYLLPT--GEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAI--HPD-RITIATGQVVGTGKDGKTLPAHVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCGLLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFWTLEGNSLSKKQGI----FEKHDKPKYVLCVTFAENGDAITGDSSGNIFVWGRG 440          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009467.1 (pep scaffold:Pmarinus_7.0:GL478507:38111:45670:1 gene:ENSPMAG00000008564.1 transcript:ENSPMAT00000009467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 6.583e-18
Identity = 57/214 (26.64%), Postives = 100/214 (46.73%), Query Frame = 3
Query:  258 SEKIVYFVAG-IGIVYDIKQRKQFYYF-EHNDDIISIALASDGELVATGQVGKSPFICIWN---SNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLC---------GNTLSSKKGIYGKKGEIQTILTVC-MSISDNAVCYSGTLNGDVYIWRENNL 854
            +  IV + AG + ++ D    +Q +        I ++A + DG  +ATG+ G +P IC+W         + ++L   H HG++  AFS  G  L+SVG   +  +N+WDWK G ++++ +  S  V    F  S    + VT G++H++FW L          G  L  +  + G + E       C    +   + Y  TL+G + ++ E  +
Sbjct:   19 TSGIVAYAAGCVVVLLDPSTGEQRHIINPARKPITALAFSPDGAHLATGEAGAAPCICVWRLLLQGEWSSAAVLGVGHQHGVACTAFSPDGRLLVSVGRRHDQAVNLWDWKSGHLVATNKV-SSHVLALAF--SSCGSRLVTAGVRHVRFWYLPPPRDQAAINGAPLPGRAALLGLQREAVFCAVACGQGPACQNLTYCLTLSGCLCVFDEQRI 229          

HSP 2 Score: 67.0106 bits (162), Expect = 1.562e-11
Identity = 41/149 (27.52%), Postives = 69/149 (46.31%), Query Frame = 3
Query: 2244 SGEIVFHVAAVGIVMNIASKTQR-FYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTM---KSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFW 2678
            SG + +    V ++++ ++  QR         I  L   P    +ATGE G  P I VW         S ++L   H+ GV    FS DG+ L SVG   +  + +WDW+ G  +A+ +     +  + +     ++LV  G++ +RFW
Sbjct:   20 SGIVAYAAGCVVVLLDPSTGEQRHIINPARKPITALAFSPDGAHLATGEAGAAPCICVWRLLLQGEWSSAAVLGVGHQHGVACTAFSPDGRLLVSVGRRHDQAVNLWDWKSGHLVATNKV-SSHVLALAFS-SCGSRLVTAGVRHVRFW 166          

HSP 3 Score: 63.1586 bits (152), Expect = 2.315e-10
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = 3
Query: 4563 VATGQIGAIPSIHVWNSL---DCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTL 4874
            +ATG+ GA P I VW  L   + +  + L   H +G+    FS  G LL+SVG  +D  + +W W++G L+A  N  +  +    F     S  V  GV+HV+FW L
Sbjct:   64 LATGEAGAAPCICVWRLLLQGEWSSAAVLGVGHQHGVACTAFSPDGRLLVSVGRRHDQAVNLWDWKSGHLVAT-NKVSSHVLALAFS-SCGSRLVTAGVRHVRFWYL 168          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 53.1434 bits (126), Expect = 4.073e-7
Identity = 68/288 (23.61%), Postives = 118/288 (40.97%), Query Frame = 3
Query: 4647 VHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTY--TGAMNGSVWVWKS--GVLTRIVEK------AHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGK--ILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVH--PFLPQY---SSASEDGTVRIW 5459
            ++I  +C   FS  G  L + G + D  I +W  E   ++    GH Q I+  ++ P  D +    G + V+ W L       + G+       +  +TT   VA    D  Y   G+++ +V VW S  G L   ++        H   V+ +  T     +VSG  ++     S+KLW+ +   NK      +      S T +       + + S++  +    IL G++D  +L   +K G    ++Q H   V+     +  P  P+Y   ++ S D   RIW
Sbjct:  444 LYIRSVC---FSPDGKFL-ATGAE-DRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-------RTGQCSLTLSIEDGVTT---VAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDR-----SVKLWNLQNANNKSDSKTPN------SGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705          

HSP 2 Score: 50.447 bits (119), Expect = 2.995e-6
Identity = 70/285 (24.56%), Postives = 121/285 (42.46%), Query Frame = 3
Query:  486 ISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVT-CGIKHIKFWSL----CGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENN---LERVIA-----TVHSGALYSIESCASGY--VTGGKDSCVVL-------HDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNA--LVGTQGSDIIEIPVSTPNKPKSLMMGH-------AAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREP 1247
            I SV FS  G +L +   D    + +WD +  K++   + H   ++   +  S    K V+  G + ++ W L    C  TLS + G+           TV +S  D     +G+L+  V +W       +ER+ +     T H  ++YS+     G   V+G  D  V L       +  + +       ++T IG+ + ++ SV    N+   L G++   ++     + N P  ++ GH       A      LG  P+ ++FATGS DC  RIW+  +  P
Sbjct:  446 IRSVCFSPDGKFLATGAED--RLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGD--KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGV----------TTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVL-SVATTQNDEYILSGSKDRGVLFWDKKSGN-PLLMLQGHRNSVISVAVANGSPLG--PEYNVFATGSGDCKARIWKYKKIAP 712          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 52.7582 bits (125), Expect = 5.071e-7
Identity = 33/118 (27.97%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 2325 HNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFW 2678
            H   I  +  HP    I  G    + T  +WD  T + + + +G H++GV ++ F  DG  + S G+D   L ++WD R G K+ +   H   I+ + W P+        G   I  W
Sbjct:  264 HERRISDVKYHPSGKFI--GSASHDMTWRLWDASTHQELLLQEG-HDKGVFSLSFQCDGSLVCSGGMDS--LSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVW 376          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: CDC20 (Activator of anaphase-promoting complex/cyclosome (APC/C); APC/C is required for metaphase/anaphase transition; directs ubiquitination of mitotic cyclins, Pds1p, and other anaphase inhibitors; cell-cycle regulated; potential Cdc28p substrate; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003084])

HSP 1 Score: 51.2174 bits (121), Expect = 1.454e-6
Identity = 35/112 (31.25%), Postives = 53/112 (47.32%), Query Frame = 3
Query: 2361 LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGM---KFIRFWTQV 2687
            L  LIATG   R   I + D +  + +     EH   VC + + SDG +LAS G D+   +++WD R      S + H   +  + W P++ N L + G    K I FW  +
Sbjct:  353 LDTLIATG--SRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNT--VMIWDTRTSLPQFSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSI 460          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 51.6026 bits (122), Expect = 1.543e-6
Identity = 36/124 (29.03%), Postives = 58/124 (46.77%), Query Frame = 3
Query: 2310 RFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAH-KDKIFMIKWDPHNNNQLVAVGMKFIRFW 2678
            R +A H +D+ C+  HP    + TG   +  T  +WD  T  SV +  G H   V ++    DG+ L S G +D  ++ VWD   G++L   R H K+ I+ + +    N  +       +R W
Sbjct:  603 RIFAGHLNDVDCVSFHPNGCYVFTGSSDK--TCRMWDVSTGDSVRLFLG-HTAPVISIAVCPDGRWL-STGSEDG-IINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 346/662 (52.27%), Postives = 475/662 (71.75%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIK---FVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR-LTDAISGSGD-----INHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQK 2120
            M+ + AP+SQ+ L+WVYGYRGHQC NNL+YT S++IVYFVAG+G+VY+ ++  Q ++  H+DDIIS+AL  +  LVATGQVGK P+IC+W+S+S ET SILKD H  GI+ +AF+ +G YL+SVGL+    + VWDWK+GK L+STR H+DR+FD +F     P K    V+CG+KHI FW+L GN+L+ KKGI+GK GEIQT L  C++   + V YSGTL+G++Y W+  NL   I   H+GA++SI   A G+ +G KD  VVL D EF+P+ ++DL  T +GY  L +RSV WL    LVGT   ++ E+  +  +KP++++ GHA GELWAL  HPKK IFATGSDD S+R+W M ++  L    +D+K+RS  FN DG+ +A+G+ DGSF +++ RD+ EV    DRKEVLHE+K+SPDG +LAVGSNDNFVDIY     +K+ G CKG+SSFITHLDWS DS Y++TNSGAAE L ++ P G+ IT  + + SI WA +T V+GT++ GIW KY+DTND+NA D     N++ TGDDFGLVKLF +PS  KG+ FRKY GHSAHVTNVR+S D   +IS+GGGD ++FQWR L + I+   D     ++  +DS ++ SDS  SDI   +S++E E Q +Y+R + ++++  L++
Sbjct:    1 MTERTAPSSQIRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLALHPEKVLVATGQVGKDPYICVWDSHSTETVSILKDAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQF----NPYKENVLVSCGVKHIIFWTLRGNSLNPKKGIFGKTGEIQTNL--CLAFGSDDVTYSGTLSGEIYKWKGQNLAGAIPNAHTGAVFSIFGGADGFASGSKDGTVVLWDAEFKPIAKLDLINTRVGYEGLSIRSVCWLGEKILVGTNAGEVFEVMATDKDKPRTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSMADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAVAQKYKKVGECKGSSSFITHLDWSEDSKYLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQHNVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQWRFLPEGITDDHDDLPEAVSGYLDSDSEESDSEASDIDELDSDVENEQQIDYSRTIYREDLPALKE 656          

HSP 2 Score: 516.153 bits (1328), Expect = 1.067e-162
Identity = 288/672 (42.86%), Postives = 414/672 (61.61%), Query Frame = 3
Query: 2154 RKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAV-MMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHK----SYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIME-LSTD-GTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS-AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQS---------DLSDTDSEEENGFDSDVEREKSMDYIAKTYSERL 4118
             + APS  ++LEWV+GYRG+ CRNN++Y  S EIV+ VA VG+V N    TQRF+  H+DDI+ L LHP K L+ATG+VG++P I VWD+ + ++VSILK  H+RG+  + F+  G  L SVGL+D H++VVWDW++G++LASTR H D+IF ++++P+  N LV+ G+K I FWT  G     K+G FG   ++ T LC A+  +   V Y+G+ SG +Y WK   L  A+   H G  ++I     GF +G KDGT+ L D  F  + K    + ++  E L           +IRSV     KIL  T++GE+ E ++TD      +VQGH EGELW LA HP K I AT SDD  + +W +  ++  L+    +    R    + DG+ +AVG  DGSF++L    L E+   + RKE + ++K+SP  G++LAVGS+DNFVDIY+ A  ++++  CKG SS+ITHLDWS D K L  NSGA E+LF+  P G R I  K EI+ I WA+W+CV+G    GIW    D  DVN++       V+ TGDDFG VKLF++PS  K +KF++Y+GHSAHVTNVR+ ++   ++SVGG D A+  W+       L + I +   ++P++         + SD+++ + +  DSDVE E+ +DY    Y E L
Sbjct:    3 ERTAPSSQIRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLALHPEKVLVATGQVGKDPYICVWDSHSTETVSILKDAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKKGIFGKTGEIQTNLCLAFGSDD--VTYSGTLSGEIYKWKGQNLAGAIPNAHTGAVFSIFGGADGFASGSKDGTVVLWDAEFKPIAKLDLINTRVGYEGL-----------SIRSVCWLGEKILVGTNAGEVFEVMATDKDKPRTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSM--ADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYSP-DGQFLAVGSNDNFVDIYAVAQKYKKVGECKGSSSFITHLDWSEDSKYLQTNSGAAERLFYRMPTGKR-ITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQHNVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQWRF------LPEGITDDHDDLPEAVSGYLDSDSEESDSEASDIDELDSDVENEQQIDYSRTIYREDL 651          

HSP 3 Score: 362.459 bits (929), Expect = 1.150e-108
Identity = 232/641 (36.19%), Postives = 348/641 (54.29%), Query Frame = 3
Query: 4347 TQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVR-GFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILE-KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK-MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLP 6260
            +Q+ L+ V+GYRG  CRNNL+Y  ++   IVY  A VG+V+N +   Q FFL H+DDI+ L +  HP+ + +VATGQ+G  P I VW+S     +S LK  H  GI  L F+ +G  L+SVG+++ H + VW W+ G  LA   GHT RIF  +F P  +++ V+ GVKH+ FWTL G+ L  K+G     F     + T L +AF ++D TY+G ++G ++ WK   L   +  AH+G VF +F    DG   SG K+     G++ LWD E    KP    + IN R G+   +          IRS+  +  KIL+GT   ++ E++   +   + ++Q H EG L  LA HP    +++ S+D +VR+W +  K +L ++        V ++ +G +L +GL  G+F +L A+    + R  DR + + ++K+SP+   +AVGSNDN VDIY +           C+  +S +T                +D+S D  +++      +   Y   TG+ +   E+I+ I W +W+ VVG EV GIW   SD  DVN      Q N  VTGDD+GLVKL   F  P +   +     V  GHS++VTNVRF ND + ++S GG D  VF W+   +LP
Sbjct:    9 SQIRLEWVYGYRGHQCRNNLYYTASK--EIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLAL--HPE-KVLVATGQVGKDPYICVWDSHSTETVSILKDAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKKGI----FGKTGEIQTNLCLAFGSDDVTYSGTLSGEIYKWKGQNLAGAIPNAHTGAVFSIFGG-ADGF-ASGSKD-----GTVVLWDAEF---KPIAKLDLINTRVGYEGLS----------IRSVCWLGEKILVGTNAGEVFEVMATDKDKPRTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSMADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAVAQK--YKKVGECKGSSSFIT---------------HLDWSEDSKYLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQHNVMVTGDDFGLVKL---FKFPSVRKGSKFRKYV--GHSAHVTNVRFSNDFNRVISVGGGDHAVFQWR---FLP 595          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO42394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N5])

HSP 1 Score: 276.174 bits (705), Expect = 7.069e-80
Identity = 181/570 (31.75%), Postives = 292/570 (51.23%), Query Frame = 3
Query:  165 SNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGK------SPFICIWNSNSLETKSILKDQH-THGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFM---VSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHD--PEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEI-PVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNER-----EPLTTLRIDKKIRSCGFN--HDGSLIAIGIMDGSFSVIRTRDMIEVH-NAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY---DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGD 1781
            +N   P+ +L L+WVYGYRG  C NNL   N + ++ YF A I ++Y++K+  Q +Y +H DD+ S+A+  DG  +A+GQV         P   IW+   LET +++   H    ++S+AFSK   G Y++SV  D   T+ VWDW++ K+++S R H D+V  A F    +++G +  V+CG +H+ FW++    L   +G +     ++ +   C++ + N    +G  NG +Y+WRE  N +   +   H G +Y++    +G +   GGKD  V   +   E  P T ++L+    G   L        SN   +GT  + I  + P+      KSL     +  L  L  HP +  F T   D ++R+W   +       P    R DKK+  C  +       IA+G  DGSF +   +    +    +  +E + +LK+SPDG  LAV S+DN + +Y   +   S +  G C+G++S++TH DWS+ S +I++ SG  ELL + A   E I   + + + +WA    VLG     IW K  D  DIN+ D + +  L+ATG+
Sbjct:   29 TNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGEPHFRIWDVVRLETIAVIGLGHFGRAVNSLAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDH--HVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSP-TGVELRYGVTGIRTLAFDD----SNTLYIGTTDNCIWTVRPIPFTLHLKSLSFQGHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNR-DKKLIPCAVSVSSTADTIAVGYKDGSFGIFNVKSGEPIFFKKRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLG--YPXIWPKKADGTDINSVDRSHSRTLLATGE 588          

HSP 2 Score: 251.136 bits (640), Expect = 2.473e-71
Identity = 192/584 (32.88%), Postives = 287/584 (49.14%), Query Frame = 3
Query: 2166 PSQGLQLEWVHGYRGYDCRNNIFYL-QSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATG------EVGREPTIHVWDTQTMKSVSILK-GEHERGVCAVDFSSD--GKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQ----LVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD---NILQSAVMMHEGGCYAIDALDKG--FVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTI-------------NILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKL------KKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHR--KEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGD 3785
            P Q L LEWV+GYRG DCRNN+  + ++GE+ +  AA+ ++ N+   TQR Y  H DD+  L +HP    IA+G      EV  EP   +WD   +++++++  G   R V ++ FS    G+ + SV  DD H + VWDW + + +AS R H D++ +  + P   N+    LV+ G + + FW    G     RG F +  K     C  +  N  G   TG  +G +Y+W++    I  S    H+G  YA+  L  G     GGKDGT++  +          +LSP  ++           +R  V G  + LA   S  +   +TD  I             ++  QGH +  L GLA HPS+    T   D  + +W     + +L +       KKL   A    +S     +AVG+KDGSF + ++ S GE      R  +E+ISD+K+SP  GK LAV SHDN + +Y+      S +    C+G +SY+TH DWS     +   SG  E LF++A +   QI    ++    WA+ +CVLG     IWP K D TD+NSV  +    +LATG+
Sbjct:   34 PDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGEPHFRIWDVVRLETIAVIGLGHFGRAVNSLAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARN--GDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNM-------KELSPTGVE-----------LRYGVTGI-RTLAFDDSNTLYIGTTDNCIWTVRPIPFTLHLKSLSFQGHSD-SLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCA--VSVSSTADTIAVGYKDGSFGIFNVKS-GEPIFFKKRCAQEKISDLKYSPD-GKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKK-CEQIKLAKDMRNTEWATQNCVLGYP--XIWPKKADGTDINSVDRSHSRTLLATGE 588          

HSP 3 Score: 206.453 bits (524), Expect = 4.060e-56
Identity = 177/611 (28.97%), Postives = 287/611 (46.97%), Query Frame = 3
Query: 4323 PNPVIEKVTQ-LELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGA------IPSIHVWNSLDCTKLSTLKGVHI-NGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRP----DSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGV--LTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKIL-LGTQDNDILEILEKQGT--VKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPA---------TCVDYSPNGNYLVIGLKSGAFAVLSAQSYR-LLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTG-GITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGD 6062
            PN   +K  Q L L+ V+GYRG DCRNNL  ++  G  + Y  AA+ +++NL+   Q  + +H DD+  L V  HP  R  +A+GQ+         P   +W+ +    ++ +   H    + SL FS    G  ++SV  D+ HTI VW WE   ++A A GH  ++ +A F P    +     V+ G +HV FW +    L   RGR   D   +P   + L+  F  N    TG  NG+++VW+ G   ++  V  AH GPV+ L   L +G ++SGG   GKD G+++ W+               N++  S T   L    +  IR+++      L +GT DN I  +     T  +K L  Q H +  L GLA HP  P++ +A  D TVR+W+     +   L   PA           V  S   + + +G K G+F + + +S   +  +K+   ++I+D+K+SP+   +AV S+DN + +Y L++ G  +     C+   S VT                 D+S   +FI+    DY++  +     + +   + +    W + + V+G     IWP K+D  D+N+   SH      TG+
Sbjct:   27 PNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGE-LAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAV--HPDGR-TIASGQVAGHEEVQGEPHFRIWDVVRLETIAVIGLGHFGRAVNSLAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRF--DHHVKPLYISCLT--FARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALL-VLPNGDLLSGG---GKD-GTVRAWN---------------NMKELSPTGVELR-YGVTGIRTLAFDDSNTLYIGTTDNCIWTVRPIPFTLHLKSLSFQGHSDS-LQGLAAHPSEPKFFTAGSDMTVRVWNSADHSV--QLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGSFGIFNVKSGEPIFFKKRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVT---------------HFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLG--YPXIWPKKADGTDINSVDRSHSRTLLATGE 588          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO31013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ48])

HSP 1 Score: 225.328 bits (573), Expect = 9.642e-63
Identity = 163/569 (28.65%), Postives = 264/569 (46.40%), Query Frame = 3
Query:  165 SNKLAPNSQLTLDWVYGYRGHQCHNNLFYTN-SEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKV--------------LSSTRAHSDRVFDARFM---VSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHD--PEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEI-PVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDR--KEVLHELKFSPDGHWLAVGSNDNFVDIY---DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGD 1781
            +N   P+ +L L+WVYGYRG  C NNL   N + ++ YF A I ++Y++K+  Q +Y +H DD+ S+A+  DG  +A+GQV     +            ++ + H      +       + L+ G      LN     +G +              +     H D+V  A F    +++G +  V+CG +H+ FW++    L   +G +     ++ +   C++ + N    +G  NG +Y+WRE  N +   +   H G +Y++    +G +   GGKD  V   +   E  P T ++L+    G   L        SN   +GT  + I  + P+      KSL     +  L  L  HP +  F T   D ++R+W   +          +  R    N D  LI   +     SV  T D I V     R  +E + +LK+SPDG  LAV S+DN + +Y   +   S +  G C+G++S++TH DWS+ S +I++ SG  ELL + A   E I   + + + +WA    VLG  + GIW K  D  DIN+ D + +  L+ATGD
Sbjct:   29 TNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEV---------QGELMVNHHYLTQDHMDQLMVNHHYLTYGHTDQLILNHHYLTQGHMDQLMVYHHYLTQDHMDQLMGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDH--HVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSP-TGVELRYGVTGIRTLAFDD----SNTLYIGTTDNCIWTVRPIPLTLHLKSLSSQGHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSV-------QLFRPPADNRDKKLIPCAV-----SVSSTADTIAVGYKDGRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPVLGIWPKKADGTDINSVDRSHSRTLLATGD 569          

HSP 2 Score: 201.83 bits (512), Expect = 1.063e-54
Identity = 172/578 (29.76%), Postives = 260/578 (44.98%), Query Frame = 3
Query: 2166 PSQGLQLEWVHGYRGYDCRNNIFYL-QSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTI-------HVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQ----LVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD---NILQSAVMMHEGGCYAIDALDKG--FVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTI-------------NILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARC--CDISCDGSA--VAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGD 3785
            P Q L LEWV+GYRG DCRNN+  + ++GE+ +  AA+ ++ N+   TQR Y  H DD+  L +HP    IA+G+V     +       H + TQ      ++   H       D         + G  D  L+V   +   + +     H D++ +  + P   N+    LV+ G + + FW    G     RG F +  K     C  +  N  G   TG  +G +Y+W++    I  S    H+G  YA+  L  G     GGKDGT++  +          +LSP  ++           +R  V G  + LA   S  +   +TD  I             ++  QGH +  L GLA HPS+    T   D  + +W     + +L +        +   C +S   +A  +AVG+KDG                   +E+ISD+K+SP  GK LAV SHDN + +Y+      S +    C+G +SY+TH DWS     +   SG  E LF++A +   QI    ++    WA+ +CVLG   +GIWP K D TD+NSV  +    +LATGD
Sbjct:   34 PDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGELMVNHHYLTQDHMD-QLMVNHHYLTYGHTDQLILNHHYLTQGHMDQ-LMVYHHYLTQDHMDQLMGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARN--GDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNM-------KELSPTGVE-----------LRYGVTGI-RTLAFDDSNTLYIGTTDNCIWTVRPIPLTLHLKSLSSQGHSD-SLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGRCA----------------QEKISDLKYSPD-GKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKK-CEQIKLAKDMRNTEWATQNCVLGYPVLGIWPKKADGTDINSVDRSHSRTLLATGD 569          

HSP 3 Score: 163.31 bits (412), Expect = 8.498e-42
Identity = 164/606 (27.06%), Postives = 267/606 (44.06%), Query Frame = 3
Query: 4323 PNPVIEKVTQ-LELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLST--LKGVHINGICSLDFSSTGTLLLS----VGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRP----DSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGV--LTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKIL-LGTQDNDILEILEKQGTV--KYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPA---------TCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTG-GITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGD 6062
            PN   +K  Q L L+ V+GYRG DCRNNL  ++  G  + Y  AA+ +++NL+   Q  + +H DD+  L V  HP  R  +A+GQ+     +     ++   L+   +  + +N    L +  T  L+L+         D  +    + T   + +  GH  ++ +A F P    +     V+ G +HV FW +    L   RGR   D   +P   + L+  F  N    TG  NG+++VW+ G   ++  V  AH GPV+ L   L +G ++SGG   GKD G+++ W+               N++  S T   L    +  IR+++      L +GT DN I  +     T+  K L        L GLA HP  P++ +A  D TVR+W+     +   L   PA           V  S   + + +G K G  A                 ++I+D+K+SP+   +AV S+DN + +Y L++ G  +     C+   S VT                 D+S   +FI+    DY++  +     + +   + +    W + + V+G  V GIWP K+D  D+N+   SH      TGD
Sbjct:   27 PNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGE-LAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAV--HPDGR-TIASGQVAGHEEVQGELMVNHHYLTQDHMDQLMVNH-HYLTYGHTDQLILNHHYLTQGHMDQLMVYHHYLTQDHMDQLMGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRF--DHHVKPLYISCLT--FARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLV-LPNGDLLSGG---GKD-GTVRAWN---------------NMKELSPTGVELR-YGVTGIRTLAFDDSNTLYIGTTDNCIWTVRPIPLTLHLKSLSSQGHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSV--QLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGRCA----------------QEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVT---------------HFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPVLGIWPKKADGTDINSVDRSHSRTLLATGD 569          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO49877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY9])

HSP 1 Score: 225.713 bits (574), Expect = 1.198e-62
Identity = 167/610 (27.38%), Postives = 298/610 (48.85%), Query Frame = 3
Query:  210 YGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVG-------KSPFICIWNSNSLETKSILK-DQHTHGISSVAFS--KTGMYLLSVGL-DPNATLNVWDWKKGKVLSSTRAH-SDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRE--NNLERVIATVHSGALYSIESCASGYV--TGGKDSCVV-----------LHDPEFQPMTR-IDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFV---DIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIW-AKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW 1943
            YGY+G Q   NL    S +I+YF++ I ++Y+ K   Q +Y  H DDI  +A+  +   +ATGQ         +   I +W++ +L T  +L  D ++  + ++AFS    G  L+ +   D +  LN+W+W+   +L+ ++      V D  F   D     V+CG +HI FW      L  K G Y +K  +   LT CM  + N    +G  +G V +W +    ++ V+   H  +++ +    +G +   GG D  V            LH+ + + +T+ I LK              H      LVGT  + I+E   ++   P  L+ GH+  E+ AL VHP K +F + S D    +W   + +   +  +   I+   F + GS++A+G   G + V+  +  + V + QD  E L ++++SP+G  +A+ S D  +    +YD   +++R G C  +++ +  LDWS+D  +I++ S   E + ++    +      ++   +W     VLG D+ G+W +  T+ N + ++D++ + +L+A GD+ G ++LF YP   +GA + +   HS  V  V +    KFL+S  G D+++ QW
Sbjct:    1 YGYQGTQ--RNLHVLPSGEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWYIATGQASGLSLDQNEMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSK-TIVSCGKEHIYFWRWHNGKLERKNG-YFEKYPVPQYLT-CMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVDGRVCAWDSNKYFTTPLHEAQVRQLTQQIRLKF-------------HSDDVTLLVGTTANKILEGSFTSDFIP--LVKGHS-DEVPALAVHPSKDLFISASMDKFAYLWSAKDHKTAWSTDVGFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEPLTDIEYSPEGEHVAIASKDGNIYVHSVYDDGMTYRRVGCCSNHTAPVMFLDWSVDGCFIQSISTEYEHITWEIGAFQREESQNVIRDTEWNTRNVVLGYDVAGVWRSTPTEENLVTSSDLSWSHDLLAVGDELGYIRLFRYPCCIEGAQYHQVRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          

HSP 2 Score: 200.29 bits (508), Expect = 5.523e-54
Identity = 166/608 (27.30%), Postives = 283/608 (46.55%), Query Frame = 3
Query: 2196 HGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVG-------REPTIHVWDTQTMKSVSILK-GEHERGVCAVDFS--SDGKKLASVGL-DDNHLLVVWDWRKGEKLASTRAH-KDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIW---KDNILQSAVMMHEGGCYAIDALDKG--FVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIW---PPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            +GY+G   + N+  L SGEI++ ++ + ++ N  S  QR Y  H DDI C+ +HP +  IATG+             I +WD +T+ ++ +L   ++   V  + FS   +GK+L  +   DD+  L +W+W     L  ++   +  +  I +DP ++  +V+ G + I FW    G    K G F          C  + PN  G   TG  SG V +W      I       HE   + +  L  G     GG DG +   D      +K +       Q  Q+         S       +L  T++ +I+E S       LV+GH + E+  LAVHPSK++  + S D +  +W  +  +HK      +    +C      GS VA+G   G ++VL   +   + S     E ++DI++SP  G+++A+ S D  + ++S     ++++R+  C   ++ +  LDWS DG  +   S   E + +E     R+  ++  I    W + + VLG    G+W   P + ++   + +S + D  +LA GD+ G ++LF YP   + A++ Q   HS  V  V +L +D++LLS  G D A++ W
Sbjct:    1 YGYQG--TQRNLHVLPSGEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWYIATGQASGLSLDQNEMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHNGKLERKNGYFEKYPVPQYLTCMDFAPN--GDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVDGRVCAWDS-----NKYFTTPLHEAQVRQLTQQIRLKFHS---DDVTLLVGTTANKILEGSFTSDFIPLVKGHSD-EVPALAVHPSKDLFISASMDKFAYLWSAK--DHKTAWSTDVGFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEPLTDIEYSPE-GEHVAIASKDGNIYVHSVYDDGMTYRRVGCCSNHTAPVMFLDWSVDGCFIQSISTEYEHITWEIGAFQREE-SQNVIRDTEWNTRNVVLGYDVAGVWRSTPTEENLVTSSDLSWSHD--LLAVGDELGYIRLFRYPCCIEGAQYHQVRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          

HSP 3 Score: 153.295 bits (386), Expect = 2.324e-38
Identity = 163/646 (25.23%), Postives = 273/646 (42.26%), Query Frame = 3
Query: 4371 HGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSL------DFS-STGTLLLSV-----------GIDNDHTIAVWKWETGTLLAKANGHTQRIFL-AEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWK--SGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKAD-VNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            +GY+G   + NLH L +    I+Y  + + +++N +S  Q  +  H DDI C+ V+ +  Y   +ATGQ   +       SLD  ++S ++      + +L      D+S S  TL  SV             D+   + +W+WE  +LL ++    Q   L   F PD     V+ G +H+ FW     +L  K G     F   P    +  + F  N    TG  +G+V VW   S  +  +V  AH   +F L       L+ +GG +     G +  WD       P + A+   VR  ++  + L+  S +V   +     KIL G+  +D +           L++ H + V   LAVHP    + SAS D    +W  +      S   G +  C  +   G+ + +G   G + VL  Q+   +   +D  + +TDI++SP    +A+ S D  + ++ +   G              +T  R   C +  +P + +D+S DG FI+    +Y+   +     Q       I    W + + V+G +VAG+W     + + V ++ +S   +    GD+ G ++L   F  P     A       R HS +V  V F+  D  L+ST G+D  V  W
Sbjct:    1 YGYQG--TQRNLHVLPS--GEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWY---IATGQASGL-------SLDQNEMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHNGKLERKNGY----FEKYPVPQYLTCMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVD-----GRVCAWDSNKYFTTPLHEAQ---VRQLTQQIR-LKFHSDDVTLLVGTTANKILEGSFTSDFIP----------LVKGHSDEVP-ALAVHPSKDLFISASMDKFAYLWSAKDHKTAWSTDVGFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEPLTDIEYSPEGEHVAIASKDGNIYVHSVYDDG--------------MTYRRVGCCSNHTAPVMFLDWSVDGCFIQSISTEYEHITWEIGAFQREESQNVIRDTEWNTRNVVLGYDVAGVWRSTPTEENLVTSSDLSWSHDLLAVGDELGYIRL---FRYPCCIEGAQYHQ--VRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO36068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM7])

HSP 1 Score: 93.9745 bits (232), Expect = 4.627e-19
Identity = 129/624 (20.67%), Postives = 251/624 (40.22%), Query Frame = 3
Query: 2295 ASKTQRFYASHNDDI--LCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGV--CAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDK---IFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQ--LCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYA----------------------------IDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQP-------PQMLSSACPTIRSVVLGKGKILASTSSGEI--MELSTD-------GTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDG----SFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLM---VNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWA---SWSCVLG---------DSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            A K+QRF    +  +    + + P +  +A  E G + TI ++D  T++   +L     +     ++ FS D K L S     +  L+ W W K + +A T++   +   ++ + ++P +N QL  VG    + +      ++          K++ Q  LC A+  ++  +  TG+ +G + +++   L++   +  GG  A                            I A  KGF+  G  GT+ L ++   K   +YK S E   P       PQM+ S      +V   +  ++ STS+ ++  + LST         T  +L Q    G + G+ V   K + AT S D  + IW  E  +  L   K+ +       +   G  + VGF D     + L+  +    E      R+   S+       G +L    H N + +YS+ + + +   KG +  +  + WS D   ++   ++    E   +   R    ++       +  +     +  +G         DS I    P  D+     V ++  G++L  G   G ++  ++P  T   +++++  H+  +  +R  ++D+YL +    D +L ++K
Sbjct:   16 ADKSQRFIPGSDKSVGMTAMAVSPNRRYVAIAEKGEKATITIYDLHTLRKKKVLSHPEVQSAEFVSLAFSPDSKYLVSQSGRPDWTLLYWTWEKAKVMAFTKSSNQQDSAVYQVSFNPQDNTQLCVVGNGIFKLF-----RYSEGNLKQFAFQKMEPQNFLCHAWVSDERII--TGTDTGRLLLFESGELKNEFSVFGGGPSAPGTARQLSTAAIGADPSPTQTAYPQVTCIAAFSKGFICSGGAGTVHLFEKAEEK--DAYKKSREIRIPTDTTNPDPQMIESQEIKDLTVSPSEETLVCSTSTSQLYSITLSTADLGKGDLATFELLSQSFHHGVITGMDVCIRKPLIATCSLDRSVRIWNYETCS--LEAYKEFQEECYSIALHPSGLYILVGFSDKLRLMNLLIDDIRYFKEFTIRGCRECSFSN-------GGHLFAAVHGNVIQLYSSTTFENVGNLKGHNGKVRQVIWSQDDSKIISCGMDGAVYEWNVYNYKREGESVLKSCSYTSVTVSPDGRTTFAVGSDRTIKEICDSQILREVPASDMVLTQCV-MSRSGRMLFAGTASGTLRAMKFPL-TVPGEWQEHQVHAGSINKMRMSYDDQYLFT-ASEDGSLYIYK 618          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 1961.81 bits (5081), Expect = 0.000e+0
Identity = 986/2039 (48.36%), Postives = 1365/2039 (66.94%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDIN-----HQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQL--QKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL+    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H   ++S+ +C  G+ TGG+D CV L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSN+N VDIY     +K+ G C G++SFITH+DWS DS Y++TN G+   L ++ P G+ +T  + L  ++WA +T VLG ++ GIW KY+D NDIN+ D N +  ++ T DD+GLVKLF YP   KGA FRKY GHSAH+TN RWS D +++I+IGG D S+FQW+          ++        DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL  Q   K      KKR++AP+ G++L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+ ++HVWDT+T+K +S+LKG H+ GVCA+DFS+DG++L S+GLDDNH +V+WDWRKGE L++ R  KDKIF++K +P+  ++L+  G+K ++FW +         G  GN+ K +T +CA Y  ++  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KL+   RCC  S DG A+AVG  DGSF++++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKGC SYITHLDW   GKLL VN+ AKEQ FFEAPRG RQ I  +E+EKI W +W+CVLG S  G WP   ++T+V +  L++D +VLATGDD G VKLF YP+K K+AKFK+Y+ HS HVTNVRW HND  L++VGG DT LM+W H  + +        ++     S+ SD +SE++ G+DSDV RE  + Y  K  S   N +    +KP L  +  S +  +  VSR      K+Q        +  +G++ R                P+ + V +L    V GYRG DCRNN+HYL+ EG+ I+YH A+V IV NL +  QSF+LEH+DDILCLT+N+HPK+ NVVATGQ+   PSIHVW+++    LS L+  H +G+CS+ FS+TG LLLSVG+D +HTI +WKW+ G  +A   GH+QRIF+AEFRPDSD+ FV+VG+KHV+FWTLAG  L++K+G + S  +   RM TMLSVAF  N+ T+TG ++G V VWK  +L RIV KAH+GPVF ++TTL DGLIV+GGKE+  KD G++KLWDQE+ R + F L          ET + +     + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GL  HP    + SA+EDGTVR+WD+  K ++  +  G PA  + YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSPNS  +AVGS +  VD Y L       +  P         L+R   C+D+ S  +Q+DFS D N I+     YK  +Y   +G+ + E   I++I W +W+SV+G+EV GIW   +DKADV  A VSH     +TGDD+G+VKL   F  P +   A   +  F GHS+++TN+RF N D  +VS GG+D  +FVW+C
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQ-PSKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACAKDEITYSGALNGDIYVWKGINLLRTIQGAHGSGIFSMNACEEGFATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRNKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNENSVDIYGVVQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFYRMPSGKEVTNREELKLVQWASWTCVLGPEVNGIWPKYSDINDINSVDGNFSNQVLVTADDYGLVKLFRYPCIKKGAKFRKYLGHSAHITNARWSHDYQWVITIGGADHSVFQWKFVPERKSKEALHIAPQETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGHDDDILCLAIHPLKDFVATGQVGRDSSVHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA---GGGLIGRKGNMGKTETMMCAVYGWSEEMV-FSGTCTGDICIWRDMFLMKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLRKGGRCCCFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDAISDIRFSPGAGKYLAVASADSFVDIYNVMSSKRVGVCKGCLSYITHLDWDKRGKLLQVNTAAKEQFFFEAPRGKRQTIPASEVEKIDWCTWTCVLGPSAEGTWPVISEVTEVTAACLSNDRQVLATGDDLGYVKLFRYPAKGKYAKFKRYVAHSTHVTNVRWTHNDSLLVTVGGGDTCLMIWAHELEGL--------REFKQCDSEESDIESEDDGGYDSDVTRENEISYTIKALSA--NMRVMTGVKPHLQLKEPSVDE-RPPVSRALPQPEKLQ--------TNNVGKKKR----------------PIEDLVLEL----VFGYRGSDCRNNVHYLN-EGADIIYHTASVAIVLNLTTSCQSFYLEHSDDILCLTINQHPKFPNVVATGQVATSPSIHVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFRPDSDTHFVSVGIKHVRFWTLAGRALLSKKGVLSS--IEDARMQTMLSVAFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRL----------ETGQII-----DCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHMDGPIWGLCTHPSRDVFLSAAEDGTVRLWDIPEKKMLNKVNLGHPAHAISYSPEGDMVAIGMKNGEFIILLVASLKIWGKKRDRRSAIQDIRFSPNSRYLAVGSTECAVDFYDL-------TLGP--------QLNRINCCRDIPSFVMQMDFSADSNHIQLSTGAYKRLVYEVPSGKQITEQFHIDRITWATWTSVLGDEVIGIWSRNTDKADVICACVSHSGLNIITGDDFGMVKL---FDFPCLEKFA--KHKRFLGHSAHLTNIRFTNGDRFVVSAGGDDRSLFVWRC 1954          

HSP 2 Score: 403.29 bits (1035), Expect = 2.070e-113
Identity = 218/624 (34.94%), Postives = 363/624 (58.17%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNS-EKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAI 1961
             + Q   +  K  P   L L+ V+GYRG  C NN+ Y N    I+Y  A + IV ++    Q +Y EH+DDI+ + +    +   +VATGQV  SP I +W++ + +T S+L+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  +++   HS R+F A F   D    FV+ GIKH++FW+L G  L SKKG+    +   +QT+L+V  +   N + ++GT++GDV +W+E+ L R++A  H+G ++++ +       VTGGK+        + L D E +      L+   I      VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP + +F + ++D ++R+W + E++ L  + +     +  ++ +G ++AIG+ +G F ++    +      +DR+  + +++FSP+  +LAVGS +  VD YD T      R   C+   SF+  +D+S DS +I+ ++GA + L+++ P G+ IT+   +  I WA +T VLG ++ GIW++ TD  D+  A V+ +   I TGDDFG+VKLF++P   K A  +++ GHSAH+TN+R++   +F++S GG D+S+F WR   ++
Sbjct: 1343 EKLQTNNVGKKKRPIEDLVLELVFGYRGSDCRNNVHYLNEGADIIYHTASVAIVLNLTTSCQSFYLEHSDDILCLTINQHPKFPNVVATGQVATSPSIHVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFR-PDSDTHFVSVGIKHVRFWTLAGRALLSKKGVLSSIEDARMQTMLSV--AFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRLETGQI---IDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHMDGPIWGLCTHPSRDVFLSAAEDGTVRLWDIPEKKMLNKVNLGHPAHAISYSPEGDMVAIGMKNGEFIILLVASLKIWGKKRDRRSAIQDIRFSPNSRYLAVGSTECAVDFYDLTLGPQLNRINCCRDIPSFVMQMDFSADSNHIQLSTGAYKRLVYEVPSGKQITEQFHIDRITWATWTSVLGDEVIGIWSRNTDKADVICACVSHSGLNIITGDDFGMVKLFDFPCLEKFAKHKRFLGHSAHLTNIRFTNGDRFVVSAGGDDRSLFVWRCVHSL 1958          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 1956.41 bits (5067), Expect = 0.000e+0
Identity = 987/2046 (48.24%), Postives = 1366/2046 (66.76%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDIN-----HQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQL--QKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIG-------AIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEK-GKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKC 6245
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL+    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H   ++S+ +C  G+ TGG+D CV L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSN+N VDIY     +K+ G C G++SFITH+DWS DS Y++TN G+   L ++ P G+ +T  + L  ++WA +T VLG ++ GIW KY+D NDIN+ D N +  ++ T DD+GLVKLF YP   KGA FRKY GHSAH+TN RWS D +++I+IGG D S+FQW+          ++        DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL  Q   K      KKR++AP+ G++L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+ ++HVWDT+T+K +S+LKG H+ GVCA+DFS+DG++L S+GLDDNH +V+WDWRKGE L++ R  KDKIF++K +P+  ++L+  G+K ++FW +         G  GN+ K +T +CA Y  ++  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KL+   RCC  S DG A+AVG  DGSF++++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKGC SYITHLDW   GKLL VN+ AKEQ FFEAPRG RQ I  +E+EKI W +W+CVLG S  G WP   ++T+V +  L++D +VLATGDD G VKLF YP+K K+AKFK+Y+ HS HVTNVRW HND  L++VGG DT LM+W H  + +        ++     S+ SD +SE++ G+DSDV RE  + Y  K  S   N +    +KP L  +  S +  +  VSR      K+Q        +  +G++ R                P+ + V +L    V GYRG DCRNN+HYL+ EG+ I+YH A+V IV NL +  QSF+LEH+DDILCLT+N+HPK+ NVVATGQ+G         PSIHVW+++    LS L+  H +G+CS+ FS+TG LLLSVG+D +HTI +WKW+ G  +A   GH+QRIF+AEFRPDSD+ FV+VG+KHV+FWTLAG  L++K+G + S  +   RM TMLSVAF  N+ T+TG ++G V VWK  +L RIV KAH+GPVF ++TTL DGLIV+GGKE+  KD G++KLWDQE+ R + F L          ET + +     + +RS+ R KGKIL+GT++ +I+E+ EK      L+  H +G + GL  HP    + SA+EDGTVR+WD+  K ++  +  G PA  + YSP G+ + IG+K+G F +L   S ++  +K+DR   I DI+FSPNS  +AVGS +  VD Y L       +  P         L+R   C+D+ S  +Q+DFS D N I+     YK  +Y   +G+ + E   I++I W +W+SV+G+EV GIW   +DKADV  A VSH     +TGDD+G+VKL   F  P +   A   +  F GHS+++TN+RF N D  +VS GG+D  +FVW+C
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQ-PSKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACAKDEITYSGALNGDIYVWKGINLLRTIQGAHGSGIFSMNACEEGFATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRNKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNENSVDIYGVVQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFYRMPSGKEVTNREELKLVQWASWTCVLGPEVNGIWPKYSDINDINSVDGNFSNQVLVTADDYGLVKLFRYPCIKKGAKFRKYLGHSAHITNARWSHDYQWVITIGGADHSVFQWKFVPERKSKEALHIAPQETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGHDDDILCLAIHPLKDFVATGQVGRDSSVHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA---GGGLIGRKGNMGKTETMMCAVYGWSEEMV-FSGTCTGDICIWRDMFLMKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLRKGGRCCCFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDAISDIRFSPGAGKYLAVASADSFVDIYNVMSSKRVGVCKGCLSYITHLDWDKRGKLLQVNTAAKEQFFFEAPRGKRQTIPASEVEKIDWCTWTCVLGPSAEGTWPVISEVTEVTAACLSNDRQVLATGDDLGYVKLFRYPAKGKYAKFKRYVAHSTHVTNVRWTHNDSLLVTVGGGDTCLMIWAHELEGL--------REFKQCDSEESDIESEDDGGYDSDVTRENEISYTIKALSA--NMRVMTGVKPHLQLKEPSVDE-RPPVSRALPQPEKLQ--------TNNVGKKKR----------------PIEDLVLEL----VFGYRGSDCRNNVHYLN-EGADIIYHTASVAIVLNLTTSCQSFYLEHSDDILCLTINQHPKFPNVVATGQVGDAGDMAATSPSIHVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFRPDSDTHFVSVGIKHVRFWTLAGRALLSKKGVLSS--IEDARMQTMLSVAFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRL----------ETGQII-----DCVRSVCRGKGKILVGTRNAEIIEVGEKNAACNILVNGHMDGPIWGLCTHPSRDVFLSAAEDGTVRLWDIPEKKMLNKVNLGHPAHAISYSPEGDMVAIGMKNGEFIILLVASLKIWGKKRDRRSAIQDIRFSPNSRYLAVGSTECAVDFYDL-------TLGP--------QLNRINCCRDIPSFVMQMDFSADSNHIQLSTGAYKRLVYEVPSGKQITEQFHIDRITWATWTSVLGDEVIGIWSRNTDKADVICACVSHSGLNIITGDDFGMVKL---FDFPCLEKFA--KHKRFLGHSAHLTNIRFTNGDRFVVSAGGDDRSLFVWRC 1961          

HSP 2 Score: 398.667 bits (1023), Expect = 7.514e-112
Identity = 219/631 (34.71%), Postives = 364/631 (57.69%), Query Frame = 3
Query:  141 NEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNS-EKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGE---LVATGQVG-------KSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYG--KKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASG--YVTGGKD------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMM-GHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDAT--ASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAI 1961
             + Q   +  K  P   L L+ V+GYRG  C NN+ Y N    I+Y  A + IV ++    Q +Y EH+DDI+ + +    +   +VATGQVG        SP I +W++ + +T S+L+  H+ G+ SV+FS TG  LLSVGLDP  T+ +W W++G  +++   HS R+F A F   D    FV+ GIKH++FW+L G  L SKKG+    +   +QT+L+V  +   N + ++GT++GDV +W+E+ L R++A  H+G ++++ +       VTGGK+        + L D E +      L+   I      VRSV       LVGT+ ++IIE  V   N   ++++ GH  G +W L  HP + +F + ++D ++R+W + E++ L  + +     +  ++ +G ++AIG+ +G F ++    +      +DR+  + +++FSP+  +LAVGS +  VD YD T      R   C+   SF+  +D+S DS +I+ ++GA + L+++ P G+ IT+   +  I WA +T VLG ++ GIW++ TD  D+  A V+ +   I TGDDFG+VKLF++P   K A  +++ GHSAH+TN+R++   +F++S GG D+S+F WR   ++
Sbjct: 1343 EKLQTNNVGKKKRPIEDLVLELVFGYRGSDCRNNVHYLNEGADIIYHTASVAIVLNLTTSCQSFYLEHSDDILCLTINQHPKFPNVVATGQVGDAGDMAATSPSIHVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFR-PDSDTHFVSVGIKHVRFWTLAGRALLSKKGVLSSIEDARMQTMLSV--AFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRLETGQI---IDCVRSVCRGKGKILVGTRNAEIIE--VGEKNAACNILVNGHMDGPIWGLCTHPSRDVFLSAAEDGTVRLWDIPEKKMLNKVNLGHPAHAISYSPEGDMVAIGMKNGEFIILLVASLKIWGKKRDRRSAIQDIRFSPNSRYLAVGSTECAVDFYDLTLGPQLNRINCCRDIPSFVMQMDFSADSNHIQLSTGAYKRLVYEVPSGKQITEQFHIDRITWATWTSVLGDEVIGIWSRNTDKADVICACVSHSGLNIITGDDFGMVKLFDFPCLEKFAKHKRFLGHSAHLTNIRFTNGDRFVVSAGGDDRSLFVWRCVHSL 1965          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 675/1340 (50.37%), Postives = 928/1340 (69.25%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDIN-----HQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQL--QKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDL 4154
            M+++ APN  L L+WVYGYRGHQC NNL+YT +++IVYFVAG+G+VY+ ++ KQ +Y  HNDDIIS+AL  +  LVATGQVGK P+IC+W+S +++T SILKD HTHGI+ +AF   G  L+SVGLD   T+ VWDW++GKVL+    H+DR+FD  + +   P K V+CG+KHIKFWSLCGN L+ K+G++GK G++QTIL  C++ + + + YSG LNGD+Y+W+  NL R I   H   ++S+ +C  G+ TGG+D CV L D  F+P+T IDL+ T+ GY  L VRSV W  ++ LVGTQ S+I E+ V   NKP  +M GH  GELWAL VHP K +  TGSDD S+RIW + +   +    +++ IR    + DG  +A+G+ DGSF+V+R RDM EV + +DRKE +HELK+SPDG  LAVGSN+N VDIY     +K+ G C G++SFITH+DWS DS Y++TN G+   L ++ P G+ +T  + L  ++WA +T VLG ++ GIW KY+D NDIN+ D N +  ++ T DD+GLVKLF YP   KGA FRKY GHSAH+TN RWS D +++I+IGG D S+FQW+          ++        DS ++ SDS  SD+   +SE+E+E Q  Y R V K+++ QL  Q   K      KKR++AP+ G++L ++HGYRGYDCR+N+FY Q+GEIV+HVAAVG+V N    TQRFY  H+DDILCL +HPLKD +ATG+VGR+ ++HVWDT+T+K +S+LKG H+ GVCA+DFS+DG++L S+GLDDNH +V+WDWRKGE L++ R  KDKIF++K +P+  ++L+  G+K ++FW +         G  GN+ K +T +CA Y  ++  V ++G+ +G + IW+D  L   V  H+G  +++ AL+KGFVTGGKDG + L D+TF +  K+Y +    L P    +L    P+IR++ LG G IL  T +GEI+E+   G I +LVQGH EGE+WGLA HP   +CATVSDD  L IW++ PS H ++ ++KL+   RCC  S DG A+AVG  DGSF++++  +L ++ S HHRK+ ISDI+FSP  GKYLAV S D+FVDIY+ +S +R+ VCKGC SYITHLDW   GKLL VN+ AKEQ FFEAPRG RQ I  +E+EKI W +W+CVLG S  G WP   ++T+V +  L++D +VLATGDD G VKLF YP+K K+AKFK+Y+ HS HVTNVRW HND  L++VGG DT LM+W H  + +        ++     S+ SD +SE++ G+DSDV RE  + Y  K  S   N +    +KP L
Sbjct:    1 MADRTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQ-PSKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTIL--CLACAKDEITYSGALNGDIYVWKGINLLRTIQGAHGSGIFSMNACEEGFATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVVHDRNKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNENSVDIYGVVQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFYRMPSGKEVTNREELKLVQWASWTCVLGPEVNGIWPKYSDINDINSVDGNFSNQVLVTADDYGLVKLFRYPCIKKGAKFRKYLGHSAHITNARWSHDYQWVITIGGADHSVFQWKFVPERKSKEALHIAPQETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGHDDDILCLAIHPLKDFVATGQVGRDSSVHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA---GGGLIGRKGNMGKTETMMCAVYGWSEEMV-FSGTCTGDICIWRDMFLMKTVKAHDGPVFSMHALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPS-HCMLAVRKLRKGGRCCCFSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDAISDIRFSPGAGKYLAVASADSFVDIYNVMSSKRVGVCKGCLSYITHLDWDKRGKLLQVNTAAKEQFFFEAPRGKRQTIPASEVEKIDWCTWTCVLGPSAEGTWPVISEVTEVTAACLSNDRQVLATGDDLGYVKLFRYPAKGKYAKFKRYVAHSTHVTNVRWTHNDSLLVTVGGGDTCLMIWAHELEGL--------REFKQCDSEESDIESEDDGGYDSDVTRENEISYTIKALSA--NMRVMTGVKPHL 1322          

HSP 2 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 509/1378 (36.94%), Postives = 753/1378 (54.64%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTIN--ILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAIS-HQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENG-------FDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAF-CTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL---ETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXX-XXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            + AP+  L+LEWV+GYRG+ CRNN++Y  + EIV+ VA VG+V N     Q+FY  HNDDI+ L LHP + L+ATG+VG+EP I VWD+ T+++VSILK  H  G+  + F  +G+ L SVGLD  + + VWDWR+G+ LA    H D+IF I WD +  ++LV+ G+K I+FW+  G   T KRG FG    L T LC A   ++  + Y+G+ +G +Y+WK  N+L++    H  G ++++A ++GF TGG+DG ++L D  F  +  +     E  Q  + LS     +RSV      IL  T   EI E+         +++QGH EGELW LAVHP+K +  T SDD  + IW +   +H LI    ++ P RC  +S DG  +A+G KDGSF VL +  + E+     RKE I ++K+SP  G +LAVGS++N VDIY  +  ++++  C G +S+ITH+DWSTD K L  N G+  +LF+  P G +++  + E++ + WASW+CVLG    GIWP   DI D+NSV      +VL T DD+G VKLF YP   K AKF++YLGHSAH+TN RW H+ ++++++GGAD ++  WK     VP   S     I  PQ  L+D++SEE +         DS++E+E  + Y  + Y E L         P L  Q    +   A   RE                      R+ ++G                     ++L  +HGYRG+DCR+NL Y   +   IVYH AAVG+V+N Q   Q F++ H+DDILCL +  HP  ++ VATGQ+G   S+HVW++     +S LKG H  G+C+LDFS+ G  L+S+G+D++HTI +W W  G  L+   G   +IF+ +  P      +  GVKH+KFW  AG  LI ++G       N  +  TM+   +  + +  ++G   G + +W+   L + V KAH GPVF +    ++   V+GGK+     G + LWD    R    Y    I     +  +K L  +    IR+IS   G IL+GT++ +ILE+ +K G +  L+Q H EG + GLA HP LP  ++ S+D T+RIWDL      + ++ L  G   C  +SP+G  L +GL  G+F +++A +   L+    R   I+DI+FSP +   +AV S D+ VDIY                  +V++  R   CK   S    +D+   G  ++      +   +    G+    P    + I   +W+ V+G    G WP  S+  +V  A +S+      TGDD G VKL   F  P     A      +  HS++VTNVR+ ++DS LV+ GG D C+ +W
Sbjct:    4 RTAPNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQPSKLVSCGVKHIKFWSLCGNALTPKRGVFGKTGDLQTILCLACAKDE--ITYSGALNGDIYVWKGINLLRTIQGAHGSGIFSMNACEEGFATGGRDGCVRLWDLNFKPI--TVIDLRETDQGYKGLS-----VRSVCWRGDHILVGTQDSEIFEVVVHDRNKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSL--IDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSP-DGAHLAVGSNENSVDIYGVVQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFYRMPSG-KEVTNREELKLVQWASWTCVLGPEVNGIWPKYSDINDINSVDGNFSNQVLVTADDYGLVKLFRYPCIKKGAKFRKYLGHSAHITNARWSHDYQWVITIGGADHSVFQWKF----VPERKSKEALHI-APQETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDL---------PQLKEQCKVKHRATAMKKRE----------------------RAPASG---------------------IKLHFIHGYRGYDCRSNLFY--TQTGEIVYHVAAVGVVYNGQQNTQRFYMGHDDDILCLAI--HP-LKDFVATGQVGRDSSVHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKAGGGLIGRKG-------NMGKTETMMCAVYGWSEEMVFSGTCTGDICIWRDMFLMKTV-KAHDGPVFSMHA--LEKGFVTGGKD-----GIVALWDDTFERCLKTYA---IKRAVLAPGSKGLLLEDNPSIRAISLGHGHILVGTKNGEILEV-DKSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLRKGGRCCC-FSPDGKALAVGLNDGSFIIVNADTLEDLVSFHHRKDAISDIRFSPGAGKYLAVASADSFVDIY------------------NVMSSKRVGVCKGCLSYITHLDWDKRGKLLQVNTAAKEQFFFEAPRGKRQTIPASEVEKIDWCTWTCVLGPSAEGTWPVISEVTEVTAACLSNDRQVLATGDDLGYVKL---FRYPAKGKYAKFKR--YVAHSTHVTNVRWTHNDSLLVTVGGGDTCLMIW 1263          

HSP 3 Score: 361.303 bits (926), Expect = 4.514e-102
Identity = 237/643 (36.86%), Postives = 348/643 (54.12%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTT-GPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLPYRQN 6272
             L L+ V+GYRG  CRNNL+Y  A+   IVY  A VG+V+N +  +Q F+L HNDDI+ L +  HP+ R +VATGQ+G  P I VW+S     +S LK VH +GI  L F   G  L+SVG+D+ +TI VW W  G +LA A GHT RIF   +     S  V+ GVKH+KFW+L G+ L  KRG     F     + T+L +A   ++ TY+GA+NG ++VWK   L R ++ AH   +F +     +    +GG++     G ++LWD   +  KP  +   I++R   +  K L       +RS+      IL+GTQD++I E++       +L MQ H EG L  LAVHP  P   + S+D +VRIW L    LI       P  C   S +G +L +G+K G+F VL  +    ++  KDR + I ++K+SP+ + +AVGSN+N VDIY +           C   NS +T                +D+STD  +++      +   Y   +G+ V   E+++ + W SW+ V+G EV GIWP  SD  D+N+   +  +   VT DDYGLVKL   F  P I   A      + GHS+++TN R+ +D   +++ GG D  VF WK   ++P R++
Sbjct:   10 HLRLEWVYGYRGHQCRNNLYYTAAK--EIVYFVAGVGVVYNTREHKQKFYLGHNDDIISLAL--HPE-RVLVATGQVGKEPYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQPSKLVSCGVKHIKFWSLCGNALTPKRGV----FGKTGDLQTILCLACAKDEITYSGALNGDIYVWKGINLLRTIQGAHGSGIFSM--NACEEGFATGGRD-----GCVRLWD---LNFKPITV---IDLRETDQGYKGLS------VRSVCWRGDHILVGTQDSEIFEVVVHDRNKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIARCNMEEPIRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSNENSVDIYGV--VQRYKKVGECMGSNSFIT---------------HMDWSTDSKYLQTNDGSGRRLFYRMPSGKEVTNREELKLVQWASWTCVLGPEVNGIWPKYSDINDINSVDGNFSNQVLVTADDYGLVKL---FRYPCIKKGAKFRK--YLGHSAHITNARWSHDYQWVITIGGADHSVFQWK---FVPERKS 599          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: EML6 (echinoderm microtubule-associated protein-like 6 [Source:NCBI gene;Acc:101159527])

HSP 1 Score: 1392.48 bits (3603), Expect = 0.000e+0
Identity = 676/1348 (50.15%), Postives = 945/1348 (70.10%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDI----NHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIED--GKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQ--MLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRR----DPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERL--------NQQQTE 4136
            MS++ AP  +L LDWVYGYRGHQC NNLFYT  +++VYFVAG+G+VY+ ++  Q +Y  HNDDIIS+AL  +  LVATGQVGK P++C+W+S +++T S+L+D HTHGI+ + FS  G  L SVGLD   T+ +W+W++GK+L+S   HSDR+FD    +   P    + V+CG+KHIKFW+LCGN L+ K+GI+GK G++QTIL  C++ + + + YSG LNGDVY+W+  NL R + + H   ++S+ SC  G+ TGG+D CV L D +F+P+T+IDL+    GY  L +RSV W ++  L GTQ S+I E+ V   +KP  +M GH+ GELWAL +HPKK +  TGSDD S+R+W + +   +    +++ +RS  F+ DGS +A+G+ DGSF+V+R RDM EV + +DRKEV+HE+KFSPDG +LAVGSND  VD+Y     +K+ G C  +SSFITH+DWSLD   ++TN GA E L ++ P G+ +++ ++   + WA ++G+LG+++ GIW KY+D+  ++A   N  A ++ TGDD GLVKLF +P   KGA F+KY GHSAHVTNVRWS D +++++ GG D ++FQWR     S   D+    +   DS ++ SDS  SD+   +S++E+E Q NY R V K+++ QL++ ++   +     KR+K P QGL+L +VHGYRGYDCRNN+FY QSGE++FHVAAVG+V N    +QRFY  H+DDIL L +HPLKD  ATG+VGR+P IHVWD QT+K +S+LKG H+RGVCA+DFS+DGK L SVGLDD+H +++WDW++GEKLA+ R HK+KIF++K +P   ++LV VG+K I+FW   GGG   KRG F +  + +T +   Y  N+  + ++G+ +G VYIWK+ +L   V  H+G  +A+ +LDKGFVTGGKDG + L D+ F +  K+Y +    L P    +L    P+IR++ LG G IL  T +GE++E+   G + +LVQGH EGE+WGLA HP   ICATVSDD  L +WE   S H+++ ++KLK   RCC  S DG  +AVG  DG  LV++  +L ++ S HHR++ ISD++F+P  GKYLAV SHD FVDIY+ ++ +R+ +CKG SSYITH+DW T GKLL VN+GAKE LFFEAPRG +Q I  +E+E+I W++W+CVLG SC GIWP   DITD+N+ SLT+D  +LATGDDFG +KLF YP + +FA+FK+Y+GH A VTNVRW H+D  LL+VGGADTALM+WK  R    +P   E ++      +  S+ SD D+EE+ G+DSDV REK +DY+ K  +  +        +QQQ E
Sbjct:    1 MSDRSAPGCRLRLDWVYGYRGHQCRNNLFYTAGKEVVYFVAGVGVVYNTREHSQRFYMGHNDDIISLALHPERSLVATGQVGKDPYVCVWDSFTVQTVSLLRDGHTHGIACLTFSADGQRLASVGLDAKNTVCIWEWRRGKILASATGHSDRIFD----ICWDPFQQDRLVSCGVKHIKFWALCGNALTPKRGIFGKAGDLQTIL--CVASAKDDITYSGALNGDVYVWKGLNLIRTVQSAHGAGIFSMFSCEEGFATGGRDGCVRLWDGDFKPITKIDLREAEQGYKGLSIRSVCWRADRILAGTQDSEIFEVMVRERDKPLLIMQGHSEGELWALDIHPKKPLAVTGSDDRSVRLWSLVDHALIARCNMEEAVRSVAFSMDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGAYLAVGSNDGLVDVYAVAQRYKKVGECSKSSSFITHMDWSLDGKILQTNDGAGEHLFYRMPLGKPVSKEEVKNQL-WASWSGILGSEVSGIWPKYSDSTAVHAVGANHAAAVLITGDDLGLVKLFRFPCLKKGAKFKKYIGHSAHVTNVRWSHDLQWVLTTGGADHALFQWRFLPE-SPKLDLIFSSDSYGDSGSEESDSDASDVPELDSDIEQETQINYDRQVYKEDLPQLRQQSREKKQQVGSLKRQKGPEQGLRLRFVHGYRGYDCRNNLFYTQSGEVLFHVAAVGVVYNRQLHSQRFYLGHDDDILSLSIHPLKDFAATGQVGRDPAIHVWDIQTLKCLSLLKGFHQRGVCALDFSADGKSLVSVGLDDDHSIILWDWKRGEKLATARGHKEKIFVVKCNPMLMDKLVTVGIKHIKFWQHAGGGLIFKRGAFRSSGRHETMMSVCYGRNE-ALVFSGAATGDVYIWKEPLLLKTVKAHDGPVFAMFSLDKGFVTGGKDGVVALWDDMFDRCLKTYAIKRAALSPASKGLLLEDNPSIRAITLGHGHILVGTKNGEVLEIDKTGPMTLLVQGHMEGEVWGLAPHPLLPICATVSDDKTLRLWETSTS-HRMVAVRKLKRGGRCCAFSPDGKVLAVGLSDGGVLVVNADTLEDLLSFHHRRDAISDLRFTPDSGKYLAVASHDTFVDIYNVLTTKRVGICKGASSYITHIDWDTRGKLLQVNTGAKELLFFEAPRGRKQTIKNSELERISWSTWTCVLGSSCEGIWPTHSDITDINATSLTADRTLLATGDDFGFLKLFSYPVRGQFARFKRYVGHCAQVTNVRWAHDDSMLLTVGGADTALMIWKRERGGGVNP-EREGAVFRDNQPLVDSEESDDDTEEDGGYDSDVAREKIVDYVTKMSTTSMREMRGNKPHQQQKE 1337          

HSP 2 Score: 875.544 bits (2261), Expect = 0.000e+0
Identity = 528/1373 (38.46%), Postives = 770/1373 (56.08%), Query Frame = 3
Query: 2157 KKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD-NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL---STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS-AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDT-TYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK---MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNS-SLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVN-EPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            + AP   L+L+WV+GYRG+ CRNN+FY    E+V+ VA VG+V N    +QRFY  HNDDI+ L LHP + L+ATG+VG++P + VWD+ T+++VS+L+  H  G+  + FS+DG++LASVGLD  + + +W+WR+G+ LAS   H D+IF I WDP   ++LV+ G+K I+FW   G   T KRG FG    L T LC A    K  + Y+G+ +G VY+WK  N++++    H  G +++ + ++GF TGG+DG ++L D  F  + K      E  Q  + LS     IRSV     +ILA T   EI E+     D  + +++QGH EGELW L +HP K +  T SDD  + +W +   +H LI    ++   R    S DGS +A+G KDGSF VL +  + E+     RKE I ++KFSP  G YLAVGS+D  VD+Y+ A  ++++  C   SS+ITH+DWS DGK+L  N GA E LF+  P G  + ++K E++  +WASWS +LG    GIWP   D T V++V       VL TGDD G VKLF +P   K AKFK+Y+GHSAHVTNVRW H+ +++L+ GGAD AL  W+   +   L+   ++       S+ SD+D+ +    DSD+E+E  ++Y  + Y E L Q + +                    SRE     K Q  +L  +   E G                            L L+ VHGYRG+DCRNNL Y   +   +++H AAVG+V+N Q   Q F+L H+DDIL L++  HP  ++  ATGQ+G  P+IHVW+      LS LKG H  G+C+LDFS+ G  L+SVG+D+DH+I +W W+ G  LA A GH ++IF+ +  P      V VG+KH+KFW  AG  LI KRG     F +  R  TM+SV +  N+   ++GA  G V++WK  +L + V KAH GPVF +F+  +D   V+GGK+     G + LWD    R    Y    I     S  +K L  +    IR+I+   G IL+GT++ ++LEI +K G +  L+Q H EG + GLA HP LP  ++ S+D T+R+W+  T    + ++ L  G   C  +SP+G  L +GL  G   V++A +   L+    R   I+D++F+P+S   +AV S+D  VDIY                  +V+T  R   CK   S    ID+ T G  ++      ++  +    G+    +  ++E+I W +W+ V+G    GIWP  SD  D+N   ++       TGDD+G +KL+ S+PV             + GH + VTNVR+ +DDS L++ GG D  + +WK
Sbjct:    4 RSAPGCRLRLDWVYGYRGHQCRNNLFYTAGKEVVYFVAGVGVVYNTREHSQRFYMGHNDDIISLALHPERSLVATGQVGKDPYVCVWDSFTVQTVSLLRDGHTHGIACLTFSADGQRLASVGLDAKNTVCIWEWRRGKILASATGHSDRIFDICWDPFQQDRLVSCGVKHIKFWALCGNALTPKRGIFGKAGDLQTILCVA--SAKDDITYSGALNGDVYVWKGLNLIRTVQSAHGAGIFSMFSCEEGFATGGRDGCVRLWDGDFKPITKIDLREAE--QGYKGLS-----IRSVCWRADRILAGTQDSEIFEVMVRERDKPL-LIMQGHSEGELWALDIHPKKPLAVTGSDDRSVRLWSL--VDHALIARCNMEEAVRSVAFSMDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSP-DGAYLAVGSNDGLVDVYAVAQRYKKVGECSKSSSFITHMDWSLDGKILQTNDGAGEHLFYRMPLG--KPVSKEEVKNQLWASWSGILGSEVSGIWPKYSDSTAVHAVGANHAAAVLITGDDLGLVKLFRFPCLKKGAKFKKYIGHSAHVTNVRWSHDLQWVLTTGGADHALFQWRFLPESPKLDLIFSSDSYGDSGSEESDSDASDVPELDSDIEQETQINYDRQVYKEDLPQLRQQ--------------------SREK----KQQVGSLKRQKGPEQG----------------------------LRLRFVHGYRGYDCRNNLFY--TQSGEVLFHVAAVGVVYNRQLHSQRFYLGHDDDILSLSI--HP-LKDFAATGQVGRDPAIHVWDIQTLKCLSLLKGFHQRGVCALDFSADGKSLVSVGLDDDHSIILWDWKRGEKLATARGHKEKIFVVKCNPMLMDKLVTVGIKHIKFWQHAGGGLIFKRGA----FRSSGRHETMMSVCYGRNEALVFSGAATGDVYIWKEPLLLKTV-KAHDGPVFAMFS--LDKGFVTGGKD-----GVVALWDDMFDRCLKTYA---IKRAALSPASKGLLLEDNPSIRAITLGHGHILVGTKNGEVLEI-DKTGPMTLLVQGHMEGEVWGLAPHPLLPICATVSDDKTLRLWETSTSHRMVAVRKLKRG-GRCCAFSPDGKVLAVGLSDGGVLVVNADTLEDLLSFHHRRDAISDLRFTPDSGKYLAVASHDTFVDIY------------------NVLTTKRVGICKGASSYITHIDWDTRGKLLQVNTGAKELLFFEAPRGRKQTIKNSELERISWSTWTCVLGSSCEGIWPTHSDITDINATSLTADRTLLATGDDFGFLKLF-SYPV----RGQFARFKRYVGHCAQVTNVRWAHDDSMLLTVGGADTALMIWK 1264          

HSP 3 Score: 452.595 bits (1163), Expect = 3.526e-132
Identity = 235/614 (38.27%), Postives = 366/614 (59.61%), Query Frame = 3
Query:  150 QIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTNIGY---PNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLR-IDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPD-GHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHIT-QTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWR 1946
            Q+  +  +  P   L L +V+GYRG+ C NNLFYT S ++++ VA +G+VY+ +   Q +Y  H+DDI+S+++    +  ATGQVG+ P I +W+  +L+  S+LK  H  G+ ++ FS  G  L+SVGLD + ++ +WDWK+G+ L++ R H +++    F+V   P+   K VT GIKHIKFW   G  L  K+G +   G  +T+++VC    + A+ +SG   GDVYIW+E  L + +   H G ++++ S   G+VTGGKD  V L D  F        + R  L   + G     N  +R++     + LVGT+  +++EI  + P     L+ GH  GE+W L  HP   I AT SDD +LR+W+ +    +  +R + +  R C F+ DG ++A+G+ DG   V+    + ++ +   R++ + +L+F+PD G +LAV S+D FVDIY+   + KR G+CKG SS+ITH+DW      ++ N+GA ELL F+AP G   T +   L  I W+ +T VLG+  +GIW  ++D  DINA  +  +  L+ATGDDFG +KLF+YP   + A F++Y GH A VTNVRW+ D   L+++GG D ++  W+
Sbjct:  660 QVGSLKRQKGPEQGLRLRFVHGYRGYDCRNNLFYTQSGEVLFHVAAVGVVYNRQLHSQRFYLGHDDDILSLSIHPLKDFAATGQVGRDPAIHVWDIQTLKCLSLLKGFHQRGVCALDFSADGKSLVSVGLDDDHSIILWDWKRGEKLATARGHKEKI----FVVKCNPMLMDKLVTVGIKHIKFWQHAGGGLIFKRGAFRSSGRHETMMSVCYG-RNEALVFSGAATGDVYIWKEPLLLKTV-KAHDGPVFAMFSLDKGFVTGGKDGVVALWDDMFDRCLKTYAIKRAALSPASKGLLLEDNPSIRAITLGHGHILVGTKNGEVLEIDKTGPM--TLLVQGHMEGEVWGLAPHPLLPICATVSDDKTLRLWETSTSHRMVAVRKLKRGGRCCAFSPDGKVLAVGLSDGGVLVVNADTLEDLLSFHHRRDAISDLRFTPDSGKYLAVASHDTFVDIYNVLTT-KRVGICKGASSYITHIDWDTRGKLLQVNTGAKELLFFEAPRGRKQTIKNSELERISWSTWTCVLGSSCEGIWPTHSDITDINATSLTADRTLLATGDDFGFLKLFSYPVRGQFARFKRYVGHCAQVTNVRWAHDDSMLLTVGGADTALMIWK 1264          

HSP 4 Score: 358.221 bits (918), Expect = 8.885e-101
Identity = 230/639 (35.99%), Postives = 345/639 (53.99%), Query Frame = 3
Query: 4350 QLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYL-MQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*YLP 6260
            +L L  V+GYRG  CRNNL Y    G  +VY  A VG+V+N +   Q F++ HNDDI+ L +  HP+ R++VATGQ+G  P + VW+S     +S L+  H +GI  L FS+ G  L SVG+D  +T+ +W+W  G +LA A GH+ RIF   + P      V+ GVKH+KFW L G+ L  KRG     F     + T+L VA   +D TY+GA+NG V+VWK   L R V+ AH   +F +F+   +    +GG++     G ++LWD +    KP      I++R   +  K L       IRS+     +IL GTQD++I E++ ++     L MQ H EG L  L +HP  P   + S+D +VR+W L    LI       A   V +S +G+ L +G+K G+F VL  +    ++  KDR + I ++KFSP+ + +AVGSND +VD+Y +           C   +S +T                +D+S DG  ++      +   Y    G+ V++  +++  +W SWS ++G EV+GIWP  SD   V+    +H +   +TGDD GLVKL   F  P +   A      + GHS++VTNVR+ +D   +++TGG D  +F W+   +LP
Sbjct:   10 RLRLDWVYGYRGHQCRNNLFY--TAGKEVVYFVAGVGVVYNTREHSQRFYMGHNDDIISLAL--HPE-RSLVATGQVGKDPYVCVWDSFTVQTVSLLRDGHTHGIACLTFSADGQRLASVGLDAKNTVCIWEWRRGKILASATGHSDRIFDICWDPFQQDRLVSCGVKHIKFWALCGNALTPKRGI----FGKAGDLQTILCVASAKDDITYSGALNGDVYVWKGLNLIRTVQSAHGAGIFSMFS--CEEGFATGGRD-----GCVRLWDGDF---KPI---TKIDLREAEQGYKGLS------IRSVCWRADRILAGTQDSEIFEVMVRERDKPLLIMQGHSEGELWALDIHPKKPLAVTGSDDRSVRLWSLVDHALIARCNMEEAVRSVAFSMDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHEMKFSPDGAYLAVGSNDGLVDVYAVAQR--YKKVGECSKSSSFIT---------------HMDWSLDGKILQTNDGAGEHLFYRMPLGKPVSKE-EVKNQLWASWSGILGSEVSGIWPKYSDSTAVHAVGANHAAAVLITGDDLGLVKL---FRFPCLKKGAKFKK--YIGHSAHVTNVRWSHDLQWVLTTGGADHALFQWR---FLP 594          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: ENSORLT00000038928.1 (echinoderm microtubule-associated protein-like 6 [Source:NCBI gene;Acc:101174888])

HSP 1 Score: 1223.76 bits (3165), Expect = 0.000e+0
Identity = 671/1422 (47.19%), Postives = 942/1422 (66.24%), Query Frame = 3
Query: 1992 DSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPP-QMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKT-KFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLE----LKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKE-KGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISR--VKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDL-ETKMLIQSLTTG-PATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDC 6224
            DS +  SDS +SDI   +S++E+E+QTNY R V K+++ QL+K     +    KR+KAP +GL+L++VH YRG+DCRNN++Y Q+GE+V+HVAAVG+V N    +QRFY  H+DDIL L +HPLKD +A+ +VGR+P IHVWDTQT+  +S+L+G+H RGVCA++F+ DGK L SVG+D++H +V+WDW+KGE+L S   HKDKIF++K +P   ++LV VG+K I+FW Q  GG T +RG FGN+ + +T + A Y  ++  + ++G+ +G VYIW+D  L   +  H+G  +A+ +LDKGFVTGGKDG ++L D+ F +  K+Y +    L P  ++L    P+IR++ LG G IL  T +GEI+E+   G + +LVQGH EGE+WGLA HP   +CATVSDD  L IWE+  SNH+++ ++KLK   RCC  S DG A+AVG  DGSFLV++  +L ++ + HHR+E ISDI+FS   GKYLAV S+D+FVDIY+ ++ +R+ VCK  +S ITH+DW +  KLL+VN+GAKE LFFEAPRG RQ I+ TE EK+ W++W+ VLG +C GIWP    ++ VN+ SL+ D K+LATGDDFG +KLF +PS+  +FAKFK+Y+GHS +VTNVRW ++D  LLSVGG DTALM+W   R+P   ++S   K ++  +S     D  EE+G+DSDV REK++DY+ K YS                          +S+   + T   +Q   L ++D         S     P +L+    N V +K   LE    L HV GYRGFDCRNNLHYL+ +G+ I++H AA  ++ NL S  Q+F+LEH DDILCLTVN+HPKY+NVVATGQI A PSIHVW+++    LS L+  H  G+  ++FS+TG LLLSVG++ +HTI VW+W+  T  +   GHT+RIF+ EFRPDSD+ FV+VGVKH+KFWTL G  L+ K+G I S  V   R+ TMLSVAF  N+ T++GA+NG V+VW+   L R+V KAHSGP+F ++TTL DGLIV+GGKE + K+ G++KLWDQEM R + F L          ET +P+E+     +RS+ R  ++GKIL+GT+D +I+E+ EK      ++  H  G + GLA HPF   + SA +DGT+RIWDL + + L+  ++ G PA C  YSPNG  + IG+++G F VL   S  +  +K+DR   I DI+FSP++  +AVGS ++ VD Y L       S  P        +L+R  YCKD+    +Q+DFS D   I+     Y  +++   +G++V E +     I  +  +++G+EV G+WP  +DKADVN   VSH      +GDD+GL+KL+  FP P         +  + GHS++VTNVRF  DD  L+S GG DC
Sbjct:  334 DSNSGESDSDVSDIPELDSDIEQESQTNYERQVYKEDLPQLRKKLIGSL----KRQKAPEEGLRLQFVHRYRGFDCRNNLYYSQTGEVVYHVAAVGVVYNRLQHSQRFYLGHDDDILSLTVHPLKDYVASAQVGRDPGIHVWDTQTLNCLSLLRGQHNRGVCALEFT-DGKSLISVGIDESHSIVIWDWKKGERL-SKAGHKDKIFVVKSNPFRMDKLVTVGIKHIKFW-QHSGGLTFRRGIFGNLGRQETMMSACYGRSED-LLFSGATNGDVYIWRDTTLIKTIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRATLSPSSKLLLEDNPSIRAITLGHGHILLGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPVCATVSDDKTLRIWELS-SNHRMVAVRKLK-RGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRRELISDIRFSQV-GKYLAVASNDSFVDIYNVLTSKRVGVCKATASCITHIDWDSR-KLLLVNTGAKELLFFEAPRGRRQNISLTEFEKLDWSTWTSVLGPTCEGIWPA---LSFVNAASLSKDRKLLATGDDFGFLKLFSFPSRQGQFAKFKKYVGHSTNVTNVRWSNDDSVLLSVGGGDTALMIWS--REPPGHKES---KAVDSEES----DDDTEEDGYDSDVAREKAVDYVTKIYS--------------------------SSIRNMSGTKPHLQHKELPVEDPPV------SRATPLPDKLLR---NNVTKKKKVLEQDLVLDHVFGYRGFDCRNNLHYLN-DGTDIIFHTAATAVIQNLSS-TQTFYLEHTDDILCLTVNQHPKYQNVVATGQILA-PSIHVWDAVTKQTLSILRCSHAKGVGYVNFSATGKLLLSVGVEPEHTITVWRWQE-TKASSKGGHTERIFVVEFRPDSDTQFVSVGVKHIKFWTLVGGSLMYKKGVIGS--VEDSRVQTMLSVAFGANNLTFSGAINGDVYVWREHFLVRVVAKAHSGPIFTMYTTLRDGLIVTGGKERRTKEGGAVKLWDQEMKRCRAFQL----------ETGQPVEN-----VRSVCRGKIQGKILVGTKDGEIIEVGEKNAASNTMINGHTHGGIWGLASHPFKDVFISAGDDGTIRIWDLVDKQKLLNKVSLGHPAKCTSYSPNGEMVSIGMETGEFIVLLVNSLTIWGKKRDRNVSIQDIRFSPDNRFLAVGSVESAVDFYDL-------SLGP--------SLNRIGYCKDISGTVIQMDFSADSRHIQVSTSTYTRQVHEVPSGKVVTE-QNAINRITWASWTILGDEVLGVWPRNADKADVNCVCVSHAGLNLASGDDFGLIKLF-EFPCPE----KFAKHKRYFGHSAHVTNVRFSCDDKFLISAGGSDC 1654          

HSP 2 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 494/1318 (37.48%), Postives = 760/1318 (57.66%), Query Frame = 3
Query:  153 IFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQ------PMTRIDLKLTN--IGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT---RDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGG--EHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPT-KGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQW-------RLTDAISGS------------GDINHQ--VDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSG-EIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGL--HP-LKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNV--AKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAI--DALDKGFVTGGKD------GTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGK--GKILASTSSGEIMEL-STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS---AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGAD 3929
            I  +  + AP   L L +V+ YRG  C NNL+Y+ + ++VY VA +G+VY+  Q  Q +Y  H+DDI+S+ +    + VA+ QVG+ P I +W++ +L   S+L+ QH  G+ ++ F+  G  L+SVG+D + ++ +WDWKKG+ LS    H D++F    +V   P    K VT GIKHIKFW   G  L+ ++GI+G  G  +T+++ C   S++ + +SG  NGDVYIWR+  L + I   H G ++++ S   G+VTGGKD  V L D  F+       + R  L  ++  +   N  +R++     + L+GT+  +I+EI  S P     L+ GH  GE+W L  HP   + AT SDD +LRIW+++    +  +R  K+ R C F+ DG  +A+G+ DGSF V+      DM+  H+   R+E++ +++FS  G +LAV SND+FVDIY+   S KR GVCK  +S ITH+DW      +  N+GA ELL F+AP G  ++I+ T+    + W+ +T VLG   +GIW   +    +NAA ++ +  L+ATGDDFG +KLF++PS   + A F+KY GHS +VTNVRWS D   L+S+GGGD ++  W       + + A+                D+  +  VD  T    S + ++      L+ +        VS+       K+ ++++    K+KK   Q L L+ V GYRG+DCRNN+ YL  G +I+FH AA  ++ N++S TQ FY  H DDILCL +  HP  ++++ATG++   P+IHVWD  T +++SIL+  H +GV  V+FS+ GK L SVG++  H + VW W++  K +S   H ++IF++++ P ++ Q V+VG+K I+FWT VGG    K+G  G+V  +++ T L  A+  N   + ++G+ +G VY+W+++ L   V   H G  + +     D   VTGGK+      G +KL D+   +  ++++L  E  QP +        +RSV  GK  GKIL  T  GEI+E+   +   N ++ GH  G +WGLA HP K++  +  DD  + IW++     KL+    L  PA+C   S +G  V++G + G F+VL + SL        R   I DI+FSP   ++LAVGS ++ VD Y      S  R+  CK  S  +  +D+S D + + V++    +   E P G + +  +  I +I WASW+ +LGD  +G+WP   D  DVN V ++  G  LA+GDDFG +KLFE+P   KFAK K+Y GHSAHVTNVR+  +D++L+S GG+D
Sbjct:  379 IGSLKRQKAPEEGLRLQFVHRYRGFDCRNNLYYSQTGEVVYHVAAVGVVYNRLQHSQRFYLGHDDDILSLTVHPLKDYVASAQVGRDPGIHVWDTQTLNCLSLLRGQHNRGVCALEFTD-GKSLISVGIDESHSIVIWDWKKGERLSKA-GHKDKIF----VVKSNPFRMDKLVTVGIKHIKFWQHSGG-LTFRRGIFGNLGRQETMMSACYGRSED-LLFSGATNGDVYIWRDTTLIKTIKA-HDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRATLSPSSKLLLEDNPSIRAITLGHGHILLGTKNGEILEIDKSGPMTL--LVQGHMEGEVWGLAAHPLLPVCATVSDDKTLRIWELSSNHRMVAVRKLKRGRCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHH---RRELISDIRFSQVGKYLAVASNDSFVDIYNVLTS-KRVGVCKATASCITHIDWD-SRKLLLVNTGAKELLFFEAPRGRRQNISLTE-FEKLDWSTWTSVLGPTCEGIWPALS---FVNAASLSKDRKLLATGDDFGFLKLFSFPSRQGQFAKFKKYVGHSTNVTNVRWSNDDSVLLSVGGGDTALMIWSREPPGHKESKAVDSEESDDDTEEDGYDSDVAREKAVDYVTKIYSSSIRNMSGTKPHLQHKELPVEDPPVSR-ATPLPDKLLRNNV---TKKKKVLEQDLVLDHVFGYRGFDCRNNLHYLNDGTDIIFHTAATAVIQNLSS-TQTFYLEHTDDILCLTVNQHPKYQNVVATGQI-LAPSIHVWDAVTKQTLSILRCSHAKGVGYVNFSATGKLLLSVGVEPEHTITVWRWQE-TKASSKGGHTERIFVVEFRPDSDTQFVSVGVKHIKFWTLVGGSLMYKKGVIGSVEDSRVQTMLSVAFGANN--LTFSGAINGDVYVWREHFLVRVVAKAHSGPIFTMYTTLRDGLIVTGGKERRTKEGGAVKLWDQEMKRC-RAFQL--ETGQPVE-------NVRSVCRGKIQGKILVGTKDGEIIEVGEKNAASNTMINGHTHGGIWGLASHPFKDVFISAGDDGTIRIWDL-VDKQKLLNKVSLGHPAKCTSYSPNGEMVSIGMETGEFIVLLVNSLTIWGKKRDRNVSIQDIRFSP-DNRFLAVGSVESAVDFYDLSLGPSLNRIGYCKDISGTVIQMDFSADSRHIQVSTSTYTRQVHEVPSG-KVVTEQNAINRITWASWT-ILGDEVLGVWPRNADKADVNCVCVSHAGLNLASGDDFGLIKLFEFPCPEKFAKHKRYFGHSAHVTNVRFSCDDKFLISAGGSD 1653          

HSP 3 Score: 356.681 bits (914), Expect = 2.730e-99
Identity = 238/637 (37.36%), Postives = 347/637 (54.47%), Query Frame = 3
Query: 4353 LELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFC-TNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETK---MLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTL----SRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVW 6239
            L L+ VH YRGFDCRNNL+Y  ++   +VYH AAVG+V+N     Q F+L H+DDIL LTV  HP  ++ VA+ Q+G  P IHVW++     LS L+G H  G+C+L+F+  G  L+SVGID  H+I +W W+ G  L+KA GH  +IF+ +  P      V VG+KH+KFW  +G  L  +RG     F N  R  TM+S  +  + D  ++GA NG V++W+   L + + KAH GPVF + +  +D   V+GGK+     G ++LWD    R    Y  +   +   S+    LED     IR+I+   G ILLGT++ +ILEI +K G +  L+Q H EG + GLA HP LP  ++ S+D T+RIW+L +    + ++ L  G   C  +SP+G  L +GL  G+F V++A +   ++    R + I+DI+FS     +AV SND+ VDIY + ++  +     C++  S +T     SR     + G+  +    +  G      L +++   +ST T  +                   G    GIWP  S    VN A +S       TGDD+G +KL+S FP  R    A     V  GHS+NVTNVR+ NDDS L+S GG D  + +W
Sbjct:  392 LRLQFVHRYRGFDCRNNLYY--SQTGEVVYHVAAVGVVYNRLQHSQRFYLGHDDDILSLTV--HP-LKDYVASAQVGRDPGIHVWDTQTLNCLSLLRGQHNRGVCALEFTD-GKSLISVGIDESHSIVIWDWKKGERLSKA-GHKDKIFVVKSNPFRMDKLVTVGIKHIKFWQHSGG-LTFRRGI----FGNLGRQETMMSACYGRSEDLLFSGATNGDVYIWRDTTLIKTI-KAHDGPVFAMCS--LDKGFVTGGKD-----GVVELWDDMFERCLKTYAIKRATLSPSSKLL--LEDNPS--IRAITLGHGHILLGTKNGEILEI-DKSGPMTLLVQGHMEGEVWGLAAHPLLPVCATVSDDKTLRIWELSSNHRMVAVRKLKRG--RCCAFSPDGKALAVGLNDGSFLVVNADTLEDMVTFHHRRELISDIRFSQVGKYLAVASNDSFVDIYNVLTSKRV---GVCKATASCITHIDWDSRKLLLVNTGAKELLFFEAPRGRRQNISLTEFEKLDWSTWTSVL-------------------GPTCEGIWPALSF---VNAASLSKDRKLLATGDDFGFLKLFS-FP-SRQGQFAKFKKYV--GHSTNVTNVRWSNDDSVLLSVGGGDTALMIW 972          

HSP 4 Score: 323.168 bits (827), Expect = 9.393e-89
Identity = 157/352 (44.60%), Postives = 233/352 (66.19%), Query Frame = 3
Query:  360 IALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPI---KFVTCGIKHIK--FWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEV 1400
            +A+  D   VATGQVGK P+IC+W++ ++ T SIL+D HTHG++ + F   G  L SVGLD   T+ VWDW++G+VL++   HSDR+FD    V   P+   + V+CG+KHIK  FW+LCGN L+ K+GI+GK G++QTIL  C+S + + + YSG LNGDVY+W+   L R I   H   ++S+ +C  G+ TGG+D C+ L D +F+P+T+IDL+ T  GY  L +RSV W ++  L GTQ S+I E+ V   +KP  LM  H+ GELWAL +HPK+ +  TGSDD S+ +W + +   L    +++ +RS  FN DGS +A+G+ DGSF+V+R+    + ++ +   +V
Sbjct:    1 LAIHPDKIQVATGQVGKDPYICVWDTYAMVTVSILRDVHTHGVACLTFDSDGQRLASVGLDAKNTICVWDWRRGRVLATATGHSDRIFD----VCWDPLQSSRLVSCGVKHIKLQFWTLCGNALTPKRGIFGKTGDLQTIL--CVSAAKDELTYSGALNGDVYVWKGVALVRTIQAAHGAGIFSMHACEEGFATGGRDGCIRLWDVDFKPITKIDLRETEQGY-KLSIRSVCWKADRILAGTQDSEIFEVLVRDRDKPVLLMQSHSEGELWALALHPKQPVAVTGSDDRSV-LWSLPDHTLLARCNMEESVRSVCFNSDGSQLALGMKDGSFTVLRSEGYADSNSGESDSDV 344          

HSP 5 Score: 218.394 bits (555), Expect = 2.257e-56
Identity = 144/370 (38.92%), Postives = 204/370 (55.14%), Query Frame = 3
Query: 2346 LGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIR--FWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVM-MHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHK--------SYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL---STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDI 3413
            L +HP K  +ATG+VG++P I VWDT  M +VSIL+  H  GV  + F SDG++LASVGLD  + + VWDWR+G  LA+   H D+IF + WDP  +++LV+ G+K I+  FWT  G   T KRG FG    L T LC +    K  + Y+G+ +G VY+WK   L   +   H  G +++ A ++GF TGG+DG I+L D  F  + K         YKLS                IRSV     +ILA T   EI E+     D  + +L+Q H EGELW LA+HP + +  T SDD   ++W +   +H L+    ++   R    + DGS +A+G KDGSF VL      + ++S     ++SDI
Sbjct:    1 LAIHPDKIQVATGQVGKDPYICVWDTYAMVTVSILRDVHTHGVACLTFDSDGQRLASVGLDAKNTICVWDWRRGRVLATATGHSDRIFDVCWDPLQSSRLVSCGVKHIKLQFWTLCGNALTPKRGIFGKTGDLQTILCVS--AAKDELTYSGALNGDVYVWKGVALVRTIQAAHGAGIFSMHACEEGFATGGRDGCIRLWDVDFKPITKIDLRETEQGYKLS----------------IRSVCWKADRILAGTQDSEIFEVLVRDRDKPV-LLMQSHSEGELWALALHPKQPVAVTGSDD-RSVLWSL--PDHTLLARCNMEESVRSVCFNSDGSQLALGMKDGSFTVLRSEGYAD-SNSGESDSDVSDI 347          

HSP 6 Score: 195.282 bits (495), Expect = 2.699e-49
Identity = 128/348 (36.78%), Postives = 187/348 (53.74%), Query Frame = 3
Query: 4563 VATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVK--FWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEK-QGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPAT-CVDYSPNGNYLVIGLKSGAFAVLSAQSY 5594
            VATGQ+G  P I VW++     +S L+ VH +G+  L F S G  L SVG+D  +TI VW W  G +LA A GH+ RIF   + P   S  V+ GVKH+K  FWTL G+ L  KRG     F     + T+L V+   ++ TY+GA+NG V+VWK   L R ++ AH   +F +     +    +GG++     G I+LWD +    KP      I++R   ET    E      IRS+     +IL GTQD++I E+L + +     LMQ+H EG L  LA+HP  P   + S+D +V +W L    L+       +   V ++ +G+ L +G+K G+F VL ++ Y
Sbjct:   10 VATGQVGKDPYICVWDTYAMVTVSILRDVHTHGVACLTFDSDGQRLASVGLDAKNTICVWDWRRGRVLATATGHSDRIFDVCWDPLQSSRLVSCGVKHIKLQFWTLCGNALTPKRGI----FGKTGDLQTILCVSAAKDELTYSGALNGDVYVWKGVALVRTIQAAHGAGIFSMHA--CEEGFATGGRD-----GCIRLWDVDF---KPI---TKIDLR---ET----EQGYKLSIRSVCWKADRILAGTQDSEIFEVLVRDRDKPVLLMQSHSEGELWALALHPKQPVAVTGSDDRSV-LWSLPDHTLLARCNMEESVRSVCFNSDGSQLALGMKDGSFTVLRSEGY 332          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000027261.1 (SMESG000027261.1)

HSP 1 Score: 4116.61 bits (10675), Expect = 0.000e+0
Identity = 2021/2029 (99.61%), Postives = 2023/2029 (99.70%), Query Frame = 3
Query:  162 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIIS+ALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSK GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNN LVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVGGGFTTKRGTFGNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQP QMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITD+NSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDS EIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRG SETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAF VLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPEKIEKIIWISWSSVVGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS
Sbjct:    1 MSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISLALASDGELVATGQVGKSPFICIWNSNSLETKSILKDQHTHGISSVAFSKNGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNVLVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNYTRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVGGGFTTKRGTFGNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQPQQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDINSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSDTDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRETNTFVKVQSAALLLKDSAEIGRRSRSNGKTTPRRLISDPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGSSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFVVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPEKIEKIIWISWSSVVGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 2029          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 351.673 bits (901), Expect = 8.126e-104
Identity = 204/607 (33.61%), Postives = 327/607 (53.87%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGK------SPFICIWNSNSLET-KSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY---DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLT 1952
            P+  L ++WVYGYRG  C  NL+Y  +  IVYFVAGI I++++  + Q +Y EH DDI  +AL  D    ATGQV         P + IW+S +L+T  +I        +++V FSK+  G  L++V    +  + +W+W   K + ++++ ++ V +A F  +D  +   TCG  H+ FW L  N L+ K  I+ K  + +   T C++ ++N    +G  +G++Y W   + ++   I   H+G ++S+    +G +   GGKD  +   D   +     +++L+N    N   R++  + +  +VGT  + I+EI  +  +   +L+ GH+  E+W +  HP K  F TG  D  + +W     + L + +++K I+S   + +  L+AIG ++G +S+    +  E+H  +D  E +  ++FSPDG   AVGS DNF+ IY     T    R G C G+SSFITHLDWS D  ++R+NSG  ELL +  P  + +T    L  + W      L  ++ GIW + +D  DINA     N  +IAT DDFG V L+ YP+       +KY GHS+HVT V++  +   L S GG D +I QW L+
Sbjct:  140 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNV-IATCGKNHLAFWILEKNALTKKMAIFEKYEKPK--FTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSN---DNGFCRTIVEIDDKLVVGTTSNAIVEI--TGNDGFDNLLNGHS-DEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 737          

HSP 2 Score: 342.428 bits (877), Expect = 1.323e-100
Identity = 213/621 (34.30%), Postives = 332/621 (53.46%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGR------EPTIHVWDTQTMKSV-SILKGEHERGVCAVDFS-SDGKKL-ASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIW---KDNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQ----RLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D K + + P + L++EWV+GYRG DCR N++YL +G+IV+ VA + I+ N+ ++TQR Y  H DDI C+ LHP K   ATG+V        +P + +W + T++++ +I  G  ER V AV FS SDG KL  +V   ++H + +W+W   + + ++++  + +   +++P ++N +   G   + FW       T K   F    K     C  +  N  G   TG  SG +Y W   K +I  +    H G  +++   + G +   GGKD  I   D  T  K  ++ +LS +N          C   R++V    K++  T+S  I+E++ +   + L+ GH + E+WG+  HPSK    T   D  +++W+     HK++  K+L+   +   +S +   VA+GF +G + + ++T   EI       E I  I+FSP  G   AVGS DNF+ IY   S      R+  C G SS+ITHLDWS+DG  L  NSG  E LF+  P   +Q+ A + +  + W S +C L     GIWP   D TD+N+V+   +  ++AT DDFG+V L+ YP+       K+Y GHS+HVT V++L  D  L S GG DTA++ W
Sbjct:  132 DFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNN--GELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDN--------GFC---RTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSD-EVWGVDSHPSKEQFVTGGHDRKIILWDA--LTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSP-DGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPE-CKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 734          

HSP 3 Score: 279.256 bits (713), Expect = 4.746e-79
Identity = 212/722 (29.36%), Postives = 334/722 (46.26%), Query Frame = 3
Query: 4140 LKPDLVSQTTSNNNLKAS---VSRETNTFVKVQSAALLLKDST-EIGRRSRSNGKTTPRRLIS--DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGA------IPSIHVWNSLDCTKLSTLK-GVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDS-TGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            L+  +VS  T     + S     R TN  V  + A  +  +    I  R R      P  L    D  + + E    L ++ V+GYRG DCR NL+YL      IVY  A + I+HNL +  Q  ++EH DDI C+ +  HP  +   ATGQ+         P + +W+SL    L T+  G     + ++ FS +  G LL++V   NDH I +W W T   +  +   T+ +  AEF P   ++    G  H+ FW L  + L  K          +P+ TT   V F  N    TG  +G+++ W  +   +T  + +AH+GP+F L  +    L+  GGK+      +I  WD    + K     +  N  GF               R+I  +  K+++GT  N I+EI    G    L+  H + V  G+  HP   Q+ +   D  + +WD L  K+L+          +  SPN + + IG   G +++ +   ++ + + KD  + I  I+FSP+ SL AVGS DN + IYK+DS T  +T    C   +S +T                +D+S+DG F+R    DY++  ++    + +     +  + W S +  +  EVAGIWP+ SD  D+N    +H      T DD+G V LY  +P      +  + +  ++GHSS+VT V+F+ +D  L STGG+D  +  W  S
Sbjct:   67 LRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPT--GDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMAL--HPD-KVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEK--YEKPKFTT--CVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDH-----AIFEWDLST-KEKAGRNIQLSNDNGFC--------------RTIVEIDDKLVVGTTSNAIVEITGNDG-FDNLLNGHSDEVW-GVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFIT---------------HLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLY-RYPAC----APKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 737          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 351.673 bits (901), Expect = 1.149e-103
Identity = 204/607 (33.61%), Postives = 327/607 (53.87%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGK------SPFICIWNSNSLET-KSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY---DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLT 1952
            P+  L ++WVYGYRG  C  NL+Y  +  IVYFVAGI I++++  + Q +Y EH DDI  +AL  D    ATGQV         P + IW+S +L+T  +I        +++V FSK+  G  L++V    +  + +W+W   K + ++++ ++ V +A F  +D  +   TCG  H+ FW L  N L+ K  I+ K  + +   T C++ ++N    +G  +G++Y W   + ++   I   H+G ++S+    +G +   GGKD  +   D   +     +++L+N    N   R++  + +  +VGT  + I+EI  +  +   +L+ GH+  E+W +  HP K  F TG  D  + +W     + L + +++K I+S   + +  L+AIG ++G +S+    +  E+H  +D  E +  ++FSPDG   AVGS DNF+ IY     T    R G C G+SSFITHLDWS D  ++R+NSG  ELL +  P  + +T    L  + W      L  ++ GIW + +D  DINA     N  +IAT DDFG V L+ YP+       +KY GHS+HVT V++  +   L S GG D +I QW L+
Sbjct:  147 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNV-IATCGKNHLAFWILEKNALTKKMAIFEKYEKPK--FTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSN---DNGFCRTIVEIDDKLVVGTTSNAIVEI--TGNDGFDNLLNGHS-DEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 744          

HSP 2 Score: 342.428 bits (877), Expect = 1.633e-100
Identity = 213/621 (34.30%), Postives = 332/621 (53.46%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGR------EPTIHVWDTQTMKSV-SILKGEHERGVCAVDFS-SDGKKL-ASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIW---KDNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQ----RLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D K + + P + L++EWV+GYRG DCR N++YL +G+IV+ VA + I+ N+ ++TQR Y  H DDI C+ LHP K   ATG+V        +P + +W + T++++ +I  G  ER V AV FS SDG KL  +V   ++H + +W+W   + + ++++  + +   +++P ++N +   G   + FW       T K   F    K     C  +  N  G   TG  SG +Y W   K +I  +    H G  +++   + G +   GGKD  I   D  T  K  ++ +LS +N          C   R++V    K++  T+S  I+E++ +   + L+ GH + E+WG+  HPSK    T   D  +++W+     HK++  K+L+   +   +S +   VA+GF +G + + ++T   EI       E I  I+FSP  G   AVGS DNF+ IY   S      R+  C G SS+ITHLDWS+DG  L  NSG  E LF+  P   +Q+ A + +  + W S +C L     GIWP   D TD+N+V+   +  ++AT DDFG+V L+ YP+       K+Y GHS+HVT V++L  D  L S GG DTA++ W
Sbjct:  139 DFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNN--GELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDN--------GFC---RTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSD-EVWGVDSHPSKEQFVTGGHDRKIILWDA--LTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSP-DGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPE-CKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 741          

HSP 3 Score: 278.87 bits (712), Expect = 5.862e-79
Identity = 207/699 (29.61%), Postives = 326/699 (46.64%), Query Frame = 3
Query: 4200 RETNTFVKVQSAALLLKDST-EIGRRSRSNGKTTPRRLIS--DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGA------IPSIHVWNSLDCTKLSTLK-GVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDS-TGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            R TN  V  + A  +  +    I  R R      P  L    D  + + E    L ++ V+GYRG DCR NL+YL      IVY  A + I+HNL +  Q  ++EH DDI C+ +  HP  +   ATGQ+         P + +W+SL    L T+  G     + ++ FS +  G LL++V   NDH I +W W T   +  +   T+ +  AEF P   ++    G  H+ FW L  + L  K          +P+ TT   V F  N    TG  +G+++ W  +   +T  + +AH+GP+F L  +    L+  GGK+      +I  WD    + K     +  N  GF               R+I  +  K+++GT  N I+EI    G    L+  H + V  G+  HP   Q+ +   D  + +WD L  K+L+          +  SPN + + IG   G +++ +   ++ + + KD  + I  I+FSP+ SL AVGS DN + IYK+DS T  +T    C   +S +T                +D+S+DG F+R    DY++  ++    + +     +  + W S +  +  EVAGIWP+ SD  D+N    +H      T DD+G V LY  +P      +  + +  ++GHSS+VT V+F+ +D  L STGG+D  +  W  S
Sbjct:   97 RSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPT--GDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMAL--HPD-KVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEK--YEKPKFTT--CVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDH-----AIFEWDLST-KEKAGRNIQLSNDNGFC--------------RTIVEIDDKLVVGTTSNAIVEITGNDG-FDNLLNGHSDEVW-GVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFIT---------------HLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLY-RYPAC----APKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 744          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 352.829 bits (904), Expect = 1.200e-102
Identity = 204/607 (33.61%), Postives = 327/607 (53.87%), Query Frame = 3
Query:  180 PNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGK------SPFICIWNSNSLET-KSILKDQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYVT--GGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIY---DATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLT 1952
            P+  L ++WVYGYRG  C  NL+Y  +  IVYFVAGI I++++  + Q +Y EH DDI  +AL  D    ATGQV         P + IW+S +L+T  +I        +++V FSK+  G  L++V    +  + +W+W   K + ++++ ++ V +A F  +D  +   TCG  H+ FW L  N L+ K  I+ K  + +   T C++ ++N    +G  +G++Y W   + ++   I   H+G ++S+    +G +   GGKD  +   D   +     +++L+N    N   R++  + +  +VGT  + I+EI  +  +   +L+ GH+  E+W +  HP K  F TG  D  + +W     + L + +++K I+S   + +  L+AIG ++G +S+    +  E+H  +D  E +  ++FSPDG   AVGS DNF+ IY     T    R G C G+SSFITHLDWS D  ++R+NSG  ELL +  P  + +T    L  + W      L  ++ GIW + +D  DINA     N  +IAT DDFG V L+ YP+       +KY GHS+HVT V++  +   L S GG D +I QW L+
Sbjct:  290 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNV-IATCGKNHLAFWILEKNALTKKMAIFEKYEKPK--FTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSN---DNGFCRTIVEIDDKLVVGTTSNAIVEI--TGNDGFDNLLNGHS-DEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 887          

HSP 2 Score: 343.199 bits (879), Expect = 2.107e-99
Identity = 213/621 (34.30%), Postives = 332/621 (53.46%), Query Frame = 3
Query: 2142 DGKKRKKAPSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGR------EPTIHVWDTQTMKSV-SILKGEHERGVCAVDFS-SDGKKL-ASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIW---KDNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCD-ETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQ----RLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW 3947
            D K + + P + L++EWV+GYRG DCR N++YL +G+IV+ VA + I+ N+ ++TQR Y  H DDI C+ LHP K   ATG+V        +P + +W + T++++ +I  G  ER V AV FS SDG KL  +V   ++H + +W+W   + + ++++  + +   +++P ++N +   G   + FW       T K   F    K     C  +  N  G   TG  SG +Y W   K +I  +    H G  +++   + G +   GGKD  I   D  T  K  ++ +LS +N          C   R++V    K++  T+S  I+E++ +   + L+ GH + E+WG+  HPSK    T   D  +++W+     HK++  K+L+   +   +S +   VA+GF +G + + ++T   EI       E I  I+FSP  G   AVGS DNF+ IY   S      R+  C G SS+ITHLDWS+DG  L  NSG  E LF+  P   +Q+ A + +  + W S +C L     GIWP   D TD+N+V+   +  ++AT DDFG+V L+ YP+       K+Y GHS+HVT V++L  D  L S GG DTA++ W
Sbjct:  282 DFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNN--GELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDN--------GFC---RTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSD-EVWGVDSHPSKEQFVTGGHDRKIILWDA--LTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPD-GSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPE-CKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 884          

HSP 3 Score: 277.33 bits (708), Expect = 3.101e-77
Identity = 207/699 (29.61%), Postives = 327/699 (46.78%), Query Frame = 3
Query: 4200 RETNTFVKVQSAALLLKDST-EIGRRSRSNGKTTPRRLIS--DPPNPVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGA------IPSIHVWNSLDCTKLSTLK-GVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWD-LETKMLIQSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDS-TGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS 6248
            R TN  V  + A  +  +    I  R R      P  L    D  + + E    L ++ V+GYRG DCR NL+YL      IVY  A + I+HNL +  Q  ++EH DDI C+ +  HP  +   ATGQ+         P + +W+SL    L T+  G     + ++ FS +  G LL++V   NDH I +W W T   +  +   T+ +  AEF P   ++    G  H+ FW L  + L  K      +   +P+ TT   V F  N    TG  +G+++ W  +   +T  + +AH+GP+F L  +    L+  GGK+      +I  WD    + K     +  N  GF               R+I  +  K+++GT  N I+EI    G    L+  H + V  G+  HP   Q+ +   D  + +WD L  K+L+          +  SPN + + IG   G +++ +   ++ + + KD  + I  I+FSP+ SL AVGS DN + IYK+DS T  +T    C   +S +T                +D+S+DG F+R    DY++  ++    + +     +  + W S +  +  EVAGIWP+ SD  D+N    +H      T DD+G V LY  +P      +  + +  ++GHSS+VT V+F+ +D  L STGG+D  +  W  S
Sbjct:  240 RSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPT--GDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMAL--HPD-KVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIF--EKYEKPKFTT--CVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDH-----AIFEWDLST-KEKAGRNIQLSNDNGFC--------------RTIVEIDDKLVVGTTSNAIVEITGNDG-FDNLLNGHSDEVW-GVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFIT---------------HLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLY-RYPA----CAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS 887          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 303.138 bits (775), Expect = 1.562e-85
Identity = 193/625 (30.88%), Postives = 319/625 (51.04%), Query Frame = 3
Query:  174 LAPNSQ--LTLDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGK------SPFICIWNSNSLETKSILK-DQHTHGISSVAFSKT--GMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIW--RENNLERVIATVHSGALYSIESCASGYVT--GGKD----------SCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNALVGTQGSDIIEIPVSTPNKP---KSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRT--RDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYDATAS---FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRL 1949
            LAP +   L L+WVYGYRG    NN+++  + +IVYF+A + I+Y+++++ Q +Y  H DD+ SIA+  D   +ATGQV         P I IW+S +L T  ++        I  ++FSK   GM + +V       L++W W+K + +   ++ ++ +    F   +     +TCG  H+ FW+   N LS K+ +Y K  + + IL  C +  DN    +G  +G++ +W    + +E+++ T H G ++S+    +  +   GGKD          +C+     +  P T   +++ + G   +I           LVG+  S I++  + + ++    +S++ GH   E+W L  HPK+  F T   D  L  W    R  +      + + S  F+    +I IG   G + VI T  R+M+ VH   D  E +  ++FS DG  LA+GS DN + +Y+ + +   + R G C G+SSFITH+DWS +  ++R+NSG  E+L + +     +     +  I WA     +     GIW++  D  DINA D   +  ++ + DDFG V L++YP P       ++ GHS+HVTNV++ FD   +IS GG D SI QW +
Sbjct:  317 LAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNK-SIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFIL--CQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCE--KTLPETHGAIRMLSQGPGGMI-----------LVGSTKSSILQFHLQSNSQSMEFRSIVDGHVE-EMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHT--DGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 922          

HSP 2 Score: 289.656 bits (740), Expect = 4.189e-81
Identity = 193/619 (31.18%), Postives = 303/619 (48.95%), Query Frame = 3
Query: 2163 APSQGLQLEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIATGEVGR------EPTIHVWDTQTMKSVSILK-GEHERGVCAVDFS-SDGKKL-ASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVXXXXXXXXXXXXNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWK---DNILQSAVMMHEGGCYAIDALDKGFVT--GGKDGTIKLCDETFTKVHKSYKLSPENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMEL-----STDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYS----AISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDITDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVWK 3950
            A  + L+LEWV+GYRG D RNN+++L +GEIV+ +AAV I+ N+  +TQR Y  H DD+  + +HP K  IATG+V        +P I +W +  + ++ ++  G+ ER +C + FS +DG  L  +V   + H+L +W W K  ++   ++  + I  + + P NN  ++  G   + FW       + K+  +    K    LC A+  N  G   TG  SG + +W      + +     HEG  +++       +   GGKD  IK        +    K  PE     +MLS             G IL  ++   I++      S       +V GH E E+WGLA HP ++   TV  D  L  W+       LI  K+                + +G   G ++V+   +   +       E+I  ++FS   G+ LA+GS DN + +Y+       + R   C G SS+ITH+DWST+G+ L  NSG  E L++ +    RQ+ +  +I  I WA+ +C +  S  GIW    D TD+N+V       VL + DDFGRV L+ YP         Q+ GHS+HVTNV++L +D  ++S GG D+++M W+
Sbjct:  320 AAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDN--GELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACI-GCEKTLPETHGAIRMLSQG---------PGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVE-EMWGLATHPKQHRFVTVGYDKLLCYWD--SLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFS-TDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNS-STCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWE 921          

HSP 3 Score: 240.35 bits (612), Expect = 9.106e-65
Identity = 185/647 (28.59%), Postives = 313/647 (48.38%), Query Frame = 3
Query: 4353 LELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGA------IPSIHVWNSLDCTKLSTLK-GVHINGICSLDFSST--GTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVW--KSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSETAKPLEDKSMEVIRSISR-VKGKILLGTQDNDILEILEKQGT----VKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLI-QSLTTGPATCVDYSPNGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDFSTDGNFIRCGLEDYKVKIYSTSTGQIVNEPXXXXXXXXXXXXXXXGEEVAGIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAMLPNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWK 6242
            L+L+ V+GYRG D RNN+++L      IVY  AAV I++N++   Q  +L H DD+  + +  HP  +  +ATGQ+         P I +W+S++   L  +  G     IC L FS    G L+ +V   N+H +++W+WE    + +A   T+ I   +F P ++   +  G  H+ FW    ++L  K+     +   +P+   +L  AF  N    TG  +G++ +W  ++  + +IV  AH GP+F L  T    L+  GGK++      IK W   +               G  +T      ++   IR +S+   G IL+G+  + IL+   +  +     + ++  H E  + GLA HP   ++ +   D  +  WD  T+ LI +   T     V + P    ++IG  +G + V+   +  ++    D  ++I  ++FS +   +A+GS DN + +Y +   G                 SR   C    S    ID+ST+G F+R    DY+V  +++ST + V   ++I  I W + +  +    AGIW +  D  D+N     H      + DD+G V LY S+P P    ++ +P+  FRGHSS+VTNV+F+ DDS ++S+GG+D  +  W+
Sbjct:  325 LKLEWVYGYRGRDSRNNVYFLPT--GEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAI--HPD-KITIATGQVAGHSKNQGKPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKN--EKPKF--ILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDR-----KIKEWSSLLA------------CIGCEKTLP----ETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEE-MWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNG--------------YKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLY-SYPFP----NSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWE 921          
The following BLAST results are available for this feature:
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML60.000e+050.86EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
EML60.000e+050.86EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
EML51.800e-11548.56EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197][more]
EML52.222e-11548.41EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197][more]
EML66.632e-10652.62EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp-11.036e-4025.12Echinoderm microtubule-associated protein-like elp... [more]
elp-11.036e-4025.12Echinoderm microtubule-associated protein-like elp... [more]
elp-11.529e-4025.12Echinoderm microtubule-associated protein-like elp... [more]
elp-11.529e-4025.12Echinoderm microtubule-associated protein-like elp... [more]
pfs-23.408e-1130.77Polyadenylation Factor Subunit homolog [Source:Un... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCX-EMAP7.985e-5326.01gene:FBgn0259099 transcript:FBtr0299510[more]
DCX-EMAP1.298e-5226.01gene:FBgn0259099 transcript:FBtr0330139[more]
DCX-EMAP6.826e-5225.50gene:FBgn0259099 transcript:FBtr0299509[more]
DCX-EMAP6.992e-5225.50gene:FBgn0259099 transcript:FBtr0331181[more]
CG341248.134e-1522.29gene:FBgn0083960 transcript:FBtr0110838[more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML51.544e-11948.12si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
EML53.398e-10450.26si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
EML60.000e+048.95EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML62.742e-9749.02EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML62.990e-9749.02EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML60.000e+050.96echinoderm microtubule associated protein like 6 [... [more]
EML61.135e-10550.61echinoderm microtubule associated protein like 6 [... [more]
EML60.000e+049.58echinoderm microtubule associated protein like 6 [... [more]
EML51.280e-9946.88echinoderm microtubule associated protein like 5 [... [more]
EML52.012e-9946.69echinoderm microtubule associated protein like 5 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eml60.000e+050.42echinoderm microtubule associated protein like 6 [... [more]
Eml51.182e-11348.37echinoderm microtubule associated protein like 5 [... [more]
Eml51.826e-11347.44echinoderm microtubule associated protein like 5 [... [more]
Eml25.136e-10836.13echinoderm microtubule associated protein like 2 [... [more]
Eml15.438e-10835.19echinoderm microtubule associated protein like 1 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZMW3|EMAL6_HUMAN0.000e+050.86Echinoderm microtubule-associated protein-like 6 O... [more]
sp|Q5SQM0|EMAL6_MOUSE0.000e+050.42Echinoderm microtubule-associated protein-like 6 O... [more]
sp|Q05BV3|EMAL5_HUMAN8.644e-11548.56Echinoderm microtubule-associated protein-like 5 O... [more]
sp|Q6ED65|EMAL5_RAT6.195e-11348.37Echinoderm microtubule-associated protein-like 5 O... [more]
sp|Q8BQM8|EMAL5_MOUSE8.266e-11348.37Echinoderm microtubule-associated protein-like 5 O... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I0920.000e+054.24echinoderm microtubule-associated protein-like 6 O... [more]
K1QFE30.000e+053.10Echinoderm microtubule-associated protein-like 6 O... [more]
A0A267FUT00.000e+051.97Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210QCE40.000e+052.81Echinoderm microtubule-associated protein-like 6 O... [more]
R7U6W82.672e-11652.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML60.000e+049.26EMAP like 6 [Source:NCBI gene;Acc:103028254][more]
ENSAMXT00000009461.20.000e+048.48pep primary_assembly:Astyanax_mexicanus-2.0:21:199... [more]
si:dkey-1f12.34.034e-11948.15EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197][more]
eml22.110e-11736.51echinoderm microtubule-associated protein-like 2 [... [more]
eml26.588e-11736.66echinoderm microtubule-associated protein-like 2 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006396.14.668e-10354.61pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene... [more]
ENSPMAT00000001632.12.662e-10033.77pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
ENSPMAT00000002683.12.345e-5035.40pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene... [more]
ENSPMAT00000006636.11.422e-4034.73pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1... [more]
ENSPMAT00000009467.16.583e-1826.64pep scaffold:Pmarinus_7.0:GL478507:38111:45670:1 g... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUP14.073e-723.61General repressor of transcription; forms complex ... [more]
PRP45.071e-727.97Splicing factor; component of the U4/U6-U5 snRNP c... [more]
CDC201.454e-631.25Activator of anaphase-promoting complex/cyclosome ... [more]
TAF51.543e-629.03Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484871.067e-16252.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423947.069e-8031.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310139.642e-6328.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498771.198e-6227.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360684.627e-1920.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1f12.32.070e-11348.36EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
si:dkey-1f12.37.514e-11248.24EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
si:dkey-1f12.34.514e-10250.37EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
EML63.526e-13250.15echinoderm microtubule-associated protein-like 6 [... [more]
ENSORLT00000038928.12.730e-9947.19echinoderm microtubule-associated protein-like 6 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027261.10.000e+099.61SMESG000027261.1[more]
SMESG000021391.18.126e-10433.61SMESG000021391.1[more]
SMESG000021391.11.149e-10333.61SMESG000021391.1[more]
SMESG000021391.11.200e-10233.61SMESG000021391.1[more]
SMESG000003186.11.562e-8530.88SMESG000003186.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010316 ID=SMED30010316|Name=Echinoderm microtubule-associated protein-like 4|organism=Schmidtea mediterranea sexual|type=transcript|length=6541bp
TATTTTAAAATAATTTTATTAATTACTAAACTAATAAAAAAATTTAATTT
AATTGAAATAATTAATTATTGTATGACTAAACCATATTTTTATATGGAAA
ATTTTTTTCACTAGCTGAATAAATTCAAATGATAATTGTCAATGAATTTC
AAATATTTGAAATGTCTAATAAATTGGCACCTAATTCTCAGTTGACACTT
GATTGGGTTTATGGTTATAGAGGCCATCAATGCCATAATAATCTGTTTTA
TACAAATTCTGAAAAAATTGTTTATTTTGTAGCTGGTATTGGTATTGTTT
ATGATATTAAACAACGCAAACAATTTTATTATTTTGAACATAATGATGAT
ATAATCAGTATTGCATTGGCTTCGGATGGTGAGTTAGTTGCAACTGGTCA
AGTTGGAAAATCACCATTCATTTGTATTTGGAACTCAAACAGTTTGGAAA
CTAAATCGATATTGAAAGATCAACATACTCATGGAATATCATCAGTGGCT
TTTAGCAAAACTGGAATGTATTTGCTCAGTGTTGGCTTGGATCCGAATGC
CACTTTGAACGTTTGGGATTGGAAAAAAGGCAAAGTGTTAAGTTCAACAA
GAGCTCACTCTGATCGGGTATTCGATGCGCGGTTCATGGTGTCTGATGGG
CCCATTAAGTTTGTTACTTGTGGCATCAAGCATATCAAATTCTGGTCACT
CTGCGGCAATACCCTCTCATCAAAGAAAGGAATTTATGGAAAGAAGGGAG
AAATACAGACAATTCTAACCGTATGCATGTCAATATCCGACAATGCCGTT
TGTTACTCGGGAACACTGAATGGGGATGTCTATATTTGGAGAGAAAATAA
TTTGGAAAGAGTCATAGCAACTGTCCACAGTGGAGCGTTGTATTCGATTG
AAAGTTGTGCTTCGGGCTATGTTACGGGTGGCAAGGACAGCTGTGTAGTG
TTGCATGATCCGGAATTCCAGCCTATGACGAGAATAGATCTCAAATTGAC
AAATATTGGTTATCCCAATTTAATTGTGAGGAGTGTACATTGGCTCTCCA
ACAATGCACTCGTTGGTACACAAGGCAGTGACATTATTGAGATTCCAGTC
TCAACACCAAATAAGCCGAAAAGTTTAATGATGGGCCATGCCGCGGGAGA
ACTGTGGGCTTTGGGCGTTCATCCTAAAAAGTCGATTTTCGCTACCGGTA
GTGATGATTGCAGTTTACGGATATGGCAAATGAATGAACGAGAACCACTG
ACAACCTTGCGAATCGACAAGAAGATCCGATCCTGTGGATTCAACCACGA
TGGATCTTTAATCGCAATTGGAATAATGGATGGCAGTTTCTCAGTTATCA
GAACTCGTGACATGATAGAAGTCCACAATGCTCAAGATAGGAAGGAAGTA
TTGCACGAATTGAAGTTTTCTCCCGACGGTCATTGGTTAGCTGTTGGTTC
CAATGATAATTTTGTCGATATATACGATGCTACAGCTTCCTTCAAACGCA
CCGGTGTCTGCAAAGGGAACTCGAGTTTCATAACTCATCTTGATTGGTCT
TTAGACAGTACGTACATTCGAACCAATAGCGGAGCAGCCGAACTTTTGAT
TTTTAAAGCACCTGGTGGCGAGCATATCACACAGACTCAATTGTTGACCA
GTATCAAATGGGCCATGTTTACTGGAGTACTAGGAACTGATATTCAAGGG
ATCTGGGCTAAGTATACCGATACAAACGATATCAATGCGGCTGATGTCAA
TCTGAATGCCAATCTGATTGCTACTGGTGATGATTTTGGATTAGTGAAGC
TATTTAATTATCCATCACCAACGAAAGGAGCTCATTTTCGAAAGTACACC
GGTCATTCTGCTCACGTAACCAACGTCAGGTGGTCATTTGATAAGAAATT
TCTCATTTCAATTGGAGGGGGTGATCAGTCTATTTTTCAGTGGCGTTTGA
CCGATGCGATATCGGGTAGTGGGGACATCAATCACCAAGTTGATTCATTT
ACTGACGGAAGTGATTCGGGACTATCAGATATTGGAGCTTGTAATTCTGA
ACTGGAAAAAGAGGCTCAGACAAACTATACAAGATTGGTCAGCAAAGATG
AAGTCAATCAGTTACAGAAAGTTACAAAGAGTGATATTGAGGATGGGAAA
AAGCGAAAAAAAGCTCCAAGCCAAGGATTGCAATTAGAATGGGTTCATGG
GTATCGAGGATATGACTGTCGGAATAATATATTCTATCTACAAAGTGGAG
AGATTGTATTTCATGTTGCTGCAGTTGGAATCGTAATGAATATTGCAAGT
AAAACTCAAAGGTTTTATGCCTCCCATAATGATGATATTCTATGTCTTGG
TCTTCATCCTTTGAAAGATTTAATAGCGACTGGAGAGGTGGGCCGAGAAC
CAACTATTCATGTTTGGGACACGCAGACAATGAAATCGGTTTCAATACTT
AAAGGCGAACATGAGCGTGGGGTTTGTGCTGTGGACTTTTCAAGTGACGG
AAAAAAGCTAGCTAGTGTTGGGTTGGATGACAATCATTTACTGGTGGTTT
GGGATTGGAGGAAAGGTGAAAAATTGGCATCCACAAGGGCACACAAAGAT
AAAATATTTATGATAAAATGGGATCCTCATAACAACAACCAACTTGTAGC
TGTAGGAATGAAGTTTATCCGATTCTGGACCCAAGTTGGTGGAGGATTCA
CTACTAAAAGAGGCACCTTTGGAAATGTAGCAAAGTTAGACACACAGTTG
TGCGCAGCATATAACCCCAATAAACCTGGTGTTTGTTATACTGGAAGTCC
AAGTGGTCTAGTATATATCTGGAAAGATAATATTTTACAATCTGCTGTTA
TGATGCACGAAGGAGGTTGTTATGCAATAGACGCTCTTGACAAAGGGTTC
GTTACTGGGGGAAAGGATGGTACAATTAAATTGTGTGATGAAACATTTAC
AAAGGTTCACAAGTCATATAAACTAAGTCCTGAAAATCTTCAACCTCCGC
AAATGCTATCAAGTGCTTGTCCTACCATTAGATCCGTAGTATTGGGTAAA
GGGAAAATTTTAGCGTCAACTAGTTCCGGTGAAATCATGGAACTCAGCAC
CGATGGTACAATAAATATTCTCGTTCAGGGTCATGGCGAAGGTGAACTAT
GGGGTTTGGCAGTTCATCCTTCAAAGAATATATGTGCAACCGTTTCTGAT
GATTGTTACCTGATGATATGGGAAGTAGAACCGAGCAACCACAAATTAAT
TAAATTGAAAAAGTTGAAAGGTCCTGCTAGGTGTTGCGATATTAGCTGTG
ATGGGTCCGCTGTTGCAGTTGGATTTAAAGACGGAAGTTTCTTGGTGTTG
AGCTTGACGAGCCTTGGTGAAATAGCTTCCAGCCACCATAGGAAAGAGGA
AATATCAGATATTAAATTTTCACCCGCTCCAGGAAAATATTTGGCTGTTG
GATCTCACGATAATTTTGTCGACATATATAGTGCAATATCTCATCAGAGA
TTAAGTGTTTGTAAGGGTTGCTCTAGCTATATTACTCATCTCGATTGGAG
TACAGACGGAAAATTATTAATGGTAAACAGCGGAGCAAAGGAACAGTTAT
TTTTTGAAGCACCTAGAGGAACTCGTCAGATTATCGCCAAGACAGAAATT
GAGAAAATTATTTGGGCCTCTTGGAGTTGCGTTTTGGGGGATTCGTGTAT
TGGTATCTGGCCACCGAAATGCGATATTACCGATGTCAATTCGGTCTCCT
TAACAAGTGATGGTAAAGTCTTAGCGACCGGAGATGATTTCGGCCGTGTT
AAGTTGTTTGAATATCCTTCAAAAACAAAATTTGCCAAATTCAAGCAATA
TCTTGGGCACTCAGCTCATGTGACAAATGTCCGATGGTTACACAATGATG
AGTACTTGTTAAGTGTTGGAGGGGCCGATACTGCTCTCATGGTCTGGAAG
CATCGTAGAGATCCAGTTCCGTTGGAGGATTCCATAAATAATAAAAAAAT
CAACATGCCGCAAAGTGATCTAAGTGATACTGATAGCGAAGAAGAGAATG
GCTTCGACAGCGATGTGGAAAGAGAAAAGTCAATGGATTATATAGCTAAA
ACGTATTCTGAACGCCTTAATCAACAGCAAACTGAATCTTTGAAACCTGA
TTTAGTTTCTCAAACCACTAGCAATAATAATTTAAAGGCGAGTGTGAGTC
GAGAAACAAACACTTTTGTGAAAGTCCAGTCAGCAGCTTTATTATTGAAA
GACTCAACAGAGATTGGCAGGAGATCTCGATCAAATGGTAAAACTACCCC
GAGACGTTTGATCTCAGATCCACCTAATCCAGTTATTGAAAAAGTCACTC
AGTTAGAATTAAAACATGTTCATGGCTATCGCGGATTCGATTGCCGCAAC
AATCTTCATTACCTGGATGCAGAAGGATCATCTATTGTCTATCATGCTGC
GGCGGTTGGGATCGTACATAATTTGCAATCAGGGCAACAATCATTCTTTC
TCGAACACAACGATGACATCCTATGCCTAACCGTTAATAGGCACCCCAAG
TACAGGAATGTTGTTGCTACTGGTCAAATCGGTGCCATACCTTCCATTCA
TGTCTGGAATTCGTTAGATTGCACCAAATTGAGCACCCTAAAGGGGGTTC
ATATAAATGGAATATGTTCTCTGGATTTCAGCAGCACCGGTACACTTCTT
CTTTCGGTTGGCATTGATAATGATCACACAATTGCAGTCTGGAAATGGGA
AACCGGAACTTTGTTAGCAAAGGCAAACGGCCATACTCAAAGAATATTTT
TAGCGGAATTTCGACCGGATTCAGACTCGATCTTTGTTAACGTTGGAGTT
AAACATGTCAAATTTTGGACACTAGCAGGGTCCGAATTGATTGCCAAACG
GGGAAGGATTCCATCGGACTTTGTAAACCAACCGAGAATGACCACAATGC
TCAGTGTTGCTTTTTGCACAAATGACACGACTTACACTGGAGCTATGAAT
GGTTCTGTATGGGTCTGGAAATCAGGCGTTTTGACTCGCATTGTGGAGAA
AGCTCATTCTGGACCGGTTTTTGTCTTGTTCACGACATTGGTTGACGGCT
TAATTGTAAGTGGTGGCAAAGAAAAAGGCAAAGACACTGGTAGTATCAAA
TTGTGGGATCAAGAAATGATTAGAAATAAACCTTTTTATTTGGCCGAAGA
TATTAATGTCCGTGGATTTTCAGAAACGGCGAAACCTTTGGAAGATAAAT
CTATGGAAGTTATACGATCTATTTCTCGGGTTAAAGGGAAAATTCTTTTA
GGCACACAGGATAATGATATATTAGAAATATTAGAAAAACAAGGAACAGT
AAAATATCTGATGCAGGCGCATGGTGAAGGCGTTCTCTGTGGTCTGGCGG
TACATCCATTTCTCCCGCAATATTCATCAGCTAGTGAAGATGGAACGGTT
CGGATTTGGGATCTGGAAACCAAAATGCTTATTCAAAGTTTGACCACGGG
ACCTGCAACATGTGTTGATTATTCCCCCAATGGAAATTACTTAGTTATCG
GACTTAAGTCCGGAGCTTTCGCTGTTCTCTCTGCACAATCATACCGATTA
TTAATACGTAAAAAAGACCGAGGAAAACAAATTACCGACATAAAATTTAG
CCCTAACAGTTCACTAATAGCCGTGGGATCCAATGATAATGTGGTGGACA
TTTATAAATTGGATTCAACCGGAGGCATCACATCTCCATCTCCCTGTCAA
TCACCGAATAGCGTGGTAACTTTATCTCGCCCTACTTATTGCAAGGATCT
TGGCAGTCCGGCAGTCCAAATTGACTTTTCGACTGATGGAAACTTCATTC
GATGTGGTCTGGAAGATTATAAAGTGAAAATTTATTCTACATCAACCGGA
CAGATTGTTAATGAACCGGAAAAAATCGAGAAAATAATCTGGATCAGTTG
GTCGAGTGTAGTTGGGGAGGAAGTGGCTGGAATCTGGCCGGACAAATCCG
ATAAGGCTGATGTGAATACAGCAGTGGTGAGCCACCAGAGCAATGCATTC
GTTACGGGAGATGATTACGGTCTTGTGAAGCTTTATTCTTCTTTTCCTGT
TCCACGAATCAACAACTCTGCCATGCTACCCAATGGAGTTTTCCGAGGTC
ACTCATCCAATGTTACCAATGTACGATTTGTTAATGATGATAGCCATTTA
GTGAGTACAGGAGGCGAAGATTGCTGCGTGTTCGTGTGGAAATGCAGCTG
ATACCTGCCATACCGTCAAAATGCTTGCTTAATTATATTTAGTTCTAATA
TATTCTTTATTACATATCTTTTATCTATGATTTGCTTTTTATTTGATGTC
TAATTTTGATATGATGCAAATATATTTTTATATTATGAGATTAAGATGTT
TTTAACTTAATAATTAAATTGTTCTTGGATCAAATATTTCTACAAATTAA
TTCAGGCGTCCGTGGGGCACCATACAAGAAAGACATTTGGAAAACTTATA
ATATTTACAGGACACAACAGGAAACAAACATAGAGTTGTTG
back to top

protein sequence of SMED30010316-orf-1

>SMED30010316-orf-1 ID=SMED30010316-orf-1|Name=SMED30010316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2041bp
MIIVNEFQIFEMSNKLAPNSQLTLDWVYGYRGHQCHNNLFYTNSEKIVYF
VAGIGIVYDIKQRKQFYYFEHNDDIISIALASDGELVATGQVGKSPFICI
WNSNSLETKSILKDQHTHGISSVAFSKTGMYLLSVGLDPNATLNVWDWKK
GKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSKK
GIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVH
SGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIV
RSVHWLSNNALVGTQGSDIIEIPVSTPNKPKSLMMGHAAGELWALGVHPK
KSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIM
DGSFSVIRTRDMIEVHNAQDRKEVLHELKFSPDGHWLAVGSNDNFVDIYD
ATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHI
TQTQLLTSIKWAMFTGVLGTDIQGIWAKYTDTNDINAADVNLNANLIATG
DDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQ
SIFQWRLTDAISGSGDINHQVDSFTDGSDSGLSDIGACNSELEKEAQTNY
TRLVSKDEVNQLQKVTKSDIEDGKKRKKAPSQGLQLEWVHGYRGYDCRNN
IFYLQSGEIVFHVAAVGIVMNIASKTQRFYASHNDDILCLGLHPLKDLIA
TGEVGREPTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLD
DNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFW
TQVGGGFTTKRGTFGNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKD
NILQSAVMMHEGGCYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLS
PENLQPPQMLSSACPTIRSVVLGKGKILASTSSGEIMELSTDGTINILVQ
GHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPA
RCCDISCDGSAVAVGFKDGSFLVLSLTSLGEIASSHHRKEEISDIKFSPA
PGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVN
SGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVLGDSCIGIWPPKCDI
TDVNSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTN
VRWLHNDEYLLSVGGADTALMVWKHRRDPVPLEDSINNKKINMPQSDLSD
TDSEEENGFDSDVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNN
NLKASVSRETNTFVKVQSAALLLKDSTEIGRRSRSNGKTTPRRLISDPPN
PVIEKVTQLELKHVHGYRGFDCRNNLHYLDAEGSSIVYHAAAVGIVHNLQ
SGQQSFFLEHNDDILCLTVNRHPKYRNVVATGQIGAIPSIHVWNSLDCTK
LSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKAN
GHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLAGSELIAKRGRIPSDFVN
QPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVL
FTTLVDGLIVSGGKEKGKDTGSIKLWDQEMIRNKPFYLAEDINVRGFSET
AKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILEKQGTVKYLMQAHGE
GVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPATCVDYSP
NGNYLVIGLKSGAFAVLSAQSYRLLIRKKDRGKQITDIKFSPNSSLIAVG
SNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTYCKDLGSPAVQIDF
STDGNFIRCGLEDYKVKIYSTSTGQIVNEPEKIEKIIWISWSSVVGEEVA
GIWPDKSDKADVNTAVVSHQSNAFVTGDDYGLVKLYSSFPVPRINNSAML
PNGVFRGHSSNVTNVRFVNDDSHLVSTGGEDCCVFVWKCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR005108HELP
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
IPR011041Quinoprot_gluc/sorb_DH
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
GO:0008017microtubule binding
Vocabulary: cellular component
TermDefinition
GO:0015630microtubule cytoskeleton
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 150..190
e-value: 3.6
score: 13.5
coord: 723..764
e-value: 3.4
score: 13.6
coord: 991..1032
e-value: 0.11
score: 21.7
coord: 1036..1075
e-value: 12.0
score: 10.2
coord: 1497..1539
e-value: 0.055
score: 22.6
coord: 1595..1631
e-value: 220.0
score: 2.3
coord: 239..277
e-value: 16.0
score: 9.4
coord: 1187..1228
e-value: 9.4
score: 10.9
coord: 566..606
e-value: 0.13
score: 21.4
coord: 327..367
e-value: 0.0012
score: 28.1
coord: 901..937
e-value: 1.5
score: 16.0
coord: 1998..2038
e-value: 2.4E-4
score: 30.4
coord: 1121..1160
e-value: 54.0
score: 6.1
coord: 454..493
e-value: 16.0
score: 9.3
coord: 105..147
e-value: 0.014
score: 24.6
coord: 812..851
e-value: 0.98
score: 17.0
coord: 1234..1274
e-value: 0.26
score: 20.4
coord: 522..560
e-value: 160.0
score: 3.0
coord: 1875..1920
e-value: 21.0
score: 8.6
coord: 411..450
e-value: 0.77
score: 17.7
coord: 1821..1860
e-value: 0.13
score: 21.3
coord: 1542..1581
e-value: 13.0
score: 9.9
coord: 1451..1494
e-value: 29.0
score: 7.8
coord: 1078..1118
e-value: 0.9
score: 17.3
coord: 370..408
e-value: 1.9
score: 15.3
coord: 767..809
e-value: 3.6E-4
score: 29.8
coord: 1781..1818
e-value: 1.4
score: 16.0
coord: 206..238
e-value: 120.0
score: 3.9
coord: 1946..1987
e-value: 65.0
score: 5.6
coord: 1632..1677
e-value: 23.0
score: 8.4
coord: 863..899
e-value: 2.2
score: 14.9
coord: 62..102
e-value: 0.97
score: 17.1
coord: 1738..1778
e-value: 0.034
score: 23.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 772..809
e-value: 0.2
score: 12.6
coord: 420..450
e-value: 0.069
score: 14.1
coord: 1746..1778
e-value: 0.035
score: 15.0
coord: 569..605
e-value: 3.5E-4
score: 21.3
coord: 1239..1274
e-value: 0.075
score: 13.9
coord: 725..764
e-value: 0.12
score: 13.3
coord: 336..366
e-value: 0.01
score: 16.7
coord: 2003..2038
e-value: 0.001
score: 19.9
coord: 1501..1539
e-value: 0.034
score: 15.0
coord: 1000..1031
e-value: 0.072
score: 14.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1241..1274
score: 9.038
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 2005..2040
score: 11.444
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 335..376
score: 9.606
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1828..1869
score: 8.904
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1767..1787
score: 10.208
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1407..2038
e-value: 2.0E-182
score: 609.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 18..606
e-value: 8.4E-207
score: 690.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 680..1274
e-value: 8.9E-215
score: 716.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1417..1752
e-value: 2.0E-182
score: 609.8
coord: 30..341
e-value: 8.4E-207
score: 690.3
coord: 692..1006
e-value: 8.9E-215
score: 716.6
IPR005108HELPPFAMPF03451HELPcoord: 15..59
e-value: 3.5E-18
score: 65.2
coord: 1407..1448
e-value: 2.6E-13
score: 49.6
coord: 672..721
e-value: 3.7E-21
score: 74.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1289..1312
NoneNo IPR availablePANTHERPTHR13720:SF16ECHINODERM MICROTUBULE-ASSOCIATED PROTEIN-LIKE 5coord: 1295..2039
coord: 15..487
coord: 297..1276
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 1295..2039
coord: 15..487
coord: 297..1276
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 1019..1033
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1000..1283
score: 12.104
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 730..860
score: 11.656
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1746..1869
score: 11.787
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 68..247
score: 8.677
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 2005..2040
score: 10.891
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1505..1590
score: 10.337
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 335..502
score: 11.866
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 299..606
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1199..1277
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1454..2039
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 20..411
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 681..1153