Mediator of RNA polymerase II transcription subunit 17

Overview
NameMediator of RNA polymerase II transcription subunit 17
Smed IDSMED30010286
Length (bp)1979
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mediator of RNA polymerase II transcription subunit 17 (SMED30010286) t-SNE clustered cells

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 17 (SMED30010286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mediator of RNA polymerase II transcription subunit 17 (SMED30010286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 17 (SMED30010286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010286h1SMcG0016084 SmedASXL_001866SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Match: MED17 (mediator complex subunit 17 [Source:HGNC Symbol;Acc:HGNC:2375])

HSP 1 Score: 88.9669 bits (219), Expect = 1.044e-17
Identity = 133/631 (21.08%), Postives = 270/631 (42.79%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTS---------PDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQ 1845
            R   I+ E   E ++     +G E    PL+ ++   +L  +IDF + +G   +  +         P      ++ +    V+   +    ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+L      + +RE  ++   S    H         P   P  H   R  G Q +   + ++ + S  +    +     IF ++R       +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E +   ++    R  +I  S   + L  F  +Q+   ++  + +LA +   W+++     +   P     N   I V S  G + +S      S S ++ V+  + +C+
Sbjct:    5 RAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLD--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLC-----HSSNDKKSQKFATEKQCPEDHLYVLEHNLH-----LLIREFHKQTLSSIMMPH---------PASAPFGHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQI--RVVHRDGR--VITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGS-KIMVQFPRNQCK 602          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Match: MED17 (mediator complex subunit 17 [Source:HGNC Symbol;Acc:HGNC:2375])

HSP 1 Score: 86.6557 bits (213), Expect = 1.418e-17
Identity = 80/331 (24.17%), Postives = 162/331 (48.94%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTS---------PDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLI 966
            R   I+ E   E ++     +G E    PL+ ++   +L  +IDF + +G   +  +         P      ++ +    V+   +    ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I
Sbjct:    5 RAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLD--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQII 332          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Match: MED17 (mediator complex subunit 17 [Source:HGNC Symbol;Acc:HGNC:2375])

HSP 1 Score: 86.6557 bits (213), Expect = 1.418e-17
Identity = 80/331 (24.17%), Postives = 162/331 (48.94%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTS---------PDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLI 966
            R   I+ E   E ++     +G E    PL+ ++   +L  +IDF + +G   +  +         P      ++ +    V+   +    ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I
Sbjct:    5 RAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLD--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQII 332          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Match: MED17 (mediator complex subunit 17 [Source:HGNC Symbol;Acc:HGNC:2375])

HSP 1 Score: 88.1965 bits (217), Expect = 1.860e-17
Identity = 80/331 (24.17%), Postives = 162/331 (48.94%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTS---------PDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLI 966
            R   I+ E   E ++     +G E    PL+ ++   +L  +IDF + +G   +  +         P      ++ +    V+   +    ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I
Sbjct:    5 RAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLD--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQII 332          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Match: MED17 (mediator complex subunit 17 [Source:HGNC Symbol;Acc:HGNC:2375])

HSP 1 Score: 87.4261 bits (215), Expect = 1.925e-17
Identity = 80/331 (24.17%), Postives = 162/331 (48.94%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTS---------PDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLI 966
            R   I+ E   E ++     +G E    PL+ ++   +L  +IDF + +G   +  +         P      ++ +    V+   +    ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I
Sbjct:    5 RAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLD--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQII 332          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Fly
Match: MED17 (gene:FBgn0038578 transcript:FBtr0083558)

HSP 1 Score: 76.2554 bits (186), Expect = 3.839e-14
Identity = 96/408 (23.53%), Postives = 183/408 (44.85%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLT--ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDL--------------RSLKIILMNNQEGEPILKV-NIKDSSFPSTVEFKSFQELPEAKTCQSQI--EKLNRAQNLLYLHEIFSTLCWESRLLDNPI--IVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPV 1215
            I+ E   EN+I    ++G E  + P   +E   +  ++IDF K +   L           +E + +   Q +L   + ++  +  +L EI  L D++ ++KD  Y+ L  +++E+ +      V ++K  ++ ++  LL+ A RL    S  +++ + + F+++L  LR+ WR+K     +IGDL  ++ GS F  +G F++ + E+  +    S  N                 +L++I+    +G   +KV   KD     T +       P   T Q  +  + L  AQN+L+  E+F+ L  E+  L  PI  +V  N++   +  + N++   +I+   H   +   +   +    H     + +HS         L +LLRE H  NS  H    +P + P+
Sbjct:    7 ISVETTCENQIREIGYDGTELYQPPPTLSESLAKCAARIDFSKTSLDDLKKEEKSAAAAADEDKDATQFQESLWPWDAVRNKLKDALTEICVLSDVISIAKDKRYLVLDPLLEEADDTKPIVQVYSRKKAISQAAQVLLSGAERLRNAHSEQRNR-NVSDFHIELLRLRQNWRLKKVSNAIIGDLSYRTAGSKFGMSGTFEVTKAEETGDEDTASSSNSSSSVSGNNGMQLKASSALRVIVPAELQGVAYIKVITQKDQEDLCTAQLNLMGHGPNI-TAQVGVWQKTLEFAQNVLFCKELFAQLAREAIQLQAPIPHVVIGNQIRATL--LPNIQ---LIISLCHSTTFDSSQPAPINDHDH-----VLEHS---------LHQLLREVHYKNS--HHPFPHPASAPL 391          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Zebrafish
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:567560])

HSP 1 Score: 95.1301 bits (235), Expect = 1.560e-20
Identity = 100/403 (24.81%), Postives = 191/403 (47.39%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDE-ESEPSE-TVQLNLTETL------KKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY--VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKS---FQELPEAKTCQSQI--EKLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGP 1212
            ++ E   E ++   + +G+E    PL+ ++   +L  +IDF + +    D         ++ + EP E   QL    +L      + ++ ++L E+  L D+L V K+  YM L  + ++           + +KK  L  ++  LL  A +LSK++S  ++Q  Q  F  +L  LR +W+++     ++GDL  +S GSLFP +G F++++  D     D    +D   L + + ++ EG   +KV+I+  S P   +  +   F+   +AK   SQ+   +L  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H  G K+ +     K++  + L + +H+         L +L+RE H+  + +   + +P + P
Sbjct:    9 VSIESSCERQVQEVSLDGMETYVPPLSMSQNLAKLVQRIDFCQSSDSEEDGAERARAGREQWKQEPEEDEGQLKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVLKERKYMTLDPVSQDPAMAKTPQVFQLISKKKSLGTAAQLLLKGAEKLSKSVSENQEQRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKIPDDYCPLNVQIPSDLEGSAYIKVSIQKQS-PDIGDLGTVNLFRRQAKAKPA-SQMWHSRLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSTGEKKSQRSSPDKSKPDDHLYVLEHN---------LHQLIREFHK-QTLSSVVMPHPASAP 392          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Xenopus
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:549728])

HSP 1 Score: 88.9669 bits (219), Expect = 8.854e-18
Identity = 97/403 (24.07%), Postives = 194/403 (48.14%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEES-------EPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY---VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGP 1212
            I+ E  +E ++     +G E    PL+ ++   +L  +IDF + +G      + + +  ++E        +PS    L   ++++ ++ ++L E+  L D+L + K+  YM+L  + +E+       +   + +KK  LAA++  LL  A RLSK+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   LKV+I+  + P   +  +     + LP+AK      + +L  AQN+L   E+F+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+         L +L+RE H+  + ++  + +P + P
Sbjct:    9 ISIESSAEKQVQEVGLDGSETYVLPLSMSQNLARLAQRIDFSQESGEEEAEAARELEWAEQEEEEGLVKFQPS----LWPWDSVRNNLRSTLTEMCVLYDVLNIVKEKRYMHLDPVSQEALPPKPNQHGLLLVSKKKSLAAAAQILLKGAERLSKSVAENQENKRQRDFNSELLRLRQHWKLRKLGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKMPEDYCPLDVHIPSDLEGSAYLKVSIQKQA-PDIGDLGTVNLFRRPLPKAKPGTPHWQTRLEAAQNVLLCKEVFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSSNDKKSQKSNSDKMGAEDHLYVLEHN---------LHQLIREFHK-QTLSNIVMPHPASAP 389          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Xenopus
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:549728])

HSP 1 Score: 88.5817 bits (218), Expect = 1.020e-17
Identity = 97/403 (24.07%), Postives = 194/403 (48.14%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEES-------EPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY---VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGP 1212
            I+ E  +E ++     +G E    PL+ ++   +L  +IDF + +G      + + +  ++E        +PS    L   ++++ ++ ++L E+  L D+L + K+  YM+L  + +E+       +   + +KK  LAA++  LL  A RLSK+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   LKV+I+  + P   +  +     + LP+AK      + +L  AQN+L   E+F+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+         L +L+RE H+  + ++  + +P + P
Sbjct:    9 ISIESSAEKQVQEVGLDGSETYVLPLSMSQNLARLAQRIDFSQESGEEEAEAARELEWAEQEEEEGLVKFQPS----LWPWDSVRNNLRSTLTEMCVLYDVLNIVKEKRYMHLDPVSQEALPPKPNQHGLLLVSKKKSLAAAAQILLKGAERLSKSVAENQENKRQRDFNSELLRLRQHWKLRKLGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKMPEDYCPLDVHIPSDLEGSAYLKVSIQKQA-PDIGDLGTVNLFRRPLPKAKPGTPHWQTRLEAAQNVLLCKEVFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSSNDKKSQKSNSDKMGAEDHLYVLEHN---------LHQLIREFHK-QTLSNIVMPHPASAP 389          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Xenopus
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:549728])

HSP 1 Score: 88.5817 bits (218), Expect = 1.070e-17
Identity = 97/405 (23.95%), Postives = 193/405 (47.65%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEES-------EPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY---VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKH--RSNSCAHFSLANPIAGP 1212
            I+ E  +E ++     +G E    PL+ ++   +L  +IDF + +G      + + +  ++E        +PS    L   ++++ ++ ++L E+  L D+L + K+  YM+L  + +E+       +   + +KK  LAA++  LL  A RLSK+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   LKV+I+  + P   +  +     + LP+AK      + +L  AQN+L   E+F+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+         L +L+RE H     + ++  + +P + P
Sbjct:    9 ISIESSAEKQVQEVGLDGSETYVLPLSMSQNLARLAQRIDFSQESGEEEAEAARELEWAEQEEEEGLVKFQPS----LWPWDSVRNNLRSTLTEMCVLYDVLNIVKEKRYMHLDPVSQEALPPKPNQHGLLLVSKKKSLAAAAQILLKGAERLSKSVAENQENKRQRDFNSELLRLRQHWKLRKLGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKMPEDYCPLDVHIPSDLEGSAYLKVSIQKQA-PDIGDLGTVNLFRRPLPKAKPGTPHWQTRLEAAQNVLLCKEVFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSSNDKKSQKSNSDKMGAEDHLYVLEHN---------LHQLIREDHLFHKQTLSNIVMPHPASAP 392          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Mouse
Match: Med17 (mediator complex subunit 17 [Source:MGI Symbol;Acc:MGI:2182585])

HSP 1 Score: 99.7525 bits (247), Expect = 2.613e-21
Identity = 140/631 (22.19%), Postives = 273/631 (43.26%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNG------ITLDYTSPDYQCMDEESEPSETV-----QLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGV--IFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQ 1845
            R   I+ E   E ++     +G E   +PL+ ++   +L  +IDF + +G         D  +PD+     + +  E +      L   ++++ ++ ++L E+  L D+L + +D  +M L  + +++    +   T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+L      + +RE  ++   S    H         P   P  H   R  G Q +   + ++ +  S   LL  +I     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E V +     +    +I  S   + L  F  +Q+   ++  + +LA +   W+++     +   P     N   I V S  G + +S      S S ++ V+  + +C+
Sbjct:    5 RAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGPDGDAPDWGGAGADQDDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQSPQTLQLISKKKSLAGAAQILLKGAERLTKSVAENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPSLQLSISLC-----HSSDDKKSQKCAAEKPGQEDHLYVLEHNLH-----LLIREFHKQTLSSIVMPH---------PASAPFGHKRMRLSGPQAFDKNEINSIQ--STEGLLEKIIKQAKHIFLRSRTAATIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQVRVVHRDGR----VIMLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGS-KIMVQFPRNQCK 600          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Match: sp|Q08BY1|MED17_DANRE (Mediator of RNA polymerase II transcription subunit 17 OS=Danio rerio OX=7955 GN=med17 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.785e-20
Identity = 139/599 (23.21%), Postives = 261/599 (43.57%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDE-ESEPSE-TVQLNLTETL------KKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY--VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKS---FQELPEAKTCQSQI--EKLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQ--NDIEIIVISNDGRWLLS 1779
            ++ E   E ++   + +G+E    PL+ ++   +L  +IDF + +    D         ++ + EP E   QL    +L      + ++ ++L E+  L D+L V K+  YM L  + ++           + +KK  L  ++  LL  A +LSK++S  ++Q  Q  F  +L  LR +W+++     ++GDL  +S GSLFP +G F++++  D     D    +D   L + + ++ EG   +KV+I+  S P   +  +   F+   +AK   SQ+   +L  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H  G K+ +     K++  + L + +H+         L +L+RE H+       S+  P   P   P  H   R  G   Y   + S+ +++  +    +     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E + +     +    +I  S   + L  F  +Q+   ++  + +LA +   W ++         SI+   N   I V S  G + +S
Sbjct:    9 VSIESSCERQVQEVSLDGMETYVPPLSMSQNLAKLVQRIDFCQSSDSEEDGAERARAGREQWKQEPEEDEGQLKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVLKERKYMTLDPVSQDPAMAKTPQVFQLISKKKSLGTAAQLLLKGAEKLSKSVSENQEQRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKIPDDYCPLNVQIPSDLEGSAYIKVSIQKQS-PDIGDLGTVNLFRRQAKAKPA-SQMWHSRLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSTGEKKSQRSSPDKSKPDDHLYVLEHN---------LHQLIREFHKQTLS---SVVMP--HPASAPFGHKRLRLAGPLAYDKAEISSLQQTEGLLEKIIKQAKHIFLRSRTARTIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNICVEQIRVVHRDGR----VITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWHVLSFSNHVGLGSIESIGNASSITVASPSGEYAIS 574          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Match: sp|Q8VCD5|MED17_MOUSE (Mediator of RNA polymerase II transcription subunit 17 OS=Mus musculus OX=10090 GN=Med17 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.828e-20
Identity = 140/631 (22.19%), Postives = 273/631 (43.26%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNG------ITLDYTSPDYQCMDEESEPSETV-----QLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGV--IFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQ 1845
            R   I+ E   E ++     +G E   +PL+ ++   +L  +IDF + +G         D  +PD+     + +  E +      L   ++++ ++ ++L E+  L D+L + +D  +M L  + +++    +   T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+L      + +RE  ++   S    H         P   P  H   R  G Q +   + ++ +  S   LL  +I     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E V +     +    +I  S   + L  F  +Q+   ++  + +LA +   W+++     +   P     N   I V S  G + +S      S S ++ V+  + +C+
Sbjct:    5 RAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGPDGDAPDWGGAGADQDDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQSPQTLQLISKKKSLAGAAQILLKGAERLTKSVAENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPSLQLSISLC-----HSSDDKKSQKCAAEKPGQEDHLYVLEHNLH-----LLIREFHKQTLSSIVMPH---------PASAPFGHKRMRLSGPQAFDKNEINSIQ--STEGLLEKIIKQAKHIFLRSRTAATIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQVRVVHRDGR----VIMLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGS-KIMVQFPRNQCK 600          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Match: sp|Q5BIR6|MED17_BOVIN (Mediator of RNA polymerase II transcription subunit 17 OS=Bos taurus OX=9913 GN=MED17 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.980e-18
Identity = 134/631 (21.24%), Postives = 271/631 (42.95%), Query Frame = 1
Query:   43 RYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITL-----------DYTSPDYQCMDEESEPSETVQLNLT--ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKES---HEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQ 1845
            R   I+ E   E ++     +G E   +PL+ ++   +L  +IDF + +G              D+         ++ E     Q +L   ++++ ++ ++L E+  L D+L + +D  +M L  + +++    ++  T  + +KK  LA ++  LL  A RL+K+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   ++V+I+  + P   +  +     + LP++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+       K   ++ L + +H+L      + +RE  ++   S    H         P   P  H   R  G Q +   + ++ + S  +    +     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E + +     +    +I  S + + L  F  +Q+   ++  + +LA +   W+++     +   P     N   I V S +G + +S      S S ++ V+  + +C+
Sbjct:    5 RAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGAEGDAQDWAGAGSSADQDDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKIPEDYCPLDVQIPSDLEGSAYIRVSIQKQA-PDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPSLQLSISLC-----HSSNDKKSPKSATEKQSPEDHLYVLEHNLH-----LLIREFHKQTLSSIMMPH---------PASAPFGHKRMRLSGPQAFDKNEINSIQSSEGLLEKIIKQAKHIFLRSRTAATIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGR----VITLSHEGQELQDFLLSQMSQHQVHAVQQLAKVM-GWQVLSFSNHVGLGPVESIGNASAITVASPNGDYAISVRNGPESGS-KIMVQFPRNQCK 602          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Match: sp|Q5ZID1|MED17_CHICK (Mediator of RNA polymerase II transcription subunit 17 OS=Gallus gallus OX=9031 GN=MED17 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.027e-17
Identity = 137/621 (22.06%), Postives = 266/621 (42.83%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSET---VQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY---VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNH---RYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQ 1845
            I+ E   E ++     +G E   +PL+ ++   +L  +IDF + +G   D      +   E SE  +    V+   +    ++++ ++ ++L E+  L D+L + KD  +M L  +V++            + +KK  LA ++  LL  A RLSK+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLF  +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +     + +P++K      + KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   +  L + +H+         L +L+RE H+       S+  P   P   P  H   R  G Q +   + S+ + +  +    +     IF + RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E + +     +    +I  S   + L  F  +Q+   ++  + +LA +   W ++     +   P     N   I V S +G + +S      S S ++ V+  + +C+
Sbjct:    9 ISIESACEKQVQEVGLDGSETYLQPLSMSQNLARLAQRIDFSQGSGSEEDEPGSAGRAWAEPSEAEDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVKDKKFMTLDPVVQDPPPPKQDPQFLQLISKKKSLAGAAQILLKGAERLSKSVAENQENKRQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFLHHGTFEVIKNTDID--LDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFKRPMPKSKPGTPHWQTKLETAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSSNDKKSQKSASEKQNPEGHLYVLEHN---------LHQLIRECHKQTLS---SVVMP--HPASAPFGHKRMRLAGPQAFDKNEISSLQTNEGLLEKIIKQAKHIFLRRRTARTIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGR----VITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWHVLSFSNHVGLGPVESIGNASAITVASPNGDYAISVRNGPESGS-KVMVQFPRSQCK 596          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Match: sp|Q0VFR9|MED17_XENTR (Mediator of RNA polymerase II transcription subunit 17 OS=Xenopus tropicalis OX=8364 GN=med17 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.690e-17
Identity = 97/403 (24.07%), Postives = 194/403 (48.14%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEES-------EPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY---VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSF----QELPEAKTCQSQIE-KLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGP 1212
            I+ E  +E ++     +G E    PL+ ++   +L  +IDF + +G      + + +  ++E        +PS    L   ++++ ++ ++L E+  L D+L + K+  YM+L  + +E+       +   + +KK  LAA++  LL  A RLSK+++  ++   Q  F  +L  LR+ W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   LKV+I+  + P   +  +     + LP+AK      + +L  AQN+L   E+F+ L  E+  + +  P IV +N++I      + L +        H    K+ +     K   ++ L + +H+         L +L+RE H+  + ++  + +P + P
Sbjct:    9 ISIESSAEKQVQEVGLDGSETYVLPLSMSQNLARLAQRIDFSQESGEEEAEAARELEWAEQEEEEGLVKFQPS----LWPWDSVRNNLRSTLTEMCVLYDVLNIVKEKRYMHLDPVSQEALPPKPNQHGLLLVSKKKSLAAAAQILLKGAERLSKSVAENQENKRQRDFNSELLRLRQHWKLRKLGDKILGDLSYRSAGSLFPHHGTFEVIKNTDID--LDKKMPEDYCPLDVHIPSDLEGSAYLKVSIQKQA-PDIGDLGTVNLFRRPLPKAKPGTPHWQTRLEAAQNVLLCKEVFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSSNDKKSQKSNSDKMGAEDHLYVLEHN---------LHQLIREFHK-QTLSNIVMPHPASAP 389          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Match: A0A4S2JLM0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011385 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.052e-26
Identity = 131/464 (28.23%), Postives = 207/464 (44.61%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPS----ETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQN------------------SFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDS-ERSDNSFENDL-----------RSLKIILMNNQEGEPILKVNIKDSSFPST----------VEFKSFQELPEAKTCQ---SQIEKLNRAQNLLYLHEIFSTLCWE-----SRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKH-WFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLR--ELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTS 1281
            I  E + E ++     +G E  EKP  P E F ++ ++IDF K         S D  C  E SE S        L +   +++    +L EINAL+DIL V K+  Y+++  +  +  + N    V  KK  LAA+S  LL    RL +  + V D  S+                   SF+  L  LR+EWR+K  Q  +IGD+ L++ GS F E+G F++ E +  + ++S+N+  ND+           RS++  L+NN  G  +L V I ++   S            +  +  E P   +     SQ E+L R Q LL   EI  TL +E     SRL D+     ++++I N+   + L +     P  H     + +++  LL T+  +      ++ +  AL + L+   LL  +HR       SL  P  G VQIP  +R  G     A  ++ S
Sbjct:   26 IPIEALPEYDVQEILLDGRELLEKPPTPAEHFQKVVNRIDFTK---------SYDGNCRSEVSESSGKSAARGSLKMWNVVRETSRMALTEINALVDILAVLKEEKYLSVFPVATDPPDLNPAILVVGKKRALAAASEILLKGTERLRRRHAEVADARSRTTSSANNSSDRSKTASTLESFHKTLMQLRQEWRLKLHQNTIIGDVSLRAIGSRFRESGNFEVRESDMVALQKSNNNCTNDMEVSGGVEVVFSRSVE-ALLNNTVGSGLLTVEIHETGTDSGPVHLWDCVFNADSGTSSEFPTRSSSTENLSQRERLVRTQRLLACREILHTLSFEAFSSKSRLCDSSCFATQDKIIANLLPGVQLTISLETKPPAHDVLEIELEDSKPLLATKTTSSAKSDGNNRVHVALTLSLQLNRLLSAQHRVVWPNLASLPTPACGAVQIPARNRAAGAHALPASHFNPS 479          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Match: A0A3Q0KHQ3 (Transcriptional co-activator crsp77-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.544e-25
Identity = 127/465 (27.31%), Postives = 220/465 (47.31%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQI--------------SQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEME------DDSERSDNSFENDLRSLKII-------LMNNQEGEPILKVNIKDS---SFPST-VEFKSFQELPEAKTCQ------SQIEKLNRAQNLLYLHEIFSTLCWES-------RLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLL----SDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSS 1293
            I  E +SE +I     +G E  EKPL P   F ++ + IDF +         S  Y     +++ SE+   N T    E +K+ + T+L EINAL+D+L + K+  Y+ +  +  +S E N++ Y++ KK  +AA++  L+  A RL +  S + D                + NSF+  L  LR+EWR+K  Q +++GD+ L+S GS F E+G F++ E +       D E  D+   + +  + II       L+N+  G  +L V   +S   S P+  +EF   ++  +  +C       +Q +KL +AQ LL   EI S L  E+        L  +     ++++I  +   + + +  ++ P    FG ++   DE  K + +    +  H++     S+ + + L  +L  +HR+      SL  P  GPV+IPL +R  G     A  +S+   S+
Sbjct:   10 IPIEALSEYDIREILLDGHEILEKPLTPAANFQRIINHIDFSE---------SSSYGDNCSQNKESESFLKNFTPKIWENVKETLRTTLIEINALVDVLSIIKEGKYLAINPVADDSQETNLSLYLSGKKRSIAAAADILMKGAERLRRRHSELIDARVRRSNSLVPPQFDNTHNSFHKALMHLRQEWRLKLHQNSILGDVSLRSVGSHFRESGNFEVRESDVFFDGKSDVESQDDKCVDAVTGVMIIFSQSMEALLNSSHGPGLLNVEFLESDINSLPTPLLEFIFHKQ--QISSCSRDPLPINQRQKLFKAQRLLACREILSMLSCEASTSKEYNHLTGSVAFATQDKIIATLFPGVQICLSSVVRPTV--FG-EDVLGDERPKLQDKK---LPDHTVFTMDYSNCINLQLHRMLAGQHRAVWPNLASLPQPACGPVEIPLYYRSGGANGLPASRFSSLSHST 457          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Match: A0A419Q505 (Mediator of RNA polymerase II transcription subunit 17 OS=Clonorchis sinensis OX=79923 GN=med17 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 5.193e-25
Identity = 130/464 (28.02%), Postives = 208/464 (44.83%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPS----ETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRL-----------SKTLSSV-------KDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDS-ERSDNSFENDL-----------RSLKIILMNNQEGEPILKVNIKDSSFPST----------VEFKSFQELPEAKTCQ---SQIEKLNRAQNLLYLHEIFSTLCWE-----SRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKH-WFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLR--ELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTS 1281
            I  E + E ++     +G E  EKP  P E F ++ ++IDF K         S D  C  E S+ S        L +   +++    +L EINAL+DIL V K+  Y+++  +  +  + N   ++  KK  L+A+S  LL    RL           S+T SSV       K   +  SF+  L  LR+EWR+K  Q  +IGD+ L++ GS F E+G F++ E +  + ++S+N+  ND+           RS++  L+NN  G  +L V I ++   S               +  E P   +     SQ E+L R Q LL   EI  TL +E     SRL D+     ++++I N+   + L +     P  H     + ++   LL T+  +      ++ +  AL + L+   LL  +HR       SL     G VQIP  +R  G     A+ ++ S
Sbjct:   29 IPIEALPEYDVQEILLDGRELLEKPPTPAEHFQKIVNRIDFTK---------SYDGSCRSEVSDSSGKSAARGSLKMWNIVRETSRMALTEINALVDILAVLKEEKYLSVFPVATDPPDLNPAFFLVGKKRALSAASEILLKGTERLRRRHAEVADARSRTTSSVNNSSDRSKTASTPESFHKTLMQLRQEWRLKLHQNTIIGDVSLRAIGSRFRESGNFEVRESDMVALQKSNNNSTNDMEVSGGVEVVFSRSVE-ALLNNTVGSGLLTVEIHETGTDSGPVHLWDCVFNANSGTSSEFPTRSSSTEKLSQRERLVRTQRLLACREILHTLSFEAFSSKSRLCDSSCFATQDKVIANLLPGVQLTISLETKPPAHDALEIELEDPKPLLTTKITSSAKSDGNNRVHVALTLSLQLNRLLAAQHRVVWPNLASLPTSACGAVQIPARNRAAGAHALPALHFNPS 482          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Match: A0A430QPI2 (Mediator of RNA polymerase II transcription subunit 17 OS=Schistosoma bovis OX=6184 GN=DC041_0005787 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 6.274e-25
Identity = 126/456 (27.63%), Postives = 211/456 (46.27%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQ--------------ISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEME------DDSERSDNSFENDLRSLKII-------LMNNQEGEPILKVNIKDS---SFPST-VEFKSFQELPEAKTCQ------SQIEKLNRAQNLLYLHEIFSTLCWES-------RLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYST 1278
            I  E +SE +I     +G E  EKPL P   F ++ + IDF +         S  Y     +++ SE    N T    E +K+ + T+L EINAL+D+L + K+  Y+ +  +  +S E N++ Y++ KK  +AA++  L+  A RL +  S + D                + NSF+  L  LR+EWR+K  Q +++GD+ L+S GS F E+G F+I E +       D E  D+   + +  + II       L+N   G  +L V   +S   S P+  +EF   ++  +  +C       +Q +KL +AQ LL   EI S L  E+        L  +     ++++I  +   + + +   + P    FG ++   DE  K + +           S+ + + L  +L  +HR+      SL  P  GPV+IPL +R  G     A  +S+
Sbjct:   10 IPIEALSEYDIREILLDGHEILEKPLTPAANFQRIINHIDFSE---------SSSYSDNCSQNKESEFFPKNFTPKIWENVKETLRTTLIEINALVDVLSIIKEGKYLAINPVADDSQETNLSLYLSGKKRSIAAAADILMKGAERLRRRHSELIDARVRRLNSVVPPQFDSAHNSFHKALMHLRQEWRLKLHQNSILGDVSLRSVGSHFRESGNFEIRESDGFADSKSDVESQDDKCVDAVTGVMIIFSQSMEALLNLSHGPGLLNVEFLESDINSLPTPLLEFIFHKQ--QISSCSRDPLPINQRQKLFKAQRLLACREILSLLSCEASTSKEYNHLTGSVAFATQDKIIATLFPGVQICLSSAVRPT--VFG-EDVSVDERPKLQDKKSDHTVSTMDYSNCINLQLHRMLAGQHRAVWPNLASLPQPTCGPVEIPLYYRSGGANGLHASKFSS 451          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Match: G4V706 (Transcriptional co-activator crsp77-related OS=Schistosoma mansoni OX=6183 GN=Smp_073610.2 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 6.309e-25
Identity = 125/460 (27.17%), Postives = 219/460 (47.61%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQI--------------SQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEME------DDSERSDNSFENDLRSLKII--LMNNQEGEPILKVNIKDS---SFPST-VEFKSFQELPEAKTCQ------SQIEKLNRAQNLLYLHEIFSTLCWES-------RLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLL----SDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSS 1293
            I  E +SE +I     +G E  EKPL P   F ++ + IDF +         S  Y     +++ SE+   N T    E +K+ + T+L EINAL+D+L + K+  Y+ +  +  +S E N++ Y++ KK  +AA++  L+  A RL +  S + D                + NSF+  L  LR+EWR+K  Q +++GD+ L+S GS F E+G F++ E +       D E  D+   + +  +  +  L+N+  G  +L V   +S   S P+  +EF   ++  +  +C       +Q +KL +AQ LL   EI S L  E+        L  +     ++++I  +   + + +  ++ P    FG ++   DE  K + +    +  H++     S+ + + L  +L  +HR+      SL  P  GPV+IPL +R  G     A  +S+   S+
Sbjct:   10 IPIEALSEYDIREILLDGHEILEKPLTPAANFQRIINHIDFSE---------SSSYGDNCSQNKESESFLKNFTPKIWENVKETLRTTLIEINALVDVLSIIKEGKYLAINPVADDSQETNLSLYLSGKKRSIAAAADILMKGAERLRRRHSELIDARVRRSNSLVPPQFDNTHNSFHKALMHLRQEWRLKLHQNSILGDVSLRSVGSHFRESGNFEVRESDVFFDGKSDVESQDDKCVDAVTGVMSMEALLNSSHGPGLLNVEFLESDINSLPTPLLEFIFHKQ--QISSCSRDPLPINQRQKLFKAQRLLACREILSMLSCEASTSKEYNHLTGSVAFATQDKIIATLFPGVQICLSSVVRPTV--FG-EDVLGDERPKLQDKK---LPDHTVFTMDYSNCINLQLHRMLAGQHRAVWPNLASLPQPACGPVEIPLYYRSGGANGLPASRFSSLSHST 452          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Cavefish
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:567560])

HSP 1 Score: 101.679 bits (252), Expect = 4.989e-22
Identity = 143/622 (22.99%), Postives = 275/622 (44.21%), Query Frame = 1
Query:    1 LIIV*IFDFYLL--MNRYKL-------IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKK--------LNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSY--VAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKS---FQELPEAKT-CQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQ--NDIEIIVISNDGRWLLS 1779
              IV +F F  L  +NR ++       ++ E   E ++   + +GVE    PL+ ++   +L  +IDF +        LNG + + +    Q  DEE        L   ++++ ++ ++L E+  L D+L + K+  YM L  + ++           + +KK  LA ++  LL  A +LSK+++  ++Q  Q  F  +L  LR +W+++     ++GDL  +S GSLF  +G F++++  D     D    +D   L + + ++ EG   +KV+I+  + P   +  +   F+  P+A+   Q+   KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H    K+ +     KT+  + L + +H+         L +L+RE H+  + +   + +P + P   P   R  G   Y   + S+ + S  +    +     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  E + +     +    +I  S   + L  F  +Q+   ++  + +LA +   W ++         +I+   N   I V S +G + +S
Sbjct:   23 FFIVRMFVFQRLQPVNRSRMSGSPAVRVSIESSCERQVQEVSLDGVETYVPPLSMSQNLAKLAQRIDFGQGSDSDEEDLNGESRE-SEWSKQNPDEEGPVKFQPCLWPWDSVRNNLRSALTEMCVLHDVLSIVKEKKYMALDPVSQDPTVAKAPQVFQLISKKKSLATAAQVLLKGAEKLSKSVAESQEQRRQRDFNAELLHLRSQWKLRKVGDKILGDLSYRSAGSLFTHHGTFEVIKNTDID--LDKKIPDDYCPLNVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFRRQPKARPGAQAWHSKLEAAQNVLLCKEIFAQLSREAVQIKSHIPHIVVKNQIISQPFPGLQLSISLC-----HSSVEKKNQRTSPDKTKPDDHLYVLEHN---------LHQLIREFHK-QTLSSSVMPHPASVPFG-PKRLRLAGPMAYDKAEISSLQPSDGLLEKIIKQAKHIFLRSRTARTIDCLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGR----VITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWHVLSFSNHVGLGAIESIGNASAITVASPNGEYAIS 614          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Sea Lamprey
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:567560])

HSP 1 Score: 95.9005 bits (237), Expect = 5.250e-21
Identity = 122/485 (25.15%), Postives = 218/485 (44.95%), Query Frame = 1
Query:  277 ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKI---VKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFP----STVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWES---RLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQ---NELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLAN-PIAGPVQIPLNHRYR--GTQFYRAIDYSTSERSSVVFLLPLLIDGV--IFHKARTDLMFVLDKIS---DMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATI 1668
            ++++  + ++L EI+ L D+L V ++  YM L  +   V  S +D       AKK  LA ++  LL  A RLS++++  ++Q  Q  F  +L  LR+ W+++  +  ++GDL  +S GSL+P  G F++L+  D     D    +D   L +++ ++ EG   +KV+I+  S       TV   S       +       KL  AQN+L+  EIF+ L  E+   +    PI+VK N++I  +   + L +    L        +EK++ +L   R     + L + +H+         L +L+RE H+ N     ++A  P     Q  L  R R  G   Y   +    +  S   LL  +I     IF + RT     +DK++   D P     ++ H      +   SV V+I    Y  +     L L++  E V +     ++   + +   + EL+  F  +Q+   ++  + +LA +
Sbjct:   13 DSVRNQLRSALTEISVLYDVLNVVREKKYMTLDPVSLEVLPSRQDRQLLQFVAKKKTLAGAAQILLRGAERLSRSVAESQEQKRQRDFNAELLKLRQHWKLRKVRDKILGDLSYRSAGSLYPHQGTFEVLKNTDID--LDKKIPDDYCPLDVLVPSDLEGTAYIKVSIQKQSTDIGDLGTVNLFSCPARKPRQGAPHWQAKLEAAQNVLFCKEIFAQLSREAVQIKFQMPPIVVK-NQIISQLFPGLQLSISLCHLLS------EEKKSQKLAPERSAQADDHLYVLEHN---------LHQLMREFHKQN----LNVATMPHPSTAQFGLTKRMRLAGPSAYDKTELGALQ--SAEGLLEKIIKQARHIFLRRRT--AATIDKLAARVDDPQ----IQAHWSNVNDVYESSVKVLITSLGYEQICKTLQLQLNIGLEQVKVVHRDGRV---MTFSHQEQELM-DFLISQMSQHQVHAVQQLAKV 463          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Nematostella
Match: EDO32058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW38])

HSP 1 Score: 59.3066 bits (142), Expect = 3.544e-9
Identity = 75/300 (25.00%), Postives = 142/300 (47.33%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLT--ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNS--------FYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMED-DSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWES 921
            IA E + E+E+     +G E     L+ +E+  +L  KIDF      +    + D    + +++   T Q +L   ++++  +  +L E+  L D+L V K+  Y+ L  + +       T  + AKK  L  +++ LL  + R+    S+V++++SQ S        F+ +L  LR+ WR+K    +L+GDL  +S GS F   G F++ +    D+   +    +   +L++ + ++ EG   + V I +S     +     + L +  + Q    KL  AQ  L+  E+F+ L  E+
Sbjct:    9 IAIEQLLESEVEEIARDGQEKYVPQLSMSEQLSKLAHKIDFLS-EAKSKADDNADDNDDESDNKTLVTFQPSLWPWDSVRTKLRNALTEVCVLSDLLNVVKEKKYVVLDPVSQSQAISKPTLQLLAKKKNLRDAATILLQGSKRME---SAVQERMSQQSRPDQERSDFHSELINLRQRWRLKRTGNSLMGDLTYRSAGSQFWNPGLFEVTKPTGVDNTHGNTPAPSVSGALEVKVSSDLEGVAEVNVQIVESGTDVHMYSGKSKVLAKMNSRQPWQGKLEAAQRNLFCKELFTQLSQEA 304          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Medaka
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:101168060])

HSP 1 Score: 95.9005 bits (237), Expect = 3.232e-20
Identity = 109/431 (25.29%), Postives = 196/431 (45.48%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYT---SPDYQCMDEESEPSETV-----QLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYV---AAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKS---FQELPEAKT-CQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSV 1296
            I+ E   E ++     +G E    PL+ ++   +L  +IDF + +    D     S D +   +E E  E        L   ++++ ++ ++L E+  L D+L V K+  YM L  +   SH+ + T  V    +KK  L  ++  LL  A RLSK+++  ++   Q  F  +L  LR +W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +   F+ L + K+  Q    KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H  G K+       K +  + L + +H+         L +++RE H+       S+  P   P   P  H+    +    + Y  +E SS+
Sbjct:    9 ISIESSCEKQVQEVALDGTETYVPPLSMSQNLAKLAQRIDFSQGSDSEEDGAEGESRDREWSKQEPEEEEGAVKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVVKEKKYMALDPV---SHDPSATPQVFQLISKKKSLGTAAQILLKGAERLSKSVAENQENRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDI--HLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFRRLQKNKSGTQPWHVKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSTGDKKNSRSSPEKPKPDDHLYVLEHN---------LHQMMREFHKQQLS---SVVMP--HPATAPFGHKR--MRLAGPLAYDKAEISSL 412          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Medaka
Match: med17 (mediator complex subunit 17 [Source:NCBI gene;Acc:101168060])

HSP 1 Score: 94.3597 bits (233), Expect = 9.125e-20
Identity = 140/603 (23.22%), Postives = 261/603 (43.28%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYT---SPDYQCMDEESEPSE-TVQLNLT----ETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTS-----YVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKS---FQELPEAKT-CQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDN--PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVF---LLPLLIDGV--IFHKARTDLMF--VLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDL--RLSNSPNSIKQNDIEIIVISNDGRWLLS 1779
            I+ E   E ++     +G E    PL+ ++   +L  +IDF + +    D     S D +   +E E  E  V+   +    ++++ ++ ++L E+  L D+L V K+  YM L  +   SH+ +         + +KK  L  ++  LL  A RLSK+++  ++   Q  F  +L  LR +W+++     ++GDL  +S GSLFP +G F++++  D     D     D   L + + ++ EG   +KV+I+  + P   +  +   F+ L + K+  Q    KL  AQN+L   EIF+ L  E+  + +  P IV +N++I      + L +        H  G K+       K +  + L + +H+         L +++RE H+       S+  P   P   P  H+    +    + Y  +E SS+     LL  +I     IF ++RT      +  +I D P     ++ H      +   SV V+I    Y  +     L L++  + + +     +    +I  S   + L  F  +Q+   ++  + +LA +   W ++     +   P     N   I V S +G + +S
Sbjct:    9 ISIESSCEKQVQEVALDGTETYVPPLSMSQNLAKLAQRIDFSQGSDSEEDGAEGESRDREWSKQEPEEEEGAVKFQPSLWPWDSVRNNLRSALTEMCVLHDVLSVVKEKKYMALDPV---SHDPSAVKTPQVFQLISKKKSLGTAAQILLKGAERLSKSVAENQENRRQRDFNSELLRLRSQWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDI--HLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQA-PDIGDLGTVNLFRRLQKNKSGTQPWHVKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPGLQLSISLC-----HSTGDKKNSRSSPEKPKPDDHLYVLEHN---------LHQMMREFHKQQLS---SVVMP--HPATAPFGHKR--MRLAGPLAYDKAEISSLQHNEGLLEKIIRQAKHIFLRSRTARTIDSLASRIED-PQ----IQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVKQIRVVHRDGR----VITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVM-GWHVLSFSNHVGLGPVESIGNASAITVASPNGEFAIS 574          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Planmine SMEST
Match: SMESG000069511.1 (SMESG000069511.1)

HSP 1 Score: 1271.53 bits (3289), Expect = 0.000e+0
Identity = 636/636 (100.00%), Postives = 636/636 (100.00%), Query Frame = 1
Query:   37 MNRYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR 1944
            MNRYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGLAASSSTLLNSAVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR
Sbjct:    1 MNRYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGLAASSSTLLNSAVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR 636          
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Planmine SMEST
Match: SMESG000069511.1 (SMESG000069511.1)

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 629/630 (99.84%), Postives = 630/630 (100.00%), Query Frame = 1
Query:   55 IAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGXXXXXXXXXXXXVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR 1944
            +AFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGLAASSSTLLNSAVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR
Sbjct:   79 LAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKLNGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDILQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGLAASSSTLLNSAVRLSKTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPENGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSFPSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDNPIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNELIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHRYRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDMPNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVYLTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRLIDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQVECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR 708          
The following BLAST results are available for this feature:
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MED171.044e-1721.08mediator complex subunit 17 [Source:HGNC Symbol;Ac... [more]
MED171.418e-1724.17mediator complex subunit 17 [Source:HGNC Symbol;Ac... [more]
MED171.418e-1724.17mediator complex subunit 17 [Source:HGNC Symbol;Ac... [more]
MED171.860e-1724.17mediator complex subunit 17 [Source:HGNC Symbol;Ac... [more]
MED171.925e-1724.17mediator complex subunit 17 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MED173.839e-1423.53gene:FBgn0038578 transcript:FBtr0083558[more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
med171.560e-2024.81mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
med178.854e-1824.07mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
med171.020e-1724.07mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
med171.070e-1723.95mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Med172.613e-2122.19mediator complex subunit 17 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08BY1|MED17_DANRE1.785e-2023.21Mediator of RNA polymerase II transcription subuni... [more]
sp|Q8VCD5|MED17_MOUSE1.828e-2022.19Mediator of RNA polymerase II transcription subuni... [more]
sp|Q5BIR6|MED17_BOVIN8.980e-1821.24Mediator of RNA polymerase II transcription subuni... [more]
sp|Q5ZID1|MED17_CHICK2.027e-1722.06Mediator of RNA polymerase II transcription subuni... [more]
sp|Q0VFR9|MED17_XENTR4.690e-1724.07Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2JLM01.052e-2628.23Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3Q0KHQ31.544e-2527.31Transcriptional co-activator crsp77-related OS=Sch... [more]
A0A419Q5055.193e-2528.02Mediator of RNA polymerase II transcription subuni... [more]
A0A430QPI26.274e-2527.63Mediator of RNA polymerase II transcription subuni... [more]
G4V7066.309e-2527.17Transcriptional co-activator crsp77-related OS=Sch... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
med174.989e-2222.99mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
med175.250e-2125.15mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO320583.544e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
med173.232e-2025.29mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
med179.125e-2023.22mediator complex subunit 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069511.10.000e+0100.00SMESG000069511.1[more]
SMESG000069511.10.000e+099.84SMESG000069511.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010286 ID=SMED30010286|Name=Mediator of RNA polymerase II transcription subunit 17|organism=Schmidtea mediterranea sexual|type=transcript|length=1979bp
TTAATAATTGTTTAAATATTCGACTTTTACTTATTGATGAATCGGTATAA
ATTAATAGCCTTTGAACCTATTTCAGAAAATGAAATAGCCAGTTACAATT
TTGAAGGGGTTGAAAATCAAGAAAAGCCACTTAATCCAAATGAAGAATTT
ATTCAATTGACTAGTAAAATAGATTTTAAAAAGCTGAATGGAATTACTTT
GGATTATACAAGTCCTGATTATCAATGCATGGATGAGGAATCCGAACCTT
CAGAAACAGTGCAACTAAATTTAACTGAAACTCTTAAAAAACACATCACA
ACATCACTAAATGAAATAAATGCTTTAATTGATATTTTACAAGTATCTAA
AGATAATACATATATGAATTTAAAGAAAATTGTGAAAGAAAGCCACGAAG
ATAATGTAACTAGTTATGTGGCTGCAAAGAAAATGGGTTTAGCAGCAAGC
TCCAGTACTTTATTAAATAGTGCTGTTAGGTTATCAAAGACTCTTTCATC
AGTAAAAGATCAAATATCACAAAATTCTTTTTATCTCGACCTTGCAATTC
TTCGAAAAGAATGGAGAATAAAATGGTTTCAAAAAAATTTAATTGGTGAT
TTAGGTTTACAAAGTTGTGGATCATTATTTCCAGAAAATGGTGGATTTCA
AATTCTAGAAATGGAGGATGATAGTGAAAGATCAGACAACTCTTTTGAAA
ATGATTTGCGTAGTTTGAAAATTATACTAATGAATAATCAAGAAGGAGAA
CCAATATTAAAAGTTAATATTAAAGATAGTTCCTTTCCATCAACTGTTGA
ATTTAAATCATTTCAAGAACTACCAGAAGCCAAAACATGTCAATCTCAAA
TTGAAAAGCTAAATAGAGCTCAAAATCTGCTATATCTACATGAAATCTTT
AGTACGCTTTGTTGGGAATCTCGATTGCTGGATAATCCGATTATTGTGAA
AGAAAATCGGCTGATTGTAAACATAAATGGTGTAATGAATCTAGAAGTTG
ATTTTATAATTTTACCAGAGAAACATTGGTTTGGGTATAAAGAGAAAGAG
ACAGATGAATTATTGAAAACACGCCATCAAAATGAATTAATAATTAAACA
GCACAGTTTACTGTCGGACGCATTAATTGTATTTTTGAGAGAACTGCTTC
GTGAGAAACATAGGTCAAACTCATGTGCTCACTTTTCATTGGCGAATCCG
ATAGCTGGCCCAGTTCAAATACCATTGAATCATAGATATCGAGGAACTCA
ATTCTATAGAGCTATTGATTATTCGACCTCTGAGCGATCTAGTGTTGTAT
TTCTATTGCCTTTGCTGATCGATGGTGTTATATTTCACAAAGCCCGCACA
GACCTCATGTTTGTCTTGGACAAAATTTCAGACATGCCCAATGGCAGTAT
TTTTGTCAGAAATCATATCCAGCTAACTCAGTCAATGTTAAATTGTAGCG
TTTCCGTTGTCATCGGGTGTTCGACGTACAATAGCCTTCAGCATTTTTTC
ACTCTGAATCTTTCAGTGTCCAAAGAAACTGTTTATCTAACTATCATCTC
AGATCAGCTGAGACATGATCTTATTTATGAATCCATCGATGTAGAATTGT
TGACATCATTTTTCAAAAATCAGATATGGAACTTTAAAATAGACGTGATT
AACAAATTAGCGACGATTAAACATAATTGGCGTTTAATAGATTTGCGGCT
ATCGAACAGTCCAAATTCAATCAAACAGAACGATATAGAAATTATTGTTA
TTTCGAACGATGGCCGTTGGTTATTAAGTTTCGGAGGCACTAAAAATTCC
GACAGTTATCAATTATCCGTGAAACATTCACAAGTTGAATGTCAAAAAGT
CACTGAATGGAAATCTATAAATTTGTTGATGTTTCAAAAAAAATTAATCA
AGAATGATTTAGAAACAATCGATGTCTTGTTGACAGCTTGGCGCTAAATA
TTAATATTAGAAATAAATGTTTTGTCGTG
back to top

protein sequence of SMED30010286-orf-1

>SMED30010286-orf-1 ID=SMED30010286-orf-1|Name=SMED30010286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=637bp
MNRYKLIAFEPISENEIASYNFEGVENQEKPLNPNEEFIQLTSKIDFKKL
NGITLDYTSPDYQCMDEESEPSETVQLNLTETLKKHITTSLNEINALIDI
LQVSKDNTYMNLKKIVKESHEDNVTSYVAAKKMGLAASSSTLLNSAVRLS
KTLSSVKDQISQNSFYLDLAILRKEWRIKWFQKNLIGDLGLQSCGSLFPE
NGGFQILEMEDDSERSDNSFENDLRSLKIILMNNQEGEPILKVNIKDSSF
PSTVEFKSFQELPEAKTCQSQIEKLNRAQNLLYLHEIFSTLCWESRLLDN
PIIVKENRLIVNINGVMNLEVDFIILPEKHWFGYKEKETDELLKTRHQNE
LIIKQHSLLSDALIVFLRELLREKHRSNSCAHFSLANPIAGPVQIPLNHR
YRGTQFYRAIDYSTSERSSVVFLLPLLIDGVIFHKARTDLMFVLDKISDM
PNGSIFVRNHIQLTQSMLNCSVSVVIGCSTYNSLQHFFTLNLSVSKETVY
LTIISDQLRHDLIYESIDVELLTSFFKNQIWNFKIDVINKLATIKHNWRL
IDLRLSNSPNSIKQNDIEIIVISNDGRWLLSFGGTKNSDSYQLSVKHSQV
ECQKVTEWKSINLLMFQKKLIKNDLETIDVLLTAWR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003712transcription cofactor activity
GO:0001104RNA polymerase II transcription cofactor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR019313Mediator_Med17
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: cellular component
TermDefinition
GO:0016592mediator complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019313Mediator complex, subunit Med17PANTHERPTHR13114TRANSCRIPTIONAL CO-ACTIVATOR CRSP77-RELATEDcoord: 7..582
NoneNo IPR availablePANTHERPTHR13114:SF7MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 17coord: 7..582